diff --git a/frameworks/accesstoken/BUILD.gn b/frameworks/accesstoken/BUILD.gn
index bdc63b3da30b7ead14e4ff3c6d81c18a9102c78c..d43f760308c46a0d5c093d95d389dac037641e62 100644
--- a/frameworks/accesstoken/BUILD.gn
+++ b/frameworks/accesstoken/BUILD.gn
@@ -1,55 +1,55 @@
-# Copyright (c) 2021-2022 Huawei Device Co., Ltd.
-# Licensed under the Apache License, Version 2.0 (the "License");
-# you may not use this file except in compliance with the License.
-# You may obtain a copy of the License at
-#
-#     http://www.apache.org/licenses/LICENSE-2.0
-#
-# Unless required by applicable law or agreed to in writing, software
-# distributed under the License is distributed on an "AS IS" BASIS,
-# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-# See the License for the specific language governing permissions and
-# limitations under the License.
-
-import("//build/ohos.gni")
-
-config("accesstoken_communication_adapter_cxx_public_config") {
-  visibility = [ ":*" ]
-  include_dirs = [
-    "include",
-    "//base/security/access_token/frameworks/common/include",
-    "//base/security/access_token/interfaces/innerkits/accesstoken/include",
-  ]
-}
-
-ohos_shared_library("accesstoken_communication_adapter_cxx") {
-  subsystem_name = "security"
-  part_name = "access_token"
-
-  public_configs = [ ":accesstoken_communication_adapter_cxx_public_config" ]
-
-  include_dirs = [
-    "include",
-    "//base/security/access_token/interfaces/innerkits/accesstoken/include",
-    "//commonlibrary/c_utils/base/include",
-  ]
-
-  sources = [
-    "src/hap_info_parcel.cpp",
-    "src/hap_policy_parcel.cpp",
-    "src/hap_token_info_for_sync_parcel.cpp",
-    "src/hap_token_info_parcel.cpp",
-    "src/native_token_info_for_sync_parcel.cpp",
-    "src/native_token_info_parcel.cpp",
-    "src/permission_def_parcel.cpp",
-    "src/permission_list_state_parcel.cpp",
-    "src/permission_state_change_info_parcel.cpp",
-    "src/permission_state_change_scope_parcel.cpp",
-    "src/permission_state_full_parcel.cpp",
-  ]
-
-  external_deps = [
-    "c_utils:utils",
-    "ipc:ipc_single",
-  ]
-}
+# Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+# Licensed under the Apache License, Version 2.0 (the "License");
+# you may not use this file except in compliance with the License.
+# You may obtain a copy of the License at
+#
+#     http://www.apache.org/licenses/LICENSE-2.0
+#
+# Unless required by applicable law or agreed to in writing, software
+# distributed under the License is distributed on an "AS IS" BASIS,
+# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+# See the License for the specific language governing permissions and
+# limitations under the License.
+
+import("//build/ohos.gni")
+
+config("accesstoken_communication_adapter_cxx_public_config") {
+  visibility = [ ":*" ]
+  include_dirs = [
+    "include",
+    "//base/security/access_token/frameworks/common/include",
+    "//base/security/access_token/interfaces/innerkits/accesstoken/include",
+  ]
+}
+
+ohos_shared_library("accesstoken_communication_adapter_cxx") {
+  subsystem_name = "security"
+  part_name = "access_token"
+
+  public_configs = [ ":accesstoken_communication_adapter_cxx_public_config" ]
+
+  include_dirs = [
+    "include",
+    "//base/security/access_token/interfaces/innerkits/accesstoken/include",
+    "//commonlibrary/c_utils/base/include",
+  ]
+
+  sources = [
+    "src/hap_info_parcel.cpp",
+    "src/hap_policy_parcel.cpp",
+    "src/hap_token_info_for_sync_parcel.cpp",
+    "src/hap_token_info_parcel.cpp",
+    "src/native_token_info_for_sync_parcel.cpp",
+    "src/native_token_info_parcel.cpp",
+    "src/permission_def_parcel.cpp",
+    "src/permission_list_state_parcel.cpp",
+    "src/permission_state_change_info_parcel.cpp",
+    "src/permission_state_change_scope_parcel.cpp",
+    "src/permission_state_full_parcel.cpp",
+  ]
+
+  external_deps = [
+    "c_utils:utils",
+    "ipc:ipc_single",
+  ]
+}
diff --git a/frameworks/accesstoken/include/hap_token_info_for_sync_parcel.h b/frameworks/accesstoken/include/hap_token_info_for_sync_parcel.h
index b0c838402a24fb0c18e96943fc6d451a023cb802..33d01bad803b9671aefda7f7a1468ca07a90d75a 100644
--- a/frameworks/accesstoken/include/hap_token_info_for_sync_parcel.h
+++ b/frameworks/accesstoken/include/hap_token_info_for_sync_parcel.h
@@ -1,40 +1,40 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef HAP_TOKEN_INFO_FOR_SYNC_PARCEL_H
-#define HAP_TOKEN_INFO_FOR_SYNC_PARCEL_H
-
-#include "hap_token_info.h"
-#include "parcel.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-struct HapTokenInfoForSyncParcel final : public Parcelable {
-    HapTokenInfoForSyncParcel() = default;
-
-    ~HapTokenInfoForSyncParcel() override = default;
-
-    bool Marshalling(Parcel &out) const override;
-
-    static HapTokenInfoForSyncParcel *Unmarshalling(Parcel &in);
-
-    HapTokenInfoForSync hapTokenInfoForSyncParams;
-};
-}  // namespace AccessToken
-}  // namespace Security
-}  // namespace OHOS
-#endif  // HAP_TOKEN_INFO_FOR_SYNC_PARCEL_H
-
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef HAP_TOKEN_INFO_FOR_SYNC_PARCEL_H
+#define HAP_TOKEN_INFO_FOR_SYNC_PARCEL_H
+
+#include "hap_token_info.h"
+#include "parcel.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+struct HapTokenInfoForSyncParcel final : public Parcelable {
+    HapTokenInfoForSyncParcel() = default;
+
+    ~HapTokenInfoForSyncParcel() override = default;
+
+    bool Marshalling(Parcel &out) const override;
+
+    static HapTokenInfoForSyncParcel *Unmarshalling(Parcel &in);
+
+    HapTokenInfoForSync hapTokenInfoForSyncParams;
+};
+}  // namespace AccessToken
+}  // namespace Security
+}  // namespace OHOS
+#endif  // HAP_TOKEN_INFO_FOR_SYNC_PARCEL_H
+
diff --git a/frameworks/accesstoken/include/i_accesstoken_manager.h b/frameworks/accesstoken/include/i_accesstoken_manager.h
index d5216bf647b3a3e34ed332314c8ad51d14ca6067..323adb37dd36c274287a3b93aaf66b792077c7c8 100644
--- a/frameworks/accesstoken/include/i_accesstoken_manager.h
+++ b/frameworks/accesstoken/include/i_accesstoken_manager.h
@@ -1,124 +1,124 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef I_ACCESSTOKEN_MANAGER_H
-#define I_ACCESSTOKEN_MANAGER_H
-
-#include <string>
-
-#include "access_token.h"
-#include "errors.h"
-#include "hap_info_parcel.h"
-#include "hap_policy_parcel.h"
-#include "hap_token_info_for_sync_parcel.h"
-#include "hap_token_info_parcel.h"
-#include "iremote_broker.h"
-#include "i_permission_state_callback.h"
-#include "native_token_info_for_sync_parcel.h"
-#include "native_token_info_parcel.h"
-#include "permission_def_parcel.h"
-#include "permission_list_state_parcel.h"
-#include "permission_state_full_parcel.h"
-#include "permission_state_change_scope_parcel.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class IAccessTokenManager : public IRemoteBroker {
-public:
-    static const int SA_ID_ACCESSTOKEN_MANAGER_SERVICE = 3503;
-
-    DECLARE_INTERFACE_DESCRIPTOR(u"ohos.security.accesstoken.IAccessTokenManager");
-
-    virtual int VerifyAccessToken(AccessTokenID tokenID, const std::string& permissionName) = 0;
-    virtual int VerifyNativeToken(AccessTokenID tokenID, const std::string& permissionName) = 0;
-    virtual int GetDefPermission(const std::string& permissionName, PermissionDefParcel& permissionDefResult) = 0;
-    virtual int GetDefPermissions(AccessTokenID tokenID, std::vector<PermissionDefParcel>& permList) = 0;
-    virtual int GetReqPermissions(
-        AccessTokenID tokenID, std::vector<PermissionStateFullParcel>& reqPermList, bool isSystemGrant) = 0;
-    virtual int GetPermissionFlag(AccessTokenID tokenID, const std::string& permissionName) = 0;
-    virtual PermissionOper GetSelfPermissionsState(
-        std::vector<PermissionListStateParcel>& permListParcel) = 0;
-    virtual int GrantPermission(AccessTokenID tokenID, const std::string& permissionName, int flag) = 0;
-    virtual int RevokePermission(AccessTokenID tokenID, const std::string& permissionName, int flag) = 0;
-    virtual int ClearUserGrantedPermissionState(AccessTokenID tokenID) = 0;
-    virtual AccessTokenIDEx AllocHapToken(const HapInfoParcel& hapInfo, const HapPolicyParcel& policyParcel) = 0;
-    virtual int DeleteToken(AccessTokenID tokenID) = 0;
-    virtual int GetTokenType(AccessTokenID tokenID) = 0;
-    virtual int CheckNativeDCap(AccessTokenID tokenID, const std::string& dcap) = 0;
-    virtual AccessTokenID GetHapTokenID(int userID, const std::string& bundleName, int instIndex) = 0;
-    virtual AccessTokenID AllocLocalTokenID(const std::string& remoteDeviceID, AccessTokenID remoteTokenID) = 0;
-    virtual int GetNativeTokenInfo(AccessTokenID tokenID, NativeTokenInfoParcel& nativeTokenInfoRes) = 0;
-    virtual int GetHapTokenInfo(AccessTokenID tokenID, HapTokenInfoParcel& hapTokenInfoRes) = 0;
-    virtual int UpdateHapToken(AccessTokenID tokenID, const std::string& appIDDesc, int32_t apiVersion,
-        const HapPolicyParcel& policyParcel) = 0;
-    virtual int32_t RegisterPermStateChangeCallback(
-        const PermStateChangeScopeParcel& scope, const sptr<IRemoteObject>& callback) = 0;
-    virtual int32_t UnRegisterPermStateChangeCallback(const sptr<IRemoteObject>& callback) = 0;
-
-#ifdef TOKEN_SYNC_ENABLE
-    virtual int GetHapTokenInfoFromRemote(AccessTokenID tokenID,
-        HapTokenInfoForSyncParcel& hapSyncParcel) = 0;
-    virtual int GetAllNativeTokenInfo(std::vector<NativeTokenInfoForSyncParcel>& nativeTokenInfoRes)  = 0;
-    virtual int SetRemoteHapTokenInfo(const std::string& deviceID,
-        HapTokenInfoForSyncParcel& hapSyncParcel) = 0;
-    virtual int SetRemoteNativeTokenInfo(const std::string& deviceID,
-        std::vector<NativeTokenInfoForSyncParcel>& nativeTokenInfoForSyncParcel)  = 0;
-    virtual int DeleteRemoteToken(const std::string& deviceID, AccessTokenID tokenID) = 0;
-    virtual AccessTokenID GetRemoteNativeTokenID(const std::string& deviceID, AccessTokenID tokenID) = 0;
-    virtual int DeleteRemoteDeviceTokens(const std::string& deviceID)  = 0;
-#endif
-
-    virtual void DumpTokenInfo(AccessTokenID tokenID, std::string& tokenInfo) = 0;
-
-    enum class InterfaceCode {
-        VERIFY_ACCESSTOKEN = 0xff10,
-        GET_DEF_PERMISSION = 0xff11,
-        GET_DEF_PERMISSIONS = 0xff12,
-        GET_REQ_PERMISSIONS = 0xff13,
-        GET_PERMISSION_FLAG = 0xff14,
-        GRANT_PERMISSION = 0xff15,
-        REVOKE_PERMISSION = 0xff16,
-        CLEAR_USER_GRANT_PERMISSION = 0xff17,
-        ALLOC_TOKEN_HAP = 0xff18,
-        TOKEN_DELETE = 0xff19,
-        GET_TOKEN_TYPE = 0xff20,
-        CHECK_NATIVE_DCAP = 0xff21,
-        GET_HAP_TOKEN_ID = 0xff22,
-        ALLOC_LOCAL_TOKEN_ID = 0xff23,
-        GET_NATIVE_TOKENINFO = 0xff24,
-        GET_HAP_TOKENINFO = 0xff25,
-        UPDATE_HAP_TOKEN = 0xff26,
-
-        GET_HAP_TOKEN_FROM_REMOTE = 0xff27,
-        GET_ALL_NATIVE_TOKEN_FROM_REMOTE = 0xff28,
-        SET_REMOTE_HAP_TOKEN_INFO = 0xff29,
-        SET_REMOTE_NATIVE_TOKEN_INFO = 0xff2a,
-        DELETE_REMOTE_TOKEN_INFO = 0xff2b,
-        DELETE_REMOTE_DEVICE_TOKEN = 0xff2c,
-        VERIFY_NATIVETOKEN = 0xff2d,
-        GET_NATIVE_REMOTE_TOKEN = 0xff2f,
-
-        DUMP_TOKENINFO = 0xff30,
-        GET_PERMISSION_OPER_STATE = 0xff31,
-        REGISTER_PERM_STATE_CHANGE_CALLBACK = 0xff32,
-        UNREGISTER_PERM_STATE_CHANGE_CALLBACK = 0xff33,
-    };
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-
-#endif // I_ACCESSTOKEN_MANAGER_H
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef I_ACCESSTOKEN_MANAGER_H
+#define I_ACCESSTOKEN_MANAGER_H
+
+#include <string>
+
+#include "access_token.h"
+#include "errors.h"
+#include "hap_info_parcel.h"
+#include "hap_policy_parcel.h"
+#include "hap_token_info_for_sync_parcel.h"
+#include "hap_token_info_parcel.h"
+#include "iremote_broker.h"
+#include "i_permission_state_callback.h"
+#include "native_token_info_for_sync_parcel.h"
+#include "native_token_info_parcel.h"
+#include "permission_def_parcel.h"
+#include "permission_list_state_parcel.h"
+#include "permission_state_full_parcel.h"
+#include "permission_state_change_scope_parcel.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class IAccessTokenManager : public IRemoteBroker {
+public:
+    static const int SA_ID_ACCESSTOKEN_MANAGER_SERVICE = 3503;
+
+    DECLARE_INTERFACE_DESCRIPTOR(u"ohos.security.accesstoken.IAccessTokenManager");
+
+    virtual int VerifyAccessToken(AccessTokenID tokenID, const std::string& permissionName) = 0;
+    virtual int VerifyNativeToken(AccessTokenID tokenID, const std::string& permissionName) = 0;
+    virtual int GetDefPermission(const std::string& permissionName, PermissionDefParcel& permissionDefResult) = 0;
+    virtual int GetDefPermissions(AccessTokenID tokenID, std::vector<PermissionDefParcel>& permList) = 0;
+    virtual int GetReqPermissions(
+        AccessTokenID tokenID, std::vector<PermissionStateFullParcel>& reqPermList, bool isSystemGrant) = 0;
+    virtual int GetPermissionFlag(AccessTokenID tokenID, const std::string& permissionName) = 0;
+    virtual PermissionOper GetSelfPermissionsState(
+        std::vector<PermissionListStateParcel>& permListParcel) = 0;
+    virtual int GrantPermission(AccessTokenID tokenID, const std::string& permissionName, int flag) = 0;
+    virtual int RevokePermission(AccessTokenID tokenID, const std::string& permissionName, int flag) = 0;
+    virtual int ClearUserGrantedPermissionState(AccessTokenID tokenID) = 0;
+    virtual AccessTokenIDEx AllocHapToken(const HapInfoParcel& hapInfo, const HapPolicyParcel& policyParcel) = 0;
+    virtual int DeleteToken(AccessTokenID tokenID) = 0;
+    virtual int GetTokenType(AccessTokenID tokenID) = 0;
+    virtual int CheckNativeDCap(AccessTokenID tokenID, const std::string& dcap) = 0;
+    virtual AccessTokenID GetHapTokenID(int userID, const std::string& bundleName, int instIndex) = 0;
+    virtual AccessTokenID AllocLocalTokenID(const std::string& remoteDeviceID, AccessTokenID remoteTokenID) = 0;
+    virtual int GetNativeTokenInfo(AccessTokenID tokenID, NativeTokenInfoParcel& nativeTokenInfoRes) = 0;
+    virtual int GetHapTokenInfo(AccessTokenID tokenID, HapTokenInfoParcel& hapTokenInfoRes) = 0;
+    virtual int UpdateHapToken(AccessTokenID tokenID, const std::string& appIDDesc, int32_t apiVersion,
+        const HapPolicyParcel& policyParcel) = 0;
+    virtual int32_t RegisterPermStateChangeCallback(
+        const PermStateChangeScopeParcel& scope, const sptr<IRemoteObject>& callback) = 0;
+    virtual int32_t UnRegisterPermStateChangeCallback(const sptr<IRemoteObject>& callback) = 0;
+
+#ifdef TOKEN_SYNC_ENABLE
+    virtual int GetHapTokenInfoFromRemote(AccessTokenID tokenID,
+        HapTokenInfoForSyncParcel& hapSyncParcel) = 0;
+    virtual int GetAllNativeTokenInfo(std::vector<NativeTokenInfoForSyncParcel>& nativeTokenInfoRes)  = 0;
+    virtual int SetRemoteHapTokenInfo(const std::string& deviceID,
+        HapTokenInfoForSyncParcel& hapSyncParcel) = 0;
+    virtual int SetRemoteNativeTokenInfo(const std::string& deviceID,
+        std::vector<NativeTokenInfoForSyncParcel>& nativeTokenInfoForSyncParcel)  = 0;
+    virtual int DeleteRemoteToken(const std::string& deviceID, AccessTokenID tokenID) = 0;
+    virtual AccessTokenID GetRemoteNativeTokenID(const std::string& deviceID, AccessTokenID tokenID) = 0;
+    virtual int DeleteRemoteDeviceTokens(const std::string& deviceID)  = 0;
+#endif
+
+    virtual void DumpTokenInfo(AccessTokenID tokenID, std::string& tokenInfo) = 0;
+
+    enum class InterfaceCode {
+        VERIFY_ACCESSTOKEN = 0xff10,
+        GET_DEF_PERMISSION = 0xff11,
+        GET_DEF_PERMISSIONS = 0xff12,
+        GET_REQ_PERMISSIONS = 0xff13,
+        GET_PERMISSION_FLAG = 0xff14,
+        GRANT_PERMISSION = 0xff15,
+        REVOKE_PERMISSION = 0xff16,
+        CLEAR_USER_GRANT_PERMISSION = 0xff17,
+        ALLOC_TOKEN_HAP = 0xff18,
+        TOKEN_DELETE = 0xff19,
+        GET_TOKEN_TYPE = 0xff20,
+        CHECK_NATIVE_DCAP = 0xff21,
+        GET_HAP_TOKEN_ID = 0xff22,
+        ALLOC_LOCAL_TOKEN_ID = 0xff23,
+        GET_NATIVE_TOKENINFO = 0xff24,
+        GET_HAP_TOKENINFO = 0xff25,
+        UPDATE_HAP_TOKEN = 0xff26,
+
+        GET_HAP_TOKEN_FROM_REMOTE = 0xff27,
+        GET_ALL_NATIVE_TOKEN_FROM_REMOTE = 0xff28,
+        SET_REMOTE_HAP_TOKEN_INFO = 0xff29,
+        SET_REMOTE_NATIVE_TOKEN_INFO = 0xff2a,
+        DELETE_REMOTE_TOKEN_INFO = 0xff2b,
+        DELETE_REMOTE_DEVICE_TOKEN = 0xff2c,
+        VERIFY_NATIVETOKEN = 0xff2d,
+        GET_NATIVE_REMOTE_TOKEN = 0xff2f,
+
+        DUMP_TOKENINFO = 0xff30,
+        GET_PERMISSION_OPER_STATE = 0xff31,
+        REGISTER_PERM_STATE_CHANGE_CALLBACK = 0xff32,
+        UNREGISTER_PERM_STATE_CHANGE_CALLBACK = 0xff33,
+    };
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+
+#endif // I_ACCESSTOKEN_MANAGER_H
diff --git a/frameworks/accesstoken/include/i_permission_state_callback.h b/frameworks/accesstoken/include/i_permission_state_callback.h
index 508f28c1e0835b77563c49633fcb4cd25590f13c..9ec9b13dc86af14cdd66f2aaa73990b585e47e78 100644
--- a/frameworks/accesstoken/include/i_permission_state_callback.h
+++ b/frameworks/accesstoken/include/i_permission_state_callback.h
@@ -1,43 +1,43 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef I_PERMISSION_STATE_CALLBACK_H
-#define I_PERMISSION_STATE_CALLBACK_H
-
-#include <string>
-
-#include "access_token.h"
-#include "errors.h"
-#include "iremote_broker.h"
-#include "permission_state_change_info.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class IPermissionStateCallback : public IRemoteBroker {
-public:
-    DECLARE_INTERFACE_DESCRIPTOR(u"ohos.security.accesstoken.IPermissionStateCallback");
-
-    virtual void PermStateChangeCallback(PermStateChangeInfo& result) = 0;
-
-    enum {
-        PERMISSION_STATE_CHANGE = 0,
-    };
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-
-#endif // I_PERMISSION_STATE_CALLBACK_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef I_PERMISSION_STATE_CALLBACK_H
+#define I_PERMISSION_STATE_CALLBACK_H
+
+#include <string>
+
+#include "access_token.h"
+#include "errors.h"
+#include "iremote_broker.h"
+#include "permission_state_change_info.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class IPermissionStateCallback : public IRemoteBroker {
+public:
+    DECLARE_INTERFACE_DESCRIPTOR(u"ohos.security.accesstoken.IPermissionStateCallback");
+
+    virtual void PermStateChangeCallback(PermStateChangeInfo& result) = 0;
+
+    enum {
+        PERMISSION_STATE_CHANGE = 0,
+    };
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+
+#endif // I_PERMISSION_STATE_CALLBACK_H
diff --git a/frameworks/accesstoken/include/native_token_info_for_sync_parcel.h b/frameworks/accesstoken/include/native_token_info_for_sync_parcel.h
index a4b6b397cf9d2f4c83d8291ae38f71b7829ad79d..fe7b5bd46ccde88fdd14a9db6b00cadaeb800656 100644
--- a/frameworks/accesstoken/include/native_token_info_for_sync_parcel.h
+++ b/frameworks/accesstoken/include/native_token_info_for_sync_parcel.h
@@ -1,40 +1,40 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef NATIVE_TOKEN_INFO_FOR_SYNC_PARCEL_H
-#define NATIVE_TOKEN_INFO_FOR_SYNC_PARCEL_H
-
-#include "native_token_info.h"
-#include "parcel.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-struct NativeTokenInfoForSyncParcel final : public Parcelable {
-    NativeTokenInfoForSyncParcel() = default;
-
-    ~NativeTokenInfoForSyncParcel() override = default;
-
-    bool Marshalling(Parcel &out) const override;
-
-    static NativeTokenInfoForSyncParcel *Unmarshalling(Parcel &in);
-
-    NativeTokenInfoForSync nativeTokenInfoForSyncParams;
-};
-}  // namespace AccessToken
-}  // namespace Security
-}  // namespace OHOS
-#endif  // NATIVE_TOKEN_INFO_FOR_SYNC_PARCEL_H
-
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef NATIVE_TOKEN_INFO_FOR_SYNC_PARCEL_H
+#define NATIVE_TOKEN_INFO_FOR_SYNC_PARCEL_H
+
+#include "native_token_info.h"
+#include "parcel.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+struct NativeTokenInfoForSyncParcel final : public Parcelable {
+    NativeTokenInfoForSyncParcel() = default;
+
+    ~NativeTokenInfoForSyncParcel() override = default;
+
+    bool Marshalling(Parcel &out) const override;
+
+    static NativeTokenInfoForSyncParcel *Unmarshalling(Parcel &in);
+
+    NativeTokenInfoForSync nativeTokenInfoForSyncParams;
+};
+}  // namespace AccessToken
+}  // namespace Security
+}  // namespace OHOS
+#endif  // NATIVE_TOKEN_INFO_FOR_SYNC_PARCEL_H
+
diff --git a/frameworks/accesstoken/include/permission_def_parcel.h b/frameworks/accesstoken/include/permission_def_parcel.h
index c509deb9167cc207010e5d44fd18c53477f889ec..fe4fb536636cddc33ab087c25dcfcb3fb3431c8f 100644
--- a/frameworks/accesstoken/include/permission_def_parcel.h
+++ b/frameworks/accesstoken/include/permission_def_parcel.h
@@ -1,39 +1,39 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef PERMISSION_DEF_PARCEL_H
-#define PERMISSION_DEF_PARCEL_H
-
-#include "permission_def.h"
-#include "parcel.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-struct PermissionDefParcel final : public Parcelable {
-    PermissionDefParcel() = default;
-
-    ~PermissionDefParcel() override = default;
-
-    bool Marshalling(Parcel &out) const override;
-
-    static PermissionDefParcel *Unmarshalling(Parcel &in);
-
-    PermissionDef permissionDef;
-};
-}  // namespace AccessToken
-}  // namespace Security
-}  // namespace OHOS
-#endif  // PERMISSION_DEF_PARCEL_H
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef PERMISSION_DEF_PARCEL_H
+#define PERMISSION_DEF_PARCEL_H
+
+#include "permission_def.h"
+#include "parcel.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+struct PermissionDefParcel final : public Parcelable {
+    PermissionDefParcel() = default;
+
+    ~PermissionDefParcel() override = default;
+
+    bool Marshalling(Parcel &out) const override;
+
+    static PermissionDefParcel *Unmarshalling(Parcel &in);
+
+    PermissionDef permissionDef;
+};
+}  // namespace AccessToken
+}  // namespace Security
+}  // namespace OHOS
+#endif  // PERMISSION_DEF_PARCEL_H
diff --git a/frameworks/accesstoken/include/permission_list_state_parcel.h b/frameworks/accesstoken/include/permission_list_state_parcel.h
index c2c180fae5598dfacde63c1ba8601c6f2879651e..bb7c7c36d7aa37d736b315ab84cc0e61c046a6b6 100644
--- a/frameworks/accesstoken/include/permission_list_state_parcel.h
+++ b/frameworks/accesstoken/include/permission_list_state_parcel.h
@@ -1,39 +1,39 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef INTERFACES_INNER_KITS_PERMISSION_PERMISSION_LIST_STATE_PARCEL_H
-#define INTERFACES_INNER_KITS_PERMISSION_PERMISSION_LIST_STATE_PARCEL_H
-
-#include "permission_list_state.h"
-#include "parcel.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-struct PermissionListStateParcel final : public Parcelable {
-    PermissionListStateParcel() = default;
-
-    ~PermissionListStateParcel() override = default;
-
-    bool Marshalling(Parcel &out) const override;
-
-    static PermissionListStateParcel *Unmarshalling(Parcel &in);
-
-    PermissionListState permsState;
-};
-}  // namespace AccessToken
-}  // namespace Security
-}  // namespace OHOS
-#endif  // INTERFACES_INNER_KITS_PERMISSION_PERMISSION_LIST_STATE_PARCEL_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef INTERFACES_INNER_KITS_PERMISSION_PERMISSION_LIST_STATE_PARCEL_H
+#define INTERFACES_INNER_KITS_PERMISSION_PERMISSION_LIST_STATE_PARCEL_H
+
+#include "permission_list_state.h"
+#include "parcel.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+struct PermissionListStateParcel final : public Parcelable {
+    PermissionListStateParcel() = default;
+
+    ~PermissionListStateParcel() override = default;
+
+    bool Marshalling(Parcel &out) const override;
+
+    static PermissionListStateParcel *Unmarshalling(Parcel &in);
+
+    PermissionListState permsState;
+};
+}  // namespace AccessToken
+}  // namespace Security
+}  // namespace OHOS
+#endif  // INTERFACES_INNER_KITS_PERMISSION_PERMISSION_LIST_STATE_PARCEL_H
diff --git a/frameworks/accesstoken/include/permission_state_change_info_parcel.h b/frameworks/accesstoken/include/permission_state_change_info_parcel.h
index eb95593c328e9f76b399913d3b169ae559a18983..635822d2e2fc6627f0cc739d98ea8e7051d757cf 100644
--- a/frameworks/accesstoken/include/permission_state_change_info_parcel.h
+++ b/frameworks/accesstoken/include/permission_state_change_info_parcel.h
@@ -1,40 +1,40 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef PERMISSION_STATE_CHANGE_INFO_PARCEL_H
-#define PERMISSION_STATE_CHANGE_INFO_PARCEL_H
-
-#include "parcel.h"
-#include "permission_state_change_info.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-struct PermissionStateChangeInfoParcel final : public Parcelable {
-    PermissionStateChangeInfoParcel() = default;
-
-    ~PermissionStateChangeInfoParcel() override = default;
-
-    bool Marshalling(Parcel& out) const override;
-
-    static PermissionStateChangeInfoParcel* Unmarshalling(Parcel& in);
-
-    PermStateChangeInfo changeInfo;
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-
-#endif // PERMISSION_STATE_CHANGE_INFO_PARCEL_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef PERMISSION_STATE_CHANGE_INFO_PARCEL_H
+#define PERMISSION_STATE_CHANGE_INFO_PARCEL_H
+
+#include "parcel.h"
+#include "permission_state_change_info.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+struct PermissionStateChangeInfoParcel final : public Parcelable {
+    PermissionStateChangeInfoParcel() = default;
+
+    ~PermissionStateChangeInfoParcel() override = default;
+
+    bool Marshalling(Parcel& out) const override;
+
+    static PermissionStateChangeInfoParcel* Unmarshalling(Parcel& in);
+
+    PermStateChangeInfo changeInfo;
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+
+#endif // PERMISSION_STATE_CHANGE_INFO_PARCEL_H
diff --git a/frameworks/accesstoken/include/permission_state_change_scope_parcel.h b/frameworks/accesstoken/include/permission_state_change_scope_parcel.h
index e1988a8f27bcc112fa80722991116954c28122eb..1256356fa7752a5128103e85c408ea6520e5cf5b 100644
--- a/frameworks/accesstoken/include/permission_state_change_scope_parcel.h
+++ b/frameworks/accesstoken/include/permission_state_change_scope_parcel.h
@@ -1,40 +1,40 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef PERMISSION_STATE_CHANGE_SCOPE_PARCEL_H
-#define PERMISSION_STATE_CHANGE_SCOPE_PARCEL_H
-
-#include "parcel.h"
-#include "permission_state_change_info.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-struct PermStateChangeScopeParcel final : public Parcelable {
-    PermStateChangeScopeParcel() = default;
-
-    ~PermStateChangeScopeParcel() override = default;
-
-    bool Marshalling(Parcel& out) const override;
-
-    static PermStateChangeScopeParcel* Unmarshalling(Parcel& in);
-
-    PermStateChangeScope scope;
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-
-#endif // PERMISSION_STATE_CHANGE_SCOPE_PARCEL_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef PERMISSION_STATE_CHANGE_SCOPE_PARCEL_H
+#define PERMISSION_STATE_CHANGE_SCOPE_PARCEL_H
+
+#include "parcel.h"
+#include "permission_state_change_info.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+struct PermStateChangeScopeParcel final : public Parcelable {
+    PermStateChangeScopeParcel() = default;
+
+    ~PermStateChangeScopeParcel() override = default;
+
+    bool Marshalling(Parcel& out) const override;
+
+    static PermStateChangeScopeParcel* Unmarshalling(Parcel& in);
+
+    PermStateChangeScope scope;
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+
+#endif // PERMISSION_STATE_CHANGE_SCOPE_PARCEL_H
diff --git a/frameworks/accesstoken/include/permission_state_full_parcel.h b/frameworks/accesstoken/include/permission_state_full_parcel.h
index 71e869ed1ef93fd7b1d968ee6e2dcc00bb30eb13..af7177b109dcc5191af6c36f168c125d212e6405 100644
--- a/frameworks/accesstoken/include/permission_state_full_parcel.h
+++ b/frameworks/accesstoken/include/permission_state_full_parcel.h
@@ -1,39 +1,39 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef INTERFACES_INNER_KITS_PERMISSION_PERMISSION_STATE_FULL_PARCEL_H
-#define INTERFACES_INNER_KITS_PERMISSION_PERMISSION_STATE_FULL_PARCEL_H
-
-#include "permission_state_full.h"
-#include "parcel.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-struct PermissionStateFullParcel final : public Parcelable {
-    PermissionStateFullParcel() = default;
-
-    ~PermissionStateFullParcel() override = default;
-
-    bool Marshalling(Parcel &out) const override;
-
-    static PermissionStateFullParcel *Unmarshalling(Parcel &in);
-
-    PermissionStateFull permStatFull;
-};
-}  // namespace AccessToken
-}  // namespace Security
-}  // namespace OHOS
-#endif  // INTERFACES_INNER_KITS_PERMISSION_PERMISSION_STATE_FULL_PARCEL_H
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef INTERFACES_INNER_KITS_PERMISSION_PERMISSION_STATE_FULL_PARCEL_H
+#define INTERFACES_INNER_KITS_PERMISSION_PERMISSION_STATE_FULL_PARCEL_H
+
+#include "permission_state_full.h"
+#include "parcel.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+struct PermissionStateFullParcel final : public Parcelable {
+    PermissionStateFullParcel() = default;
+
+    ~PermissionStateFullParcel() override = default;
+
+    bool Marshalling(Parcel &out) const override;
+
+    static PermissionStateFullParcel *Unmarshalling(Parcel &in);
+
+    PermissionStateFull permStatFull;
+};
+}  // namespace AccessToken
+}  // namespace Security
+}  // namespace OHOS
+#endif  // INTERFACES_INNER_KITS_PERMISSION_PERMISSION_STATE_FULL_PARCEL_H
diff --git a/frameworks/accesstoken/src/hap_policy_parcel.cpp b/frameworks/accesstoken/src/hap_policy_parcel.cpp
index 6bbccf7de8c1db04c83497277681c1fb2e2b48f3..c37e589b5aa18983044c4fa54feceab7f740828a 100644
--- a/frameworks/accesstoken/src/hap_policy_parcel.cpp
+++ b/frameworks/accesstoken/src/hap_policy_parcel.cpp
@@ -1,87 +1,87 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "hap_policy_parcel.h"
-#include "refbase.h"
-#include "access_token.h"
-#include "parcel_utils.h"
-#include "permission_def.h"
-#include "permission_def_parcel.h"
-#include "permission_state_full.h"
-#include "permission_state_full_parcel.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-bool HapPolicyParcel::Marshalling(Parcel& out) const
-{
-    RETURN_IF_FALSE(out.WriteInt32(this->hapPolicyParameter.apl));
-    RETURN_IF_FALSE(out.WriteString(this->hapPolicyParameter.domain));
-
-    const std::vector<PermissionDef>& permList = this->hapPolicyParameter.permList;
-    int32_t permListSize = static_cast<int32_t>(permList.size());
-    RETURN_IF_FALSE(out.WriteInt32(permListSize));
-
-    for (int i = 0; i < permListSize; i++) {
-        PermissionDefParcel permDefParcel;
-        permDefParcel.permissionDef = permList[i];
-        out.WriteParcelable(&permDefParcel);
-    }
-
-    const std::vector<PermissionStateFull>& permStateList = this->hapPolicyParameter.permStateList;
-    int32_t permStateListSize = static_cast<int32_t>(permStateList.size());
-    RETURN_IF_FALSE(out.WriteInt32(permStateListSize));
-
-    for (int i = 0; i < permStateListSize; i++) {
-        PermissionStateFullParcel permStateParcel;
-        permStateParcel.permStatFull = permStateList[i];
-        out.WriteParcelable(&permStateParcel);
-    }
-
-    return true;
-}
-
-HapPolicyParcel* HapPolicyParcel::Unmarshalling(Parcel& in)
-{
-    auto* hapPolicyParcel = new (std::nothrow) HapPolicyParcel();
-    RELEASE_IF_FALSE(hapPolicyParcel != nullptr, hapPolicyParcel);
-
-    int32_t apl;
-    RELEASE_IF_FALSE(in.ReadInt32(apl), hapPolicyParcel);
-    hapPolicyParcel->hapPolicyParameter.apl = ATokenAplEnum(apl);
-
-    hapPolicyParcel->hapPolicyParameter.domain = in.ReadString();
-
-    int permListSize;
-    RELEASE_IF_FALSE(in.ReadInt32(permListSize), hapPolicyParcel);
-
-    for (int i = 0; i < permListSize; i++) {
-        sptr<PermissionDefParcel> permDefParcel = in.ReadParcelable<PermissionDefParcel>();
-        RELEASE_IF_FALSE(permDefParcel != nullptr, hapPolicyParcel);
-        hapPolicyParcel->hapPolicyParameter.permList.emplace_back(permDefParcel->permissionDef);
-    }
-
-    int permStateListSize;
-    RELEASE_IF_FALSE(in.ReadInt32(permStateListSize), hapPolicyParcel);
-    for (int i = 0; i < permStateListSize; i++) {
-        sptr<PermissionStateFullParcel> permissionStateParcel = in.ReadParcelable<PermissionStateFullParcel>();
-        RELEASE_IF_FALSE(permissionStateParcel != nullptr, hapPolicyParcel);
-        hapPolicyParcel->hapPolicyParameter.permStateList.emplace_back(permissionStateParcel->permStatFull);
-    }
-    return hapPolicyParcel;
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "hap_policy_parcel.h"
+#include "refbase.h"
+#include "access_token.h"
+#include "parcel_utils.h"
+#include "permission_def.h"
+#include "permission_def_parcel.h"
+#include "permission_state_full.h"
+#include "permission_state_full_parcel.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+bool HapPolicyParcel::Marshalling(Parcel& out) const
+{
+    RETURN_IF_FALSE(out.WriteInt32(this->hapPolicyParameter.apl));
+    RETURN_IF_FALSE(out.WriteString(this->hapPolicyParameter.domain));
+
+    const std::vector<PermissionDef>& permList = this->hapPolicyParameter.permList;
+    int32_t permListSize = static_cast<int32_t>(permList.size());
+    RETURN_IF_FALSE(out.WriteInt32(permListSize));
+
+    for (int i = 0; i < permListSize; i++) {
+        PermissionDefParcel permDefParcel;
+        permDefParcel.permissionDef = permList[i];
+        out.WriteParcelable(&permDefParcel);
+    }
+
+    const std::vector<PermissionStateFull>& permStateList = this->hapPolicyParameter.permStateList;
+    int32_t permStateListSize = static_cast<int32_t>(permStateList.size());
+    RETURN_IF_FALSE(out.WriteInt32(permStateListSize));
+
+    for (int i = 0; i < permStateListSize; i++) {
+        PermissionStateFullParcel permStateParcel;
+        permStateParcel.permStatFull = permStateList[i];
+        out.WriteParcelable(&permStateParcel);
+    }
+
+    return true;
+}
+
+HapPolicyParcel* HapPolicyParcel::Unmarshalling(Parcel& in)
+{
+    auto* hapPolicyParcel = new (std::nothrow) HapPolicyParcel();
+    RELEASE_IF_FALSE(hapPolicyParcel != nullptr, hapPolicyParcel);
+
+    int32_t apl;
+    RELEASE_IF_FALSE(in.ReadInt32(apl), hapPolicyParcel);
+    hapPolicyParcel->hapPolicyParameter.apl = ATokenAplEnum(apl);
+
+    hapPolicyParcel->hapPolicyParameter.domain = in.ReadString();
+
+    int permListSize;
+    RELEASE_IF_FALSE(in.ReadInt32(permListSize), hapPolicyParcel);
+
+    for (int i = 0; i < permListSize; i++) {
+        sptr<PermissionDefParcel> permDefParcel = in.ReadParcelable<PermissionDefParcel>();
+        RELEASE_IF_FALSE(permDefParcel != nullptr, hapPolicyParcel);
+        hapPolicyParcel->hapPolicyParameter.permList.emplace_back(permDefParcel->permissionDef);
+    }
+
+    int permStateListSize;
+    RELEASE_IF_FALSE(in.ReadInt32(permStateListSize), hapPolicyParcel);
+    for (int i = 0; i < permStateListSize; i++) {
+        sptr<PermissionStateFullParcel> permissionStateParcel = in.ReadParcelable<PermissionStateFullParcel>();
+        RELEASE_IF_FALSE(permissionStateParcel != nullptr, hapPolicyParcel);
+        hapPolicyParcel->hapPolicyParameter.permStateList.emplace_back(permissionStateParcel->permStatFull);
+    }
+    return hapPolicyParcel;
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/frameworks/accesstoken/src/hap_token_info_for_sync_parcel.cpp b/frameworks/accesstoken/src/hap_token_info_for_sync_parcel.cpp
index 17b04b3a53e3154c28d2af7b6e8fb9107cec6bac..e02db64346f8b8a52287d5d5d97768eb1cb8e727 100644
--- a/frameworks/accesstoken/src/hap_token_info_for_sync_parcel.cpp
+++ b/frameworks/accesstoken/src/hap_token_info_for_sync_parcel.cpp
@@ -1,66 +1,66 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "hap_token_info_for_sync_parcel.h"
-#include "refbase.h"
-#include "hap_token_info_parcel.h"
-#include "parcel_utils.h"
-#include "permission_state_full.h"
-#include "permission_state_full_parcel.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-bool HapTokenInfoForSyncParcel::Marshalling(Parcel& out) const
-{
-    HapTokenInfoParcel baseInfoParcel;
-    baseInfoParcel.hapTokenInfoParams = this->hapTokenInfoForSyncParams.baseInfo;
-    out.WriteParcelable(&baseInfoParcel);
-
-    const std::vector<PermissionStateFull>& permStateList = this->hapTokenInfoForSyncParams.permStateList;
-    int32_t permStateListSize = static_cast<int32_t>(permStateList.size());
-    RETURN_IF_FALSE(out.WriteInt32(permStateListSize));
-    RETURN_IF_FALSE((permStateListSize <= MAX_PERMLIST_SIZE));
-    for (int i = 0; i < permStateListSize; i++) {
-        PermissionStateFullParcel permStateParcel;
-        permStateParcel.permStatFull = permStateList[i];
-        out.WriteParcelable(&permStateParcel);
-    }
-
-    return true;
-}
-
-HapTokenInfoForSyncParcel* HapTokenInfoForSyncParcel::Unmarshalling(Parcel& in)
-{
-    auto* hapTokenInfoForSyncParcel = new (std::nothrow) HapTokenInfoForSyncParcel();
-    RELEASE_IF_FALSE(hapTokenInfoForSyncParcel != nullptr, hapTokenInfoForSyncParcel);
-
-    sptr<HapTokenInfoParcel> baseInfoParcel = in.ReadParcelable<HapTokenInfoParcel>();
-    RELEASE_IF_FALSE(baseInfoParcel != nullptr, hapTokenInfoForSyncParcel);
-    hapTokenInfoForSyncParcel->hapTokenInfoForSyncParams.baseInfo = baseInfoParcel->hapTokenInfoParams;
-
-    int permStateListSize;
-    RELEASE_IF_FALSE(in.ReadInt32(permStateListSize), hapTokenInfoForSyncParcel);
-    for (int i = 0; i < permStateListSize; i++) {
-        sptr<PermissionStateFullParcel> permissionStateParcel = in.ReadParcelable<PermissionStateFullParcel>();
-        RELEASE_IF_FALSE(permissionStateParcel != nullptr, hapTokenInfoForSyncParcel);
-        hapTokenInfoForSyncParcel->hapTokenInfoForSyncParams.permStateList.emplace_back(
-            permissionStateParcel->permStatFull);
-    }
-    return hapTokenInfoForSyncParcel;
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "hap_token_info_for_sync_parcel.h"
+#include "refbase.h"
+#include "hap_token_info_parcel.h"
+#include "parcel_utils.h"
+#include "permission_state_full.h"
+#include "permission_state_full_parcel.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+bool HapTokenInfoForSyncParcel::Marshalling(Parcel& out) const
+{
+    HapTokenInfoParcel baseInfoParcel;
+    baseInfoParcel.hapTokenInfoParams = this->hapTokenInfoForSyncParams.baseInfo;
+    out.WriteParcelable(&baseInfoParcel);
+
+    const std::vector<PermissionStateFull>& permStateList = this->hapTokenInfoForSyncParams.permStateList;
+    int32_t permStateListSize = static_cast<int32_t>(permStateList.size());
+    RETURN_IF_FALSE(out.WriteInt32(permStateListSize));
+    RETURN_IF_FALSE((permStateListSize <= MAX_PERMLIST_SIZE));
+    for (int i = 0; i < permStateListSize; i++) {
+        PermissionStateFullParcel permStateParcel;
+        permStateParcel.permStatFull = permStateList[i];
+        out.WriteParcelable(&permStateParcel);
+    }
+
+    return true;
+}
+
+HapTokenInfoForSyncParcel* HapTokenInfoForSyncParcel::Unmarshalling(Parcel& in)
+{
+    auto* hapTokenInfoForSyncParcel = new (std::nothrow) HapTokenInfoForSyncParcel();
+    RELEASE_IF_FALSE(hapTokenInfoForSyncParcel != nullptr, hapTokenInfoForSyncParcel);
+
+    sptr<HapTokenInfoParcel> baseInfoParcel = in.ReadParcelable<HapTokenInfoParcel>();
+    RELEASE_IF_FALSE(baseInfoParcel != nullptr, hapTokenInfoForSyncParcel);
+    hapTokenInfoForSyncParcel->hapTokenInfoForSyncParams.baseInfo = baseInfoParcel->hapTokenInfoParams;
+
+    int permStateListSize;
+    RELEASE_IF_FALSE(in.ReadInt32(permStateListSize), hapTokenInfoForSyncParcel);
+    for (int i = 0; i < permStateListSize; i++) {
+        sptr<PermissionStateFullParcel> permissionStateParcel = in.ReadParcelable<PermissionStateFullParcel>();
+        RELEASE_IF_FALSE(permissionStateParcel != nullptr, hapTokenInfoForSyncParcel);
+        hapTokenInfoForSyncParcel->hapTokenInfoForSyncParams.permStateList.emplace_back(
+            permissionStateParcel->permStatFull);
+    }
+    return hapTokenInfoForSyncParcel;
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/frameworks/accesstoken/src/hap_token_info_parcel.cpp b/frameworks/accesstoken/src/hap_token_info_parcel.cpp
index 6d209ca4b63e72db0208d8d55c71f838fd57d38d..afea5d570e9bca8ac11a80f7ee76e991589cf251 100644
--- a/frameworks/accesstoken/src/hap_token_info_parcel.cpp
+++ b/frameworks/accesstoken/src/hap_token_info_parcel.cpp
@@ -1,61 +1,61 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "hap_token_info_parcel.h"
-#include "parcel_utils.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-bool HapTokenInfoParcel::Marshalling(Parcel& out) const
-{
-    RETURN_IF_FALSE(out.WriteInt32(this->hapTokenInfoParams.apl));
-    RETURN_IF_FALSE(out.WriteUint8(this->hapTokenInfoParams.ver));
-    RETURN_IF_FALSE(out.WriteInt32(this->hapTokenInfoParams.userID));
-    RETURN_IF_FALSE(out.WriteString(this->hapTokenInfoParams.bundleName));
-    RETURN_IF_FALSE(out.WriteInt32(this->hapTokenInfoParams.apiVersion));
-    RETURN_IF_FALSE(out.WriteInt32(this->hapTokenInfoParams.instIndex));
-    RETURN_IF_FALSE(out.WriteInt32(this->hapTokenInfoParams.dlpType));
-    RETURN_IF_FALSE(out.WriteString(this->hapTokenInfoParams.appID));
-    RETURN_IF_FALSE(out.WriteString(this->hapTokenInfoParams.deviceID));
-    RETURN_IF_FALSE(out.WriteUint32(this->hapTokenInfoParams.tokenID));
-    RETURN_IF_FALSE(out.WriteUint32(this->hapTokenInfoParams.tokenAttr));
-    return true;
-}
-
-HapTokenInfoParcel* HapTokenInfoParcel::Unmarshalling(Parcel& in)
-{
-    auto* hapTokenInfoParcel = new (std::nothrow) HapTokenInfoParcel();
-    RELEASE_IF_FALSE(hapTokenInfoParcel != nullptr, hapTokenInfoParcel);
-    int apl;
-    uint8_t ver;
-    RELEASE_IF_FALSE(in.ReadInt32(apl), hapTokenInfoParcel);
-    hapTokenInfoParcel->hapTokenInfoParams.apl = ATokenAplEnum(apl);
-    RELEASE_IF_FALSE(in.ReadUint8(ver), hapTokenInfoParcel);
-    hapTokenInfoParcel->hapTokenInfoParams.ver = ver;
-    RELEASE_IF_FALSE(in.ReadInt32(hapTokenInfoParcel->hapTokenInfoParams.userID), hapTokenInfoParcel);
-    hapTokenInfoParcel->hapTokenInfoParams.bundleName = in.ReadString();
-    RELEASE_IF_FALSE(in.ReadInt32(hapTokenInfoParcel->hapTokenInfoParams.apiVersion), hapTokenInfoParcel);
-    RELEASE_IF_FALSE(in.ReadInt32(hapTokenInfoParcel->hapTokenInfoParams.instIndex), hapTokenInfoParcel);
-    RELEASE_IF_FALSE(in.ReadInt32(hapTokenInfoParcel->hapTokenInfoParams.dlpType), hapTokenInfoParcel);
-    hapTokenInfoParcel->hapTokenInfoParams.appID = in.ReadString();
-    hapTokenInfoParcel->hapTokenInfoParams.deviceID = in.ReadString();
-    RELEASE_IF_FALSE(in.ReadUint32(hapTokenInfoParcel->hapTokenInfoParams.tokenID), hapTokenInfoParcel);
-    RELEASE_IF_FALSE(in.ReadUint32(hapTokenInfoParcel->hapTokenInfoParams.tokenAttr), hapTokenInfoParcel);
-    return hapTokenInfoParcel;
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "hap_token_info_parcel.h"
+#include "parcel_utils.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+bool HapTokenInfoParcel::Marshalling(Parcel& out) const
+{
+    RETURN_IF_FALSE(out.WriteInt32(this->hapTokenInfoParams.apl));
+    RETURN_IF_FALSE(out.WriteUint8(this->hapTokenInfoParams.ver));
+    RETURN_IF_FALSE(out.WriteInt32(this->hapTokenInfoParams.userID));
+    RETURN_IF_FALSE(out.WriteString(this->hapTokenInfoParams.bundleName));
+    RETURN_IF_FALSE(out.WriteInt32(this->hapTokenInfoParams.apiVersion));
+    RETURN_IF_FALSE(out.WriteInt32(this->hapTokenInfoParams.instIndex));
+    RETURN_IF_FALSE(out.WriteInt32(this->hapTokenInfoParams.dlpType));
+    RETURN_IF_FALSE(out.WriteString(this->hapTokenInfoParams.appID));
+    RETURN_IF_FALSE(out.WriteString(this->hapTokenInfoParams.deviceID));
+    RETURN_IF_FALSE(out.WriteUint32(this->hapTokenInfoParams.tokenID));
+    RETURN_IF_FALSE(out.WriteUint32(this->hapTokenInfoParams.tokenAttr));
+    return true;
+}
+
+HapTokenInfoParcel* HapTokenInfoParcel::Unmarshalling(Parcel& in)
+{
+    auto* hapTokenInfoParcel = new (std::nothrow) HapTokenInfoParcel();
+    RELEASE_IF_FALSE(hapTokenInfoParcel != nullptr, hapTokenInfoParcel);
+    int apl;
+    uint8_t ver;
+    RELEASE_IF_FALSE(in.ReadInt32(apl), hapTokenInfoParcel);
+    hapTokenInfoParcel->hapTokenInfoParams.apl = ATokenAplEnum(apl);
+    RELEASE_IF_FALSE(in.ReadUint8(ver), hapTokenInfoParcel);
+    hapTokenInfoParcel->hapTokenInfoParams.ver = ver;
+    RELEASE_IF_FALSE(in.ReadInt32(hapTokenInfoParcel->hapTokenInfoParams.userID), hapTokenInfoParcel);
+    hapTokenInfoParcel->hapTokenInfoParams.bundleName = in.ReadString();
+    RELEASE_IF_FALSE(in.ReadInt32(hapTokenInfoParcel->hapTokenInfoParams.apiVersion), hapTokenInfoParcel);
+    RELEASE_IF_FALSE(in.ReadInt32(hapTokenInfoParcel->hapTokenInfoParams.instIndex), hapTokenInfoParcel);
+    RELEASE_IF_FALSE(in.ReadInt32(hapTokenInfoParcel->hapTokenInfoParams.dlpType), hapTokenInfoParcel);
+    hapTokenInfoParcel->hapTokenInfoParams.appID = in.ReadString();
+    hapTokenInfoParcel->hapTokenInfoParams.deviceID = in.ReadString();
+    RELEASE_IF_FALSE(in.ReadUint32(hapTokenInfoParcel->hapTokenInfoParams.tokenID), hapTokenInfoParcel);
+    RELEASE_IF_FALSE(in.ReadUint32(hapTokenInfoParcel->hapTokenInfoParams.tokenAttr), hapTokenInfoParcel);
+    return hapTokenInfoParcel;
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/frameworks/accesstoken/src/native_token_info_for_sync_parcel.cpp b/frameworks/accesstoken/src/native_token_info_for_sync_parcel.cpp
index 6b0f65ed6b380b7a1f61f755cad17755df6b87a5..311d5046f541c105854012fbfac73607fff24671 100644
--- a/frameworks/accesstoken/src/native_token_info_for_sync_parcel.cpp
+++ b/frameworks/accesstoken/src/native_token_info_for_sync_parcel.cpp
@@ -1,66 +1,66 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "native_token_info_for_sync_parcel.h"
-#include "refbase.h"
-#include "native_token_info_parcel.h"
-#include "parcel_utils.h"
-#include "permission_state_full.h"
-#include "permission_state_full_parcel.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-bool NativeTokenInfoForSyncParcel::Marshalling(Parcel& out) const
-{
-    NativeTokenInfoParcel baseInfoParcel;
-    baseInfoParcel.nativeTokenInfoParams = this->nativeTokenInfoForSyncParams.baseInfo;
-    RETURN_IF_FALSE(out.WriteParcelable(&baseInfoParcel));
-
-    const std::vector<PermissionStateFull>& permStateList = this->nativeTokenInfoForSyncParams.permStateList;
-    int32_t permStateListSize = static_cast<int32_t>(permStateList.size());
-    RETURN_IF_FALSE(out.WriteInt32(permStateListSize));
-    RETURN_IF_FALSE((permStateListSize <= MAX_PERMLIST_SIZE));
-    for (int i = 0; i < permStateListSize; i++) {
-        PermissionStateFullParcel permStateParcel;
-        permStateParcel.permStatFull = permStateList[i];
-        RETURN_IF_FALSE(out.WriteParcelable(&permStateParcel));
-    }
-
-    return true;
-}
-
-NativeTokenInfoForSyncParcel* NativeTokenInfoForSyncParcel::Unmarshalling(Parcel& in)
-{
-    auto* nativeTokenInfoForSyncParcel = new (std::nothrow) NativeTokenInfoForSyncParcel();
-    RELEASE_IF_FALSE(nativeTokenInfoForSyncParcel != nullptr, nativeTokenInfoForSyncParcel);
-
-    sptr<NativeTokenInfoParcel> baseInfoParcel = in.ReadParcelable<NativeTokenInfoParcel>();
-    RELEASE_IF_FALSE(baseInfoParcel != nullptr, nativeTokenInfoForSyncParcel);
-    nativeTokenInfoForSyncParcel->nativeTokenInfoForSyncParams.baseInfo = baseInfoParcel->nativeTokenInfoParams;
-
-    int permStateListSize;
-    RELEASE_IF_FALSE(in.ReadInt32(permStateListSize), nativeTokenInfoForSyncParcel);
-    for (int i = 0; i < permStateListSize; i++) {
-        sptr<PermissionStateFullParcel> permissionStateParcel = in.ReadParcelable<PermissionStateFullParcel>();
-        RELEASE_IF_FALSE(permissionStateParcel != nullptr, nativeTokenInfoForSyncParcel);
-        nativeTokenInfoForSyncParcel->nativeTokenInfoForSyncParams.permStateList.emplace_back(
-            permissionStateParcel->permStatFull);
-    }
-    return nativeTokenInfoForSyncParcel;
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "native_token_info_for_sync_parcel.h"
+#include "refbase.h"
+#include "native_token_info_parcel.h"
+#include "parcel_utils.h"
+#include "permission_state_full.h"
+#include "permission_state_full_parcel.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+bool NativeTokenInfoForSyncParcel::Marshalling(Parcel& out) const
+{
+    NativeTokenInfoParcel baseInfoParcel;
+    baseInfoParcel.nativeTokenInfoParams = this->nativeTokenInfoForSyncParams.baseInfo;
+    RETURN_IF_FALSE(out.WriteParcelable(&baseInfoParcel));
+
+    const std::vector<PermissionStateFull>& permStateList = this->nativeTokenInfoForSyncParams.permStateList;
+    int32_t permStateListSize = static_cast<int32_t>(permStateList.size());
+    RETURN_IF_FALSE(out.WriteInt32(permStateListSize));
+    RETURN_IF_FALSE((permStateListSize <= MAX_PERMLIST_SIZE));
+    for (int i = 0; i < permStateListSize; i++) {
+        PermissionStateFullParcel permStateParcel;
+        permStateParcel.permStatFull = permStateList[i];
+        RETURN_IF_FALSE(out.WriteParcelable(&permStateParcel));
+    }
+
+    return true;
+}
+
+NativeTokenInfoForSyncParcel* NativeTokenInfoForSyncParcel::Unmarshalling(Parcel& in)
+{
+    auto* nativeTokenInfoForSyncParcel = new (std::nothrow) NativeTokenInfoForSyncParcel();
+    RELEASE_IF_FALSE(nativeTokenInfoForSyncParcel != nullptr, nativeTokenInfoForSyncParcel);
+
+    sptr<NativeTokenInfoParcel> baseInfoParcel = in.ReadParcelable<NativeTokenInfoParcel>();
+    RELEASE_IF_FALSE(baseInfoParcel != nullptr, nativeTokenInfoForSyncParcel);
+    nativeTokenInfoForSyncParcel->nativeTokenInfoForSyncParams.baseInfo = baseInfoParcel->nativeTokenInfoParams;
+
+    int permStateListSize;
+    RELEASE_IF_FALSE(in.ReadInt32(permStateListSize), nativeTokenInfoForSyncParcel);
+    for (int i = 0; i < permStateListSize; i++) {
+        sptr<PermissionStateFullParcel> permissionStateParcel = in.ReadParcelable<PermissionStateFullParcel>();
+        RELEASE_IF_FALSE(permissionStateParcel != nullptr, nativeTokenInfoForSyncParcel);
+        nativeTokenInfoForSyncParcel->nativeTokenInfoForSyncParams.permStateList.emplace_back(
+            permissionStateParcel->permStatFull);
+    }
+    return nativeTokenInfoForSyncParcel;
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/frameworks/accesstoken/src/native_token_info_parcel.cpp b/frameworks/accesstoken/src/native_token_info_parcel.cpp
index 621ce872c591eae6ecb34184b2e9b315b691c114..38804183a32b4e685e41702d2f96f4834e4e720c 100644
--- a/frameworks/accesstoken/src/native_token_info_parcel.cpp
+++ b/frameworks/accesstoken/src/native_token_info_parcel.cpp
@@ -1,95 +1,95 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "native_token_info_parcel.h"
-#include <iosfwd>
-#include <new>
-#include <string>
-#include <vector>
-#include "access_token.h"
-#include "parcel_utils.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-bool NativeTokenInfoParcel::Marshalling(Parcel& out) const
-{
-    RETURN_IF_FALSE(out.WriteInt32(this->nativeTokenInfoParams.apl));
-    RETURN_IF_FALSE(out.WriteUint8(this->nativeTokenInfoParams.ver));
-    RETURN_IF_FALSE(out.WriteString(this->nativeTokenInfoParams.processName));
-    RETURN_IF_FALSE(out.WriteUint32(this->nativeTokenInfoParams.tokenID));
-    RETURN_IF_FALSE(out.WriteUint32(this->nativeTokenInfoParams.tokenAttr));
-
-    if ((this->nativeTokenInfoParams.dcap).size() > INT32_MAX) {
-        return false;
-    }
-    int32_t dcapSize = static_cast<int32_t>((this->nativeTokenInfoParams.dcap).size());
-    RETURN_IF_FALSE(out.WriteInt32(dcapSize));
-
-    for (const auto& dcapItem : this->nativeTokenInfoParams.dcap) {
-        RETURN_IF_FALSE(out.WriteString(dcapItem));
-    }
-
-    if ((this->nativeTokenInfoParams.nativeAcls).size() > INT32_MAX) {
-        return false;
-    }
-    int32_t nativeAclSize = static_cast<int32_t>((this->nativeTokenInfoParams.nativeAcls).size());
-    RETURN_IF_FALSE(out.WriteInt32(nativeAclSize));
-
-    for (const auto& item : this->nativeTokenInfoParams.nativeAcls) {
-        RETURN_IF_FALSE(out.WriteString(item));
-    }
-
-    return true;
-}
-
-NativeTokenInfoParcel* NativeTokenInfoParcel::Unmarshalling(Parcel& in)
-{
-    auto* nativeTokenInfoParcel = new (std::nothrow) NativeTokenInfoParcel();
-    RELEASE_IF_FALSE(nativeTokenInfoParcel != nullptr, nativeTokenInfoParcel);
-
-    int32_t apl;
-    uint8_t ver;
-    RELEASE_IF_FALSE(in.ReadInt32(apl), nativeTokenInfoParcel);
-    RELEASE_IF_FALSE(in.ReadUint8(ver), nativeTokenInfoParcel);
-    nativeTokenInfoParcel->nativeTokenInfoParams.apl = ATokenAplEnum(apl);
-    nativeTokenInfoParcel->nativeTokenInfoParams.ver = ver;
-
-    nativeTokenInfoParcel->nativeTokenInfoParams.processName = in.ReadString();
-    RELEASE_IF_FALSE(in.ReadUint32(nativeTokenInfoParcel->nativeTokenInfoParams.tokenID), nativeTokenInfoParcel);
-    RELEASE_IF_FALSE(in.ReadUint32(nativeTokenInfoParcel->nativeTokenInfoParams.tokenAttr), nativeTokenInfoParcel);
-
-    int32_t dcapSize;
-    RELEASE_IF_FALSE(in.ReadInt32(dcapSize), nativeTokenInfoParcel);
-
-    for (int32_t i = 0; i < dcapSize; i++) {
-        std::string dcapsItem;
-        RELEASE_IF_FALSE(in.ReadString(dcapsItem), nativeTokenInfoParcel);
-        nativeTokenInfoParcel->nativeTokenInfoParams.dcap.emplace_back(dcapsItem);
-    }
-
-    int32_t nativeAclSize;
-    RELEASE_IF_FALSE(in.ReadInt32(nativeAclSize), nativeTokenInfoParcel);
-
-    for (int32_t i = 0; i < nativeAclSize; i++) {
-        std::string item;
-        RELEASE_IF_FALSE(in.ReadString(item), nativeTokenInfoParcel);
-        nativeTokenInfoParcel->nativeTokenInfoParams.nativeAcls.emplace_back(item);
-    }
-    return nativeTokenInfoParcel;
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "native_token_info_parcel.h"
+#include <iosfwd>
+#include <new>
+#include <string>
+#include <vector>
+#include "access_token.h"
+#include "parcel_utils.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+bool NativeTokenInfoParcel::Marshalling(Parcel& out) const
+{
+    RETURN_IF_FALSE(out.WriteInt32(this->nativeTokenInfoParams.apl));
+    RETURN_IF_FALSE(out.WriteUint8(this->nativeTokenInfoParams.ver));
+    RETURN_IF_FALSE(out.WriteString(this->nativeTokenInfoParams.processName));
+    RETURN_IF_FALSE(out.WriteUint32(this->nativeTokenInfoParams.tokenID));
+    RETURN_IF_FALSE(out.WriteUint32(this->nativeTokenInfoParams.tokenAttr));
+
+    if ((this->nativeTokenInfoParams.dcap).size() > INT32_MAX) {
+        return false;
+    }
+    int32_t dcapSize = static_cast<int32_t>((this->nativeTokenInfoParams.dcap).size());
+    RETURN_IF_FALSE(out.WriteInt32(dcapSize));
+
+    for (const auto& dcapItem : this->nativeTokenInfoParams.dcap) {
+        RETURN_IF_FALSE(out.WriteString(dcapItem));
+    }
+
+    if ((this->nativeTokenInfoParams.nativeAcls).size() > INT32_MAX) {
+        return false;
+    }
+    int32_t nativeAclSize = static_cast<int32_t>((this->nativeTokenInfoParams.nativeAcls).size());
+    RETURN_IF_FALSE(out.WriteInt32(nativeAclSize));
+
+    for (const auto& item : this->nativeTokenInfoParams.nativeAcls) {
+        RETURN_IF_FALSE(out.WriteString(item));
+    }
+
+    return true;
+}
+
+NativeTokenInfoParcel* NativeTokenInfoParcel::Unmarshalling(Parcel& in)
+{
+    auto* nativeTokenInfoParcel = new (std::nothrow) NativeTokenInfoParcel();
+    RELEASE_IF_FALSE(nativeTokenInfoParcel != nullptr, nativeTokenInfoParcel);
+
+    int32_t apl;
+    uint8_t ver;
+    RELEASE_IF_FALSE(in.ReadInt32(apl), nativeTokenInfoParcel);
+    RELEASE_IF_FALSE(in.ReadUint8(ver), nativeTokenInfoParcel);
+    nativeTokenInfoParcel->nativeTokenInfoParams.apl = ATokenAplEnum(apl);
+    nativeTokenInfoParcel->nativeTokenInfoParams.ver = ver;
+
+    nativeTokenInfoParcel->nativeTokenInfoParams.processName = in.ReadString();
+    RELEASE_IF_FALSE(in.ReadUint32(nativeTokenInfoParcel->nativeTokenInfoParams.tokenID), nativeTokenInfoParcel);
+    RELEASE_IF_FALSE(in.ReadUint32(nativeTokenInfoParcel->nativeTokenInfoParams.tokenAttr), nativeTokenInfoParcel);
+
+    int32_t dcapSize;
+    RELEASE_IF_FALSE(in.ReadInt32(dcapSize), nativeTokenInfoParcel);
+
+    for (int32_t i = 0; i < dcapSize; i++) {
+        std::string dcapsItem;
+        RELEASE_IF_FALSE(in.ReadString(dcapsItem), nativeTokenInfoParcel);
+        nativeTokenInfoParcel->nativeTokenInfoParams.dcap.emplace_back(dcapsItem);
+    }
+
+    int32_t nativeAclSize;
+    RELEASE_IF_FALSE(in.ReadInt32(nativeAclSize), nativeTokenInfoParcel);
+
+    for (int32_t i = 0; i < nativeAclSize; i++) {
+        std::string item;
+        RELEASE_IF_FALSE(in.ReadString(item), nativeTokenInfoParcel);
+        nativeTokenInfoParcel->nativeTokenInfoParams.nativeAcls.emplace_back(item);
+    }
+    return nativeTokenInfoParcel;
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/frameworks/accesstoken/src/permission_def_parcel.cpp b/frameworks/accesstoken/src/permission_def_parcel.cpp
index 4ca7b3d2a3d553ed44a550b9515ec78a47129d68..56578ccc3f3286edce414112c4d8ccca91faceff 100644
--- a/frameworks/accesstoken/src/permission_def_parcel.cpp
+++ b/frameworks/accesstoken/src/permission_def_parcel.cpp
@@ -1,61 +1,61 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "permission_def_parcel.h"
-
-#include "access_token.h"
-#include "parcel_utils.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-bool PermissionDefParcel::Marshalling(Parcel& out) const
-{
-    RETURN_IF_FALSE(out.WriteString(this->permissionDef.permissionName));
-    RETURN_IF_FALSE(out.WriteString(this->permissionDef.bundleName));
-    RETURN_IF_FALSE(out.WriteInt32(this->permissionDef.grantMode));
-    RETURN_IF_FALSE(out.WriteInt32(this->permissionDef.availableLevel));
-    RETURN_IF_FALSE(out.WriteBool(this->permissionDef.provisionEnable));
-    RETURN_IF_FALSE(out.WriteBool(this->permissionDef.distributedSceneEnable));
-    RETURN_IF_FALSE(out.WriteString(this->permissionDef.label));
-    RETURN_IF_FALSE(out.WriteInt32(this->permissionDef.labelId));
-    RETURN_IF_FALSE(out.WriteString(this->permissionDef.description));
-    RETURN_IF_FALSE(out.WriteInt32(this->permissionDef.descriptionId));
-    return true;
-}
-
-PermissionDefParcel* PermissionDefParcel::Unmarshalling(Parcel& in)
-{
-    auto* permissionDefParcel = new (std::nothrow) PermissionDefParcel();
-    RELEASE_IF_FALSE(permissionDefParcel != nullptr, permissionDefParcel);
-    permissionDefParcel->permissionDef.permissionName = in.ReadString();
-    permissionDefParcel->permissionDef.bundleName = in.ReadString();
-    RELEASE_IF_FALSE(in.ReadInt32(permissionDefParcel->permissionDef.grantMode), permissionDefParcel);
-
-    int level;
-    RELEASE_IF_FALSE(in.ReadInt32(level), permissionDefParcel);
-    permissionDefParcel->permissionDef.availableLevel = ATokenAplEnum(level);
-
-    RELEASE_IF_FALSE(in.ReadBool(permissionDefParcel->permissionDef.provisionEnable), permissionDefParcel);
-    RELEASE_IF_FALSE(in.ReadBool(permissionDefParcel->permissionDef.distributedSceneEnable), permissionDefParcel);
-    permissionDefParcel->permissionDef.label = in.ReadString();
-    RELEASE_IF_FALSE(in.ReadInt32(permissionDefParcel->permissionDef.labelId), permissionDefParcel);
-    permissionDefParcel->permissionDef.description = in.ReadString();
-    RELEASE_IF_FALSE(in.ReadInt32(permissionDefParcel->permissionDef.descriptionId), permissionDefParcel);
-    return permissionDefParcel;
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "permission_def_parcel.h"
+
+#include "access_token.h"
+#include "parcel_utils.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+bool PermissionDefParcel::Marshalling(Parcel& out) const
+{
+    RETURN_IF_FALSE(out.WriteString(this->permissionDef.permissionName));
+    RETURN_IF_FALSE(out.WriteString(this->permissionDef.bundleName));
+    RETURN_IF_FALSE(out.WriteInt32(this->permissionDef.grantMode));
+    RETURN_IF_FALSE(out.WriteInt32(this->permissionDef.availableLevel));
+    RETURN_IF_FALSE(out.WriteBool(this->permissionDef.provisionEnable));
+    RETURN_IF_FALSE(out.WriteBool(this->permissionDef.distributedSceneEnable));
+    RETURN_IF_FALSE(out.WriteString(this->permissionDef.label));
+    RETURN_IF_FALSE(out.WriteInt32(this->permissionDef.labelId));
+    RETURN_IF_FALSE(out.WriteString(this->permissionDef.description));
+    RETURN_IF_FALSE(out.WriteInt32(this->permissionDef.descriptionId));
+    return true;
+}
+
+PermissionDefParcel* PermissionDefParcel::Unmarshalling(Parcel& in)
+{
+    auto* permissionDefParcel = new (std::nothrow) PermissionDefParcel();
+    RELEASE_IF_FALSE(permissionDefParcel != nullptr, permissionDefParcel);
+    permissionDefParcel->permissionDef.permissionName = in.ReadString();
+    permissionDefParcel->permissionDef.bundleName = in.ReadString();
+    RELEASE_IF_FALSE(in.ReadInt32(permissionDefParcel->permissionDef.grantMode), permissionDefParcel);
+
+    int level;
+    RELEASE_IF_FALSE(in.ReadInt32(level), permissionDefParcel);
+    permissionDefParcel->permissionDef.availableLevel = ATokenAplEnum(level);
+
+    RELEASE_IF_FALSE(in.ReadBool(permissionDefParcel->permissionDef.provisionEnable), permissionDefParcel);
+    RELEASE_IF_FALSE(in.ReadBool(permissionDefParcel->permissionDef.distributedSceneEnable), permissionDefParcel);
+    permissionDefParcel->permissionDef.label = in.ReadString();
+    RELEASE_IF_FALSE(in.ReadInt32(permissionDefParcel->permissionDef.labelId), permissionDefParcel);
+    permissionDefParcel->permissionDef.description = in.ReadString();
+    RELEASE_IF_FALSE(in.ReadInt32(permissionDefParcel->permissionDef.descriptionId), permissionDefParcel);
+    return permissionDefParcel;
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/frameworks/accesstoken/src/permission_list_state_parcel.cpp b/frameworks/accesstoken/src/permission_list_state_parcel.cpp
index 5fe05d917635bb6f3fce2f365712d372a6e8742f..1e85e65604b62be3b35e021e422ed5a645e988ad 100644
--- a/frameworks/accesstoken/src/permission_list_state_parcel.cpp
+++ b/frameworks/accesstoken/src/permission_list_state_parcel.cpp
@@ -1,41 +1,41 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "permission_list_state_parcel.h"
-#include "parcel_utils.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-bool PermissionListStateParcel::Marshalling(Parcel& out) const
-{
-    RETURN_IF_FALSE(out.WriteString(this->permsState.permissionName));
-    RETURN_IF_FALSE(out.WriteInt32(this->permsState.state));
-    return true;
-}
-
-PermissionListStateParcel* PermissionListStateParcel::Unmarshalling(Parcel& in)
-{
-    auto* permissionStateParcel = new (std::nothrow) PermissionListStateParcel();
-    RELEASE_IF_FALSE(permissionStateParcel != nullptr, permissionStateParcel);
-
-    RELEASE_IF_FALSE(in.ReadString(permissionStateParcel->permsState.permissionName), permissionStateParcel);
-    RELEASE_IF_FALSE(in.ReadInt32(permissionStateParcel->permsState.state), permissionStateParcel);
-
-    return permissionStateParcel;
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "permission_list_state_parcel.h"
+#include "parcel_utils.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+bool PermissionListStateParcel::Marshalling(Parcel& out) const
+{
+    RETURN_IF_FALSE(out.WriteString(this->permsState.permissionName));
+    RETURN_IF_FALSE(out.WriteInt32(this->permsState.state));
+    return true;
+}
+
+PermissionListStateParcel* PermissionListStateParcel::Unmarshalling(Parcel& in)
+{
+    auto* permissionStateParcel = new (std::nothrow) PermissionListStateParcel();
+    RELEASE_IF_FALSE(permissionStateParcel != nullptr, permissionStateParcel);
+
+    RELEASE_IF_FALSE(in.ReadString(permissionStateParcel->permsState.permissionName), permissionStateParcel);
+    RELEASE_IF_FALSE(in.ReadInt32(permissionStateParcel->permsState.state), permissionStateParcel);
+
+    return permissionStateParcel;
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/frameworks/accesstoken/src/permission_state_change_info_parcel.cpp b/frameworks/accesstoken/src/permission_state_change_info_parcel.cpp
index 173a2d25b8e3155d6dee4393818521c4d29e1f0e..1af18a4aea061f949356d8a939da69504b54b86e 100644
--- a/frameworks/accesstoken/src/permission_state_change_info_parcel.cpp
+++ b/frameworks/accesstoken/src/permission_state_change_info_parcel.cpp
@@ -1,44 +1,44 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "permission_state_change_info_parcel.h"
-#include "parcel_utils.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-bool PermissionStateChangeInfoParcel::Marshalling(Parcel& out) const
-{
-    RETURN_IF_FALSE(out.WriteInt32(this->changeInfo.PermStateChangeType));
-    RETURN_IF_FALSE(out.WriteUint32(this->changeInfo.tokenID));
-    RETURN_IF_FALSE(out.WriteString(this->changeInfo.permissionName));
-    return true;
-}
-
-PermissionStateChangeInfoParcel* PermissionStateChangeInfoParcel::Unmarshalling(Parcel& in)
-{
-    auto* permissionStateParcel = new (std::nothrow) PermissionStateChangeInfoParcel();
-    if (permissionStateParcel == nullptr) {
-        return nullptr;
-    }
-    RELEASE_IF_FALSE(in.ReadInt32(permissionStateParcel->changeInfo.PermStateChangeType), permissionStateParcel);
-    RELEASE_IF_FALSE(in.ReadUint32(permissionStateParcel->changeInfo.tokenID), permissionStateParcel);
-    RELEASE_IF_FALSE(in.ReadString(permissionStateParcel->changeInfo.permissionName), permissionStateParcel);
-
-    return permissionStateParcel;
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "permission_state_change_info_parcel.h"
+#include "parcel_utils.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+bool PermissionStateChangeInfoParcel::Marshalling(Parcel& out) const
+{
+    RETURN_IF_FALSE(out.WriteInt32(this->changeInfo.PermStateChangeType));
+    RETURN_IF_FALSE(out.WriteUint32(this->changeInfo.tokenID));
+    RETURN_IF_FALSE(out.WriteString(this->changeInfo.permissionName));
+    return true;
+}
+
+PermissionStateChangeInfoParcel* PermissionStateChangeInfoParcel::Unmarshalling(Parcel& in)
+{
+    auto* permissionStateParcel = new (std::nothrow) PermissionStateChangeInfoParcel();
+    if (permissionStateParcel == nullptr) {
+        return nullptr;
+    }
+    RELEASE_IF_FALSE(in.ReadInt32(permissionStateParcel->changeInfo.PermStateChangeType), permissionStateParcel);
+    RELEASE_IF_FALSE(in.ReadUint32(permissionStateParcel->changeInfo.tokenID), permissionStateParcel);
+    RELEASE_IF_FALSE(in.ReadString(permissionStateParcel->changeInfo.permissionName), permissionStateParcel);
+
+    return permissionStateParcel;
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/frameworks/accesstoken/src/permission_state_change_scope_parcel.cpp b/frameworks/accesstoken/src/permission_state_change_scope_parcel.cpp
index 8555df3533764777dee7971f36034edad0b48a5d..93cd2fc1b95c55d95cf0de1e3c68048f9a531793 100644
--- a/frameworks/accesstoken/src/permission_state_change_scope_parcel.cpp
+++ b/frameworks/accesstoken/src/permission_state_change_scope_parcel.cpp
@@ -1,63 +1,63 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "permission_state_change_scope_parcel.h"
-#include "parcel_utils.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-bool PermStateChangeScopeParcel::Marshalling(Parcel& out) const
-{
-    RETURN_IF_FALSE(out.WriteUint32((this->scope.tokenIDs.size())));
-    for (const auto& tokenID : this->scope.tokenIDs) {
-        RETURN_IF_FALSE(out.WriteUint32(tokenID));
-    }
-
-    RETURN_IF_FALSE(out.WriteUint32((this->scope.permList.size())));
-    for (const auto& permissionName : this->scope.permList) {
-        RETURN_IF_FALSE(out.WriteString(permissionName));
-    }
-    return true;
-}
-
-PermStateChangeScopeParcel* PermStateChangeScopeParcel::Unmarshalling(Parcel& in)
-{
-    auto* permStateChangeScopeParcel = new (std::nothrow) PermStateChangeScopeParcel();
-    if (permStateChangeScopeParcel == nullptr) {
-        return nullptr;
-    }
-    uint32_t tokenIdListSize = 0;
-    RELEASE_IF_FALSE(in.ReadUint32(tokenIdListSize), permStateChangeScopeParcel);
-    RELEASE_IF_FALSE(tokenIdListSize <= TOKENIDS_LIST_SIZE_MAX, permStateChangeScopeParcel);
-    for (uint32_t i = 0; i < tokenIdListSize; i++) {
-        AccessTokenID tokenID;
-        RELEASE_IF_FALSE(in.ReadUint32(tokenID), permStateChangeScopeParcel);
-        permStateChangeScopeParcel->scope.tokenIDs.emplace_back(tokenID);
-    }
-
-    uint32_t permListSize = 0;
-    RELEASE_IF_FALSE(in.ReadUint32(permListSize), permStateChangeScopeParcel);
-    RELEASE_IF_FALSE(permListSize <= PERMS_LIST_SIZE_MAX, permStateChangeScopeParcel);
-    for (uint32_t i = 0; i < permListSize; i++) {
-        std::string permName;
-        RELEASE_IF_FALSE(in.ReadString(permName), permStateChangeScopeParcel);
-        permStateChangeScopeParcel->scope.permList.emplace_back(permName);
-    }
-    return permStateChangeScopeParcel;
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "permission_state_change_scope_parcel.h"
+#include "parcel_utils.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+bool PermStateChangeScopeParcel::Marshalling(Parcel& out) const
+{
+    RETURN_IF_FALSE(out.WriteUint32((this->scope.tokenIDs.size())));
+    for (const auto& tokenID : this->scope.tokenIDs) {
+        RETURN_IF_FALSE(out.WriteUint32(tokenID));
+    }
+
+    RETURN_IF_FALSE(out.WriteUint32((this->scope.permList.size())));
+    for (const auto& permissionName : this->scope.permList) {
+        RETURN_IF_FALSE(out.WriteString(permissionName));
+    }
+    return true;
+}
+
+PermStateChangeScopeParcel* PermStateChangeScopeParcel::Unmarshalling(Parcel& in)
+{
+    auto* permStateChangeScopeParcel = new (std::nothrow) PermStateChangeScopeParcel();
+    if (permStateChangeScopeParcel == nullptr) {
+        return nullptr;
+    }
+    uint32_t tokenIdListSize = 0;
+    RELEASE_IF_FALSE(in.ReadUint32(tokenIdListSize), permStateChangeScopeParcel);
+    RELEASE_IF_FALSE(tokenIdListSize <= TOKENIDS_LIST_SIZE_MAX, permStateChangeScopeParcel);
+    for (uint32_t i = 0; i < tokenIdListSize; i++) {
+        AccessTokenID tokenID;
+        RELEASE_IF_FALSE(in.ReadUint32(tokenID), permStateChangeScopeParcel);
+        permStateChangeScopeParcel->scope.tokenIDs.emplace_back(tokenID);
+    }
+
+    uint32_t permListSize = 0;
+    RELEASE_IF_FALSE(in.ReadUint32(permListSize), permStateChangeScopeParcel);
+    RELEASE_IF_FALSE(permListSize <= PERMS_LIST_SIZE_MAX, permStateChangeScopeParcel);
+    for (uint32_t i = 0; i < permListSize; i++) {
+        std::string permName;
+        RELEASE_IF_FALSE(in.ReadString(permName), permStateChangeScopeParcel);
+        permStateChangeScopeParcel->scope.permList.emplace_back(permName);
+    }
+    return permStateChangeScopeParcel;
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/frameworks/accesstoken/src/permission_state_full_parcel.cpp b/frameworks/accesstoken/src/permission_state_full_parcel.cpp
index 1919f9d52de426452fca7f0ba61b5703d39d5de8..30500ae28bd7ebd70873f9fbe0faf6096c116888 100644
--- a/frameworks/accesstoken/src/permission_state_full_parcel.cpp
+++ b/frameworks/accesstoken/src/permission_state_full_parcel.cpp
@@ -1,79 +1,79 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "permission_state_full_parcel.h"
-#include "parcel_utils.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-bool PermissionStateFullParcel::Marshalling(Parcel& out) const
-{
-    RETURN_IF_FALSE(out.WriteString(this->permStatFull.permissionName));
-    RETURN_IF_FALSE(out.WriteBool(this->permStatFull.isGeneral));
-
-    RETURN_IF_FALSE(out.WriteInt32((int32_t)(this->permStatFull.resDeviceID.size())));
-    for (auto devId : this->permStatFull.resDeviceID) {
-        RETURN_IF_FALSE(out.WriteString(devId));
-    }
-
-    RETURN_IF_FALSE(out.WriteInt32((int32_t)(this->permStatFull.grantStatus.size())));
-    for (auto grantStat : this->permStatFull.grantStatus) {
-        RETURN_IF_FALSE(out.WriteInt32(grantStat));
-    }
-
-    RETURN_IF_FALSE(out.WriteInt32((int32_t)(this->permStatFull.grantFlags.size())));
-    for (auto grantFlag : this->permStatFull.grantFlags) {
-        RETURN_IF_FALSE(out.WriteInt32(grantFlag));
-    }
-    return true;
-}
-
-PermissionStateFullParcel* PermissionStateFullParcel::Unmarshalling(Parcel& in)
-{
-    auto* permissionStateParcel = new (std::nothrow) PermissionStateFullParcel();
-    RELEASE_IF_FALSE(permissionStateParcel != nullptr, permissionStateParcel);
-
-    RELEASE_IF_FALSE(in.ReadString(permissionStateParcel->permStatFull.permissionName), permissionStateParcel);
-    RELEASE_IF_FALSE(in.ReadBool(permissionStateParcel->permStatFull.isGeneral), permissionStateParcel);
-
-    int resIdSize = 0;
-    RELEASE_IF_FALSE(in.ReadInt32(resIdSize), permissionStateParcel);
-    for (int i = 0; i < resIdSize; i++) {
-        std::string resId;
-        RELEASE_IF_FALSE(in.ReadString(resId), permissionStateParcel);
-        permissionStateParcel->permStatFull.resDeviceID.emplace_back(resId);
-    }
-
-    int grantStatsSize = 0;
-    RELEASE_IF_FALSE(in.ReadInt32(grantStatsSize), permissionStateParcel);
-    for (int i = 0; i < grantStatsSize; i++) {
-        int grantStat;
-        RELEASE_IF_FALSE(in.ReadInt32(grantStat), permissionStateParcel);
-        permissionStateParcel->permStatFull.grantStatus.emplace_back(grantStat);
-    }
-
-    int grantFlagSize = 0;
-    RELEASE_IF_FALSE(in.ReadInt32(grantFlagSize), permissionStateParcel);
-    for (int i = 0; i < grantFlagSize; i++) {
-        int flag;
-        RELEASE_IF_FALSE(in.ReadInt32(flag), permissionStateParcel);
-        permissionStateParcel->permStatFull.grantFlags.emplace_back(flag);
-    }
-    return permissionStateParcel;
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "permission_state_full_parcel.h"
+#include "parcel_utils.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+bool PermissionStateFullParcel::Marshalling(Parcel& out) const
+{
+    RETURN_IF_FALSE(out.WriteString(this->permStatFull.permissionName));
+    RETURN_IF_FALSE(out.WriteBool(this->permStatFull.isGeneral));
+
+    RETURN_IF_FALSE(out.WriteInt32((int32_t)(this->permStatFull.resDeviceID.size())));
+    for (auto devId : this->permStatFull.resDeviceID) {
+        RETURN_IF_FALSE(out.WriteString(devId));
+    }
+
+    RETURN_IF_FALSE(out.WriteInt32((int32_t)(this->permStatFull.grantStatus.size())));
+    for (auto grantStat : this->permStatFull.grantStatus) {
+        RETURN_IF_FALSE(out.WriteInt32(grantStat));
+    }
+
+    RETURN_IF_FALSE(out.WriteInt32((int32_t)(this->permStatFull.grantFlags.size())));
+    for (auto grantFlag : this->permStatFull.grantFlags) {
+        RETURN_IF_FALSE(out.WriteInt32(grantFlag));
+    }
+    return true;
+}
+
+PermissionStateFullParcel* PermissionStateFullParcel::Unmarshalling(Parcel& in)
+{
+    auto* permissionStateParcel = new (std::nothrow) PermissionStateFullParcel();
+    RELEASE_IF_FALSE(permissionStateParcel != nullptr, permissionStateParcel);
+
+    RELEASE_IF_FALSE(in.ReadString(permissionStateParcel->permStatFull.permissionName), permissionStateParcel);
+    RELEASE_IF_FALSE(in.ReadBool(permissionStateParcel->permStatFull.isGeneral), permissionStateParcel);
+
+    int resIdSize = 0;
+    RELEASE_IF_FALSE(in.ReadInt32(resIdSize), permissionStateParcel);
+    for (int i = 0; i < resIdSize; i++) {
+        std::string resId;
+        RELEASE_IF_FALSE(in.ReadString(resId), permissionStateParcel);
+        permissionStateParcel->permStatFull.resDeviceID.emplace_back(resId);
+    }
+
+    int grantStatsSize = 0;
+    RELEASE_IF_FALSE(in.ReadInt32(grantStatsSize), permissionStateParcel);
+    for (int i = 0; i < grantStatsSize; i++) {
+        int grantStat;
+        RELEASE_IF_FALSE(in.ReadInt32(grantStat), permissionStateParcel);
+        permissionStateParcel->permStatFull.grantStatus.emplace_back(grantStat);
+    }
+
+    int grantFlagSize = 0;
+    RELEASE_IF_FALSE(in.ReadInt32(grantFlagSize), permissionStateParcel);
+    for (int i = 0; i < grantFlagSize; i++) {
+        int flag;
+        RELEASE_IF_FALSE(in.ReadInt32(flag), permissionStateParcel);
+        permissionStateParcel->permStatFull.grantFlags.emplace_back(flag);
+    }
+    return permissionStateParcel;
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/frameworks/com.ohos.permissionmanager/.gitignore b/frameworks/com.ohos.permissionmanager/.gitignore
index 39187ebed671ccfd399a7e88520b1075926c058e..2981358453339f3410b8e9f950599013a9ee0a99 100644
--- a/frameworks/com.ohos.permissionmanager/.gitignore
+++ b/frameworks/com.ohos.permissionmanager/.gitignore
@@ -1,4 +1,4 @@
-/node_modules
-/local.properties
-/.idea
+/node_modules
+/local.properties
+/.idea
 **/build
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/AppScope/app.json5 b/frameworks/com.ohos.permissionmanager/AppScope/app.json5
index 22b0ce94ea5a6ec86d8ff9cfbc079c9c9c64912f..7648d225024d0180a15678ee3603a445049e631a 100644
--- a/frameworks/com.ohos.permissionmanager/AppScope/app.json5
+++ b/frameworks/com.ohos.permissionmanager/AppScope/app.json5
@@ -1,26 +1,26 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-{
-  "app": {
-    "bundleName": "com.ohos.permissionmanager",
-    "vendor": "example",
-    "versionCode": 1000000,
-    "versionName": "1.0.0",
-    "icon": "$media:app_icon",
-    "label": "$string:app_name",
-    "distributedNotificationEnabled": true
-  }
-}
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+{
+  "app": {
+    "bundleName": "com.ohos.permissionmanager",
+    "vendor": "example",
+    "versionCode": 1000000,
+    "versionName": "1.0.0",
+    "icon": "$media:app_icon",
+    "label": "$string:app_name",
+    "distributedNotificationEnabled": true
+  }
+}
diff --git a/frameworks/com.ohos.permissionmanager/AppScope/resources/base/element/string.json b/frameworks/com.ohos.permissionmanager/AppScope/resources/base/element/string.json
index 4fe2f85945857ee885481b8b8d6750c9caa8ccf3..b3b093150cf1112130df22149084e9916e8b0d7a 100644
--- a/frameworks/com.ohos.permissionmanager/AppScope/resources/base/element/string.json
+++ b/frameworks/com.ohos.permissionmanager/AppScope/resources/base/element/string.json
@@ -1,8 +1,8 @@
-{
-  "string": [
-    {
-      "name": "app_name",
-      "value": "权限管理"
-    }
-  ]
-}
+{
+  "string": [
+    {
+      "name": "app_name",
+      "value": "权限管理"
+    }
+  ]
+}
diff --git a/frameworks/com.ohos.permissionmanager/build-profile.json5 b/frameworks/com.ohos.permissionmanager/build-profile.json5
index aaf5d5afbda89e79f9d6c33d198770785896aa75..d2eee0aee734373a065f02ef67a57e85dd2cfa89 100644
--- a/frameworks/com.ohos.permissionmanager/build-profile.json5
+++ b/frameworks/com.ohos.permissionmanager/build-profile.json5
@@ -1,58 +1,58 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-{
-  "app": {
-    "compileSdkVersion": 9,
-    "compatibleSdkVersion": 9,
-    "products": [
-      {
-        "name": "default",
-        "signingConfig": "default"
-      }
-    ],
-    "signingConfigs": [
-      {
-        "name": "default",
-      }
-    ]
-  },
-  "modules": [
-    {
-      "name": "entry",
-      "srcPath": "./entry",
-      "targets": [
-        {
-          "name": "default",
-          "applyToProducts": [
-            "default"
-          ]
-        }
-      ]
-    },
-    {
-      "name": "permissionmanager",
-      "srcPath": "./permissionmanager",
-      "targets": [
-        {
-          "name": "default",
-          "applyToProducts": [
-            "default"
-          ]
-        }
-      ]
-    }
-  ]
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+{
+  "app": {
+    "compileSdkVersion": 9,
+    "compatibleSdkVersion": 9,
+    "products": [
+      {
+        "name": "default",
+        "signingConfig": "default"
+      }
+    ],
+    "signingConfigs": [
+      {
+        "name": "default",
+      }
+    ]
+  },
+  "modules": [
+    {
+      "name": "entry",
+      "srcPath": "./entry",
+      "targets": [
+        {
+          "name": "default",
+          "applyToProducts": [
+            "default"
+          ]
+        }
+      ]
+    },
+    {
+      "name": "permissionmanager",
+      "srcPath": "./permissionmanager",
+      "targets": [
+        {
+          "name": "default",
+          "applyToProducts": [
+            "default"
+          ]
+        }
+      ]
+    }
+  ]
 }
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/entry/.gitignore b/frameworks/com.ohos.permissionmanager/entry/.gitignore
index 4f9a973815d0b5e49bc8547681a6b4bc7a178d12..16ad22851d8b327b59cf74d965ddae2598a56e11 100644
--- a/frameworks/com.ohos.permissionmanager/entry/.gitignore
+++ b/frameworks/com.ohos.permissionmanager/entry/.gitignore
@@ -1,3 +1,3 @@
-/node_modules
-/.preview
+/node_modules
+/.preview
 /build
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/entry/build-profile.json5 b/frameworks/com.ohos.permissionmanager/entry/build-profile.json5
index 8d4191ee3893b90de4b15ff67cfce2e295b0609f..e4f8a47c03ef66b1bf9200814c5475fecbe6c25e 100644
--- a/frameworks/com.ohos.permissionmanager/entry/build-profile.json5
+++ b/frameworks/com.ohos.permissionmanager/entry/build-profile.json5
@@ -1,28 +1,28 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-{
-  "apiType": 'stageMode',
-  "buildOption": {
-  },
-  "targets": [
-    {
-      "name": "default",
-    },
-    {
-      "name": "ohosTest",
-    }
-  ]
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+{
+  "apiType": 'stageMode',
+  "buildOption": {
+  },
+  "targets": [
+    {
+      "name": "default",
+    },
+    {
+      "name": "ohosTest",
+    }
+  ]
 }
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/entry/hvigorfile.js b/frameworks/com.ohos.permissionmanager/entry/hvigorfile.js
index d7720ee6a7aad5c617d1fd2f6fc8c87067bfa32c..fda93c709ee47976559e87a7d0c5c47ea7d5dd5c 100644
--- a/frameworks/com.ohos.permissionmanager/entry/hvigorfile.js
+++ b/frameworks/com.ohos.permissionmanager/entry/hvigorfile.js
@@ -1,2 +1,2 @@
-// Script for compiling build behavior. It is built in the build plug-in and cannot be modified currently.
-module.exports = require('@ohos/hvigor-ohos-plugin').hapTasks
+// Script for compiling build behavior. It is built in the build plug-in and cannot be modified currently.
+module.exports = require('@ohos/hvigor-ohos-plugin').hapTasks
diff --git a/frameworks/com.ohos.permissionmanager/entry/package-lock.json b/frameworks/com.ohos.permissionmanager/entry/package-lock.json
index 15bc7145be1490029883067847743ea7134cf545..6b5c677321c8c4acabe0282ef103e8ad3e03aab7 100644
--- a/frameworks/com.ohos.permissionmanager/entry/package-lock.json
+++ b/frameworks/com.ohos.permissionmanager/entry/package-lock.json
@@ -1,5 +1,5 @@
-{
-  "name": "entry",
-  "version": "1.0.0",
-  "lockfileVersion": 1
-}
+{
+  "name": "entry",
+  "version": "1.0.0",
+  "lockfileVersion": 1
+}
diff --git a/frameworks/com.ohos.permissionmanager/entry/package.json b/frameworks/com.ohos.permissionmanager/entry/package.json
index c7685ac4e7c0d79df04c96744f0d8f22cb4a9025..6576583641cb892756f8e1b57932eb87a84841f5 100644
--- a/frameworks/com.ohos.permissionmanager/entry/package.json
+++ b/frameworks/com.ohos.permissionmanager/entry/package.json
@@ -1,14 +1,14 @@
-{
-	"license": "ISC",
-	"devDependencies": {},
-	"name": "entry",
-	"ohos": {
-		"org": "huawei",
-		"directoryLevel": "module",
-		"buildTool": "hvigor"
-	},
-	"description": "example description",
-	"repository": {},
-	"version": "1.0.0",
-	"dependencies": {}
-}
+{
+	"license": "ISC",
+	"devDependencies": {},
+	"name": "entry",
+	"ohos": {
+		"org": "huawei",
+		"directoryLevel": "module",
+		"buildTool": "hvigor"
+	},
+	"description": "example description",
+	"repository": {},
+	"version": "1.0.0",
+	"dependencies": {}
+}
diff --git a/frameworks/com.ohos.permissionmanager/entry/src/main/ets/Application/AbilityStage.ts b/frameworks/com.ohos.permissionmanager/entry/src/main/ets/Application/AbilityStage.ts
index 32dfe93ccff0375201857794de902cec4d239442..8a1acf6be6bc92e41cb9001dce17015877b7b36c 100644
--- a/frameworks/com.ohos.permissionmanager/entry/src/main/ets/Application/AbilityStage.ts
+++ b/frameworks/com.ohos.permissionmanager/entry/src/main/ets/Application/AbilityStage.ts
@@ -1,7 +1,7 @@
-import AbilityStage from "@ohos.application.AbilityStage"
-
-export default class MyAbilityStage extends AbilityStage {
-    onCreate() {
-        console.log("[Demo] MyAbilityStage onCreate")
-    }
+import AbilityStage from "@ohos.application.AbilityStage"
+
+export default class MyAbilityStage extends AbilityStage {
+    onCreate() {
+        console.log("[Demo] MyAbilityStage onCreate")
+    }
 }
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/entry/src/main/ets/MainAbility/MainAbility.ts b/frameworks/com.ohos.permissionmanager/entry/src/main/ets/MainAbility/MainAbility.ts
index edb9130731e04190fedab08e6446428203cadc28..ecf2e8cc51da82e48d5b2415e23958288a30b8ee 100644
--- a/frameworks/com.ohos.permissionmanager/entry/src/main/ets/MainAbility/MainAbility.ts
+++ b/frameworks/com.ohos.permissionmanager/entry/src/main/ets/MainAbility/MainAbility.ts
@@ -1,34 +1,34 @@
-import Ability from '@ohos.application.Ability'
-
-export default class MainAbility extends Ability {
-    onCreate(want, launchParam) {
-        console.log("[Demo] MainAbility onCreate")
-        globalThis.abilityWant = want;
-    }
-
-    onDestroy() {
-        console.log("[Demo] MainAbility onDestroy")
-    }
-
-    onWindowStageCreate(windowStage) {
-        // Main window is created, set main page for this ability
-        console.log("[Demo] MainAbility onWindowStageCreate")
-
-        windowStage.setUIContent(this.context, "pages/index", null)
-    }
-
-    onWindowStageDestroy() {
-        // Main window is destroyed, release UI related resources
-        console.log("[Demo] MainAbility onWindowStageDestroy")
-    }
-
-    onForeground() {
-        // Ability has brought to foreground
-        console.log("[Demo] MainAbility onForeground")
-    }
-
-    onBackground() {
-        // Ability has back to background
-        console.log("[Demo] MainAbility onBackground")
-    }
-};
+import Ability from '@ohos.application.Ability'
+
+export default class MainAbility extends Ability {
+    onCreate(want, launchParam) {
+        console.log("[Demo] MainAbility onCreate")
+        globalThis.abilityWant = want;
+    }
+
+    onDestroy() {
+        console.log("[Demo] MainAbility onDestroy")
+    }
+
+    onWindowStageCreate(windowStage) {
+        // Main window is created, set main page for this ability
+        console.log("[Demo] MainAbility onWindowStageCreate")
+
+        windowStage.setUIContent(this.context, "pages/index", null)
+    }
+
+    onWindowStageDestroy() {
+        // Main window is destroyed, release UI related resources
+        console.log("[Demo] MainAbility onWindowStageDestroy")
+    }
+
+    onForeground() {
+        // Ability has brought to foreground
+        console.log("[Demo] MainAbility onForeground")
+    }
+
+    onBackground() {
+        // Ability has back to background
+        console.log("[Demo] MainAbility onBackground")
+    }
+};
diff --git a/frameworks/com.ohos.permissionmanager/entry/src/main/ets/pages/index.ets b/frameworks/com.ohos.permissionmanager/entry/src/main/ets/pages/index.ets
index 54bfa30ae2852e2e97807aebd3918c646d6aad9e..c4c382cf18941ac82d25ab571ebb3879b0f82811 100644
--- a/frameworks/com.ohos.permissionmanager/entry/src/main/ets/pages/index.ets
+++ b/frameworks/com.ohos.permissionmanager/entry/src/main/ets/pages/index.ets
@@ -1,32 +1,32 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-@Entry
-@Component
-struct Index {
-  @State message: string = 'Hello World'
-
-  build() {
-    Row() {
-      Column() {
-        Text(this.message)
-          .fontSize(50)
-          .fontWeight(FontWeight.Bold)
-      }
-      .width('100%')
-    }
-    .height('100%')
-  }
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+@Entry
+@Component
+struct Index {
+  @State message: string = 'Hello World'
+
+  build() {
+    Row() {
+      Column() {
+        Text(this.message)
+          .fontSize(50)
+          .fontWeight(FontWeight.Bold)
+      }
+      .width('100%')
+    }
+    .height('100%')
+  }
 }
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/entry/src/main/module.json5 b/frameworks/com.ohos.permissionmanager/entry/src/main/module.json5
index 8f7a7509a61a8ec682ca9e2cf413ac90c9f3fd84..23880f02e9a2419e6e7c9a84951db7f16222ae35 100644
--- a/frameworks/com.ohos.permissionmanager/entry/src/main/module.json5
+++ b/frameworks/com.ohos.permissionmanager/entry/src/main/module.json5
@@ -1,51 +1,51 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-{
-  "module": {
-    "name": "entry",
-    "type": "entry",
-    "srcEntrance": "./ets/Application/AbilityStage.ts",
-    "description": "$string:entry_desc",
-    "mainElement": "MainAbility",
-    "deviceTypes": [
-      "phone"
-    ],
-    "deliveryWithInstall": true,
-    "installationFree": false,
-    "pages": "$profile:main_pages",
-    "uiSyntax": "ets",
-    "abilities": [
-      {
-        "name": "MainAbility",
-        "srcEntrance": "./ets/MainAbility/MainAbility.ts",
-        "description": "$string:MainAbility_desc",
-        "icon": "$media:icon",
-        "label": "$string:MainAbility_label",
-        "visible": true,
-        "skills": [
-          {
-            "entities": [
-              "entity.system.home"
-            ],
-            "actions": [
-              "action.system.home"
-            ]
-          }
-        ]
-      }
-    ]
-  }
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+{
+  "module": {
+    "name": "entry",
+    "type": "entry",
+    "srcEntrance": "./ets/Application/AbilityStage.ts",
+    "description": "$string:entry_desc",
+    "mainElement": "MainAbility",
+    "deviceTypes": [
+      "phone"
+    ],
+    "deliveryWithInstall": true,
+    "installationFree": false,
+    "pages": "$profile:main_pages",
+    "uiSyntax": "ets",
+    "abilities": [
+      {
+        "name": "MainAbility",
+        "srcEntrance": "./ets/MainAbility/MainAbility.ts",
+        "description": "$string:MainAbility_desc",
+        "icon": "$media:icon",
+        "label": "$string:MainAbility_label",
+        "visible": true,
+        "skills": [
+          {
+            "entities": [
+              "entity.system.home"
+            ],
+            "actions": [
+              "action.system.home"
+            ]
+          }
+        ]
+      }
+    ]
+  }
 }
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/entry/src/main/resources/base/element/string.json b/frameworks/com.ohos.permissionmanager/entry/src/main/resources/base/element/string.json
index 490210a3908f47722dc942d49dacc98b97669a5f..dddf9123aec0b6c9500eeacf289ac1bc58ff7a6a 100644
--- a/frameworks/com.ohos.permissionmanager/entry/src/main/resources/base/element/string.json
+++ b/frameworks/com.ohos.permissionmanager/entry/src/main/resources/base/element/string.json
@@ -1,16 +1,16 @@
-{
-  "string": [
-    {
-      "name": "entry_desc",
-      "value": "description"
-    },
-    {
-      "name": "MainAbility_desc",
-      "value": "description"
-    },
-    {
-      "name": "MainAbility_label",
-      "value": "label"
-    }
-  ]
+{
+  "string": [
+    {
+      "name": "entry_desc",
+      "value": "description"
+    },
+    {
+      "name": "MainAbility_desc",
+      "value": "description"
+    },
+    {
+      "name": "MainAbility_label",
+      "value": "label"
+    }
+  ]
 }
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/entry/src/main/resources/base/profile/main_pages.json b/frameworks/com.ohos.permissionmanager/entry/src/main/resources/base/profile/main_pages.json
index feec276e105eeb8d621c20aaf838f318b0a94150..50b961efe7eba3554818d73178d6c4aa735bcd16 100644
--- a/frameworks/com.ohos.permissionmanager/entry/src/main/resources/base/profile/main_pages.json
+++ b/frameworks/com.ohos.permissionmanager/entry/src/main/resources/base/profile/main_pages.json
@@ -1,5 +1,5 @@
-{
-  "src": [
-    "pages/index"
-  ]
-}
+{
+  "src": [
+    "pages/index"
+  ]
+}
diff --git a/frameworks/com.ohos.permissionmanager/hvigorfile.js b/frameworks/com.ohos.permissionmanager/hvigorfile.js
index 5f2735e3deeaf655828407544bbed9365c258278..586ced98461bdcdac2b070f2e041e99c7ac678d9 100644
--- a/frameworks/com.ohos.permissionmanager/hvigorfile.js
+++ b/frameworks/com.ohos.permissionmanager/hvigorfile.js
@@ -1,2 +1,2 @@
-// Script for compiling build behavior. It is built in the build plug-in and cannot be modified currently.
+// Script for compiling build behavior. It is built in the build plug-in and cannot be modified currently.
 module.exports = require('@ohos/hvigor-ohos-plugin').appTasks
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/package-lock.json b/frameworks/com.ohos.permissionmanager/package-lock.json
index 638b410244d9b7d9adc2c752d9b8741c2149fbab..1f54866aa19a152feb4570f270d2643423eeb295 100644
--- a/frameworks/com.ohos.permissionmanager/package-lock.json
+++ b/frameworks/com.ohos.permissionmanager/package-lock.json
@@ -1,1643 +1,1643 @@
-{
-  "name": "permissionmanager",
-  "version": "1.0.0",
-  "lockfileVersion": 1,
-  "requires": true,
-  "dependencies": {
-    "@ohos/hvigor": {
-      "version": "1.0.6",
-      "resolved": "https://repo.harmonyos.com/npm/@ohos/hvigor/-/@ohos/hvigor-1.0.6.tgz",
-      "integrity": "sha512-jjp7vpvUOMW1Nf7TdyhOtonwWHoSyBJLUiZTQqIx/GJV4UJyIqsiURUOqFwncQ4L7PDdeHuWly4uEelknYeWhg==",
-      "requires": {
-        "@ohos/hvigor-base": "1.0.6",
-        "interpret": "1.4.0",
-        "liftoff": "4.0.0",
-        "mute-stdout": "1.0.0",
-        "pretty-hrtime": "1.0.0",
-        "v8flags": "3.2.0",
-        "yargs": "7.1.0"
-      }
-    },
-    "@ohos/hvigor-base": {
-      "version": "1.0.6",
-      "resolved": "https://repo.harmonyos.com/npm/@ohos/hvigor-base/-/@ohos/hvigor-base-1.0.6.tgz",
-      "integrity": "sha512-cRDnWICTxmpNiFb9clIioqP5Oik1seLCICztXVhZqultrHuxwTheCRUZrHwlpyWdkSB2Al+FFBqmSwzIgZX4IQ==",
-      "requires": {
-        "json5": "2.2.0",
-        "log4js": "6.4.1",
-        "undertaker": "1.2.1"
-      }
-    },
-    "@ohos/hvigor-ohos-plugin": {
-      "version": "1.0.6",
-      "resolved": "https://repo.harmonyos.com/npm/@ohos/hvigor-ohos-plugin/-/@ohos/hvigor-ohos-plugin-1.0.6.tgz",
-      "integrity": "sha512-MAAi8uJxMzODUoSSNfBr+fU4HQ20dfQtkje9I+X4asc7qY2kAplW/q9f5XS8IOvv8zhC8OcSgsAXOAJuLMstOQ==",
-      "requires": {
-        "@ohos/hvigor-base": "1.0.6",
-        "@ohos/sdkmanager-common": "1.1.3",
-        "ajv": "8.10.0",
-        "archiver": "5.3.0",
-        "execa": "5.1.1",
-        "fs-extra": "10.0.0",
-        "glob": "7.2.0",
-        "iconv-lite": "0.6.3",
-        "json5": "2.2.0",
-        "lodash": "4.17.21",
-        "pretty-hrtime": "1.0.3",
-        "resolve-package-path": "4.0.3"
-      },
-      "dependencies": {
-        "fs-extra": {
-          "version": "10.0.0",
-          "resolved": "https://repo.huaweicloud.com/repository/npm/fs-extra/-/fs-extra-10.0.0.tgz",
-          "integrity": "sha512-C5owb14u9eJwizKGdchcDUQeFtlSHHthBk8pbX9Vc1PFZrLombudjDnNns88aYslCyF6IY5SUw3Roz6xShcEIQ==",
-          "requires": {
-            "graceful-fs": "^4.2.0",
-            "jsonfile": "^6.0.1",
-            "universalify": "^2.0.0"
-          }
-        },
-        "pretty-hrtime": {
-          "version": "1.0.3",
-          "resolved": "https://repo.huaweicloud.com/repository/npm/pretty-hrtime/-/pretty-hrtime-1.0.3.tgz",
-          "integrity": "sha1-t+PqQkNaTJsnWdmeDyAesZWALuE="
-        }
-      }
-    },
-    "@ohos/sdkmanager-common": {
-      "version": "1.1.3",
-      "resolved": "https://repo.harmonyos.com/npm/@ohos/sdkmanager-common/-/@ohos/sdkmanager-common-1.1.3.tgz",
-      "integrity": "sha512-d2uhVauDDJZIUvyyaWWoavG4N/jLyfF5IH5kEXKV6R8HNf3606H1zDQzA+UZtOfwwJFXhD9djRjnVFNB8xc7aw=="
-    },
-    "ajv": {
-      "version": "8.10.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/ajv/-/ajv-8.10.0.tgz",
-      "integrity": "sha512-bzqAEZOjkrUMl2afH8dknrq5KEk2SrwdBROR+vH1EKVQTqaUbJVPdc/gEdggTMM0Se+s+Ja4ju4TlNcStKl2Hw==",
-      "requires": {
-        "fast-deep-equal": "^3.1.1",
-        "json-schema-traverse": "^1.0.0",
-        "require-from-string": "^2.0.2",
-        "uri-js": "^4.2.2"
-      }
-    },
-    "ansi-regex": {
-      "version": "2.1.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/ansi-regex/-/ansi-regex-2.1.1.tgz",
-      "integrity": "sha1-w7M6te42DYbg5ijwRorn7yfWVN8="
-    },
-    "archiver": {
-      "version": "5.3.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/archiver/-/archiver-5.3.0.tgz",
-      "integrity": "sha512-iUw+oDwK0fgNpvveEsdQ0Ase6IIKztBJU2U0E9MzszMfmVVUyv1QJhS2ITW9ZCqx8dktAxVAjWWkKehuZE8OPg==",
-      "requires": {
-        "archiver-utils": "^2.1.0",
-        "async": "^3.2.0",
-        "buffer-crc32": "^0.2.1",
-        "readable-stream": "^3.6.0",
-        "readdir-glob": "^1.0.0",
-        "tar-stream": "^2.2.0",
-        "zip-stream": "^4.1.0"
-      }
-    },
-    "archiver-utils": {
-      "version": "2.1.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/archiver-utils/-/archiver-utils-2.1.0.tgz",
-      "integrity": "sha512-bEL/yUb/fNNiNTuUz979Z0Yg5L+LzLxGJz8x79lYmR54fmTIb6ob/hNQgkQnIUDWIFjZVQwl9Xs356I6BAMHfw==",
-      "requires": {
-        "glob": "^7.1.4",
-        "graceful-fs": "^4.2.0",
-        "lazystream": "^1.0.0",
-        "lodash.defaults": "^4.2.0",
-        "lodash.difference": "^4.5.0",
-        "lodash.flatten": "^4.4.0",
-        "lodash.isplainobject": "^4.0.6",
-        "lodash.union": "^4.6.0",
-        "normalize-path": "^3.0.0",
-        "readable-stream": "^2.0.0"
-      },
-      "dependencies": {
-        "readable-stream": {
-          "version": "2.3.7",
-          "resolved": "https://repo.huaweicloud.com/repository/npm/readable-stream/-/readable-stream-2.3.7.tgz",
-          "integrity": "sha512-Ebho8K4jIbHAxnuxi7o42OrZgF/ZTNcsZj6nRKyUmkhLFq8CHItp/fy6hQZuZmP/n3yZ9VBUbp4zz/mX8hmYPw==",
-          "requires": {
-            "core-util-is": "~1.0.0",
-            "inherits": "~2.0.3",
-            "isarray": "~1.0.0",
-            "process-nextick-args": "~2.0.0",
-            "safe-buffer": "~5.1.1",
-            "string_decoder": "~1.1.1",
-            "util-deprecate": "~1.0.1"
-          }
-        }
-      }
-    },
-    "arr-filter": {
-      "version": "1.1.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/arr-filter/-/arr-filter-1.1.2.tgz",
-      "integrity": "sha1-Q/3d0JHo7xGqTEXZzcGOLf8XEe4=",
-      "requires": {
-        "make-iterator": "^1.0.0"
-      }
-    },
-    "arr-flatten": {
-      "version": "1.1.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/arr-flatten/-/arr-flatten-1.1.0.tgz",
-      "integrity": "sha512-L3hKV5R/p5o81R7O02IGnwpDmkp6E982XhtbuwSe3O4qOtMMMtodicASA1Cny2U+aCXcNpml+m4dPsvsJ3jatg=="
-    },
-    "arr-map": {
-      "version": "2.0.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/arr-map/-/arr-map-2.0.2.tgz",
-      "integrity": "sha1-Onc0X/wc814qkYJWAfnljy4kysQ=",
-      "requires": {
-        "make-iterator": "^1.0.0"
-      }
-    },
-    "array-each": {
-      "version": "1.0.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/array-each/-/array-each-1.0.1.tgz",
-      "integrity": "sha1-p5SvDAWrF1KEbudTofIRoFugxE8="
-    },
-    "array-initial": {
-      "version": "1.1.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/array-initial/-/array-initial-1.1.0.tgz",
-      "integrity": "sha1-L6dLJnOTccOUe9enrcc74zSz15U=",
-      "requires": {
-        "array-slice": "^1.0.0",
-        "is-number": "^4.0.0"
-      }
-    },
-    "array-last": {
-      "version": "1.3.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/array-last/-/array-last-1.3.0.tgz",
-      "integrity": "sha512-eOCut5rXlI6aCOS7Z7kCplKRKyiFQ6dHFBem4PwlwKeNFk2/XxTrhRh5T9PyaEWGy/NHTZWbY+nsZlNFJu9rYg==",
-      "requires": {
-        "is-number": "^4.0.0"
-      }
-    },
-    "array-slice": {
-      "version": "1.1.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/array-slice/-/array-slice-1.1.0.tgz",
-      "integrity": "sha512-B1qMD3RBP7O8o0H2KbrXDyB0IccejMF15+87Lvlor12ONPRHP6gTjXMNkt/d3ZuOGbAe66hFmaCfECI24Ufp6w=="
-    },
-    "async": {
-      "version": "3.2.3",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/async/-/async-3.2.3.tgz",
-      "integrity": "sha512-spZRyzKL5l5BZQrr/6m/SqFdBN0q3OCI0f9rjfBzCMBIP4p75P620rR3gTmaksNOhmzgdxcaxdNfMy6anrbM0g=="
-    },
-    "async-done": {
-      "version": "1.3.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/async-done/-/async-done-1.3.2.tgz",
-      "integrity": "sha512-uYkTP8dw2og1tu1nmza1n1CMW0qb8gWWlwqMmLb7MhBVs4BXrFziT6HXUd+/RlRA/i4H9AkofYloUbs1fwMqlw==",
-      "requires": {
-        "end-of-stream": "^1.1.0",
-        "once": "^1.3.2",
-        "process-nextick-args": "^2.0.0",
-        "stream-exhaust": "^1.0.1"
-      }
-    },
-    "async-settle": {
-      "version": "1.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/async-settle/-/async-settle-1.0.0.tgz",
-      "integrity": "sha1-HQqRS7Aldb7IqPOnTlCA9yssDGs=",
-      "requires": {
-        "async-done": "^1.2.2"
-      }
-    },
-    "bach": {
-      "version": "1.2.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/bach/-/bach-1.2.0.tgz",
-      "integrity": "sha1-Szzpa/JxNPeaG0FKUcFONMO9mIA=",
-      "requires": {
-        "arr-filter": "^1.1.1",
-        "arr-flatten": "^1.0.1",
-        "arr-map": "^2.0.0",
-        "array-each": "^1.0.0",
-        "array-initial": "^1.0.0",
-        "array-last": "^1.1.1",
-        "async-done": "^1.2.2",
-        "async-settle": "^1.0.0",
-        "now-and-later": "^2.0.0"
-      }
-    },
-    "balanced-match": {
-      "version": "1.0.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/balanced-match/-/balanced-match-1.0.2.tgz",
-      "integrity": "sha512-3oSeUO0TMV67hN1AmbXsK4yaqU7tjiHlbxRDZOpH0KW9+CeX4bRAaX0Anxt0tx2MrpRpWwQaPwIlISEJhYU5Pw=="
-    },
-    "base64-js": {
-      "version": "1.5.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/base64-js/-/base64-js-1.5.1.tgz",
-      "integrity": "sha512-AKpaYlHn8t4SVbOHCy+b5+KKgvR4vrsD8vbvrbiQJps7fKDTkjkDry6ji0rUJjC0kzbNePLwzxq8iypo41qeWA=="
-    },
-    "bl": {
-      "version": "4.1.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/bl/-/bl-4.1.0.tgz",
-      "integrity": "sha512-1W07cM9gS6DcLperZfFSj+bWLtaPGSOHWhPiGzXmvVJbRLdG82sH/Kn8EtW1VqWVA54AKf2h5k5BbnIbwF3h6w==",
-      "requires": {
-        "buffer": "^5.5.0",
-        "inherits": "^2.0.4",
-        "readable-stream": "^3.4.0"
-      }
-    },
-    "brace-expansion": {
-      "version": "1.1.11",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/brace-expansion/-/brace-expansion-1.1.11.tgz",
-      "integrity": "sha512-iCuPHDFgrHX7H2vEI/5xpz07zSHB00TpugqhmYtVmMO6518mCuRMoOYFldEBl0g187ufozdaHgWKcYFb61qGiA==",
-      "requires": {
-        "balanced-match": "^1.0.0",
-        "concat-map": "0.0.1"
-      }
-    },
-    "braces": {
-      "version": "3.0.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/braces/-/braces-3.0.2.tgz",
-      "integrity": "sha512-b8um+L1RzM3WDSzvhm6gIz1yfTbBt6YTlcEKAvsmqCZZFw46z626lVj9j1yEPW33H5H+lBQpZMP1k8l+78Ha0A==",
-      "requires": {
-        "fill-range": "^7.0.1"
-      }
-    },
-    "buffer": {
-      "version": "5.7.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/buffer/-/buffer-5.7.1.tgz",
-      "integrity": "sha512-EHcyIPBQ4BSGlvjB16k5KgAJ27CIsHY/2JBmCRReo48y9rQ3MaUzWX3KVlBa4U7MyX02HdVj0K7C3WaB3ju7FQ==",
-      "requires": {
-        "base64-js": "^1.3.1",
-        "ieee754": "^1.1.13"
-      }
-    },
-    "buffer-crc32": {
-      "version": "0.2.13",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/buffer-crc32/-/buffer-crc32-0.2.13.tgz",
-      "integrity": "sha1-DTM+PwDqxQqhRUq9MO+MKl2ackI="
-    },
-    "call-bind": {
-      "version": "1.0.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/call-bind/-/call-bind-1.0.2.tgz",
-      "integrity": "sha512-7O+FbCihrB5WGbFYesctwmTKae6rOiIzmz1icreWJ+0aA7LJfuqhEso2T9ncpcFtzMQtzXf2QGGueWJGTYsqrA==",
-      "requires": {
-        "function-bind": "^1.1.1",
-        "get-intrinsic": "^1.0.2"
-      }
-    },
-    "camelcase": {
-      "version": "3.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/camelcase/-/camelcase-3.0.0.tgz",
-      "integrity": "sha1-MvxLn82vhF/N9+c7uXysImHwqwo="
-    },
-    "cliui": {
-      "version": "3.2.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/cliui/-/cliui-3.2.0.tgz",
-      "integrity": "sha1-EgYBU3qRbSmUD5NNo7SNWFo5IT0=",
-      "requires": {
-        "string-width": "^1.0.1",
-        "strip-ansi": "^3.0.1",
-        "wrap-ansi": "^2.0.0"
-      }
-    },
-    "code-point-at": {
-      "version": "1.1.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/code-point-at/-/code-point-at-1.1.0.tgz",
-      "integrity": "sha1-DQcLTQQ6W+ozovGkDi7bPZpMz3c="
-    },
-    "collection-map": {
-      "version": "1.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/collection-map/-/collection-map-1.0.0.tgz",
-      "integrity": "sha1-rqDwb40mx4DCt1SUOFVEsiVa8Yw=",
-      "requires": {
-        "arr-map": "^2.0.2",
-        "for-own": "^1.0.0",
-        "make-iterator": "^1.0.0"
-      }
-    },
-    "compress-commons": {
-      "version": "4.1.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/compress-commons/-/compress-commons-4.1.1.tgz",
-      "integrity": "sha512-QLdDLCKNV2dtoTorqgxngQCMA+gWXkM/Nwu7FpeBhk/RdkzimqC3jueb/FDmaZeXh+uby1jkBqE3xArsLBE5wQ==",
-      "requires": {
-        "buffer-crc32": "^0.2.13",
-        "crc32-stream": "^4.0.2",
-        "normalize-path": "^3.0.0",
-        "readable-stream": "^3.6.0"
-      }
-    },
-    "concat-map": {
-      "version": "0.0.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/concat-map/-/concat-map-0.0.1.tgz",
-      "integrity": "sha1-2Klr13/Wjfd5OnMDajug1UBdR3s="
-    },
-    "core-util-is": {
-      "version": "1.0.3",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/core-util-is/-/core-util-is-1.0.3.tgz",
-      "integrity": "sha512-ZQBvi1DcpJ4GDqanjucZ2Hj3wEO5pZDS89BWbkcrvdxksJorwUDDZamX9ldFkp9aw2lmBDLgkObEA4DWNJ9FYQ=="
-    },
-    "crc-32": {
-      "version": "1.2.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/crc-32/-/crc-32-1.2.2.tgz",
-      "integrity": "sha512-ROmzCKrTnOwybPcJApAA6WBWij23HVfGVNKqqrZpuyZOHqK2CwHSvpGuyt/UNNvaIjEd8X5IFGp4Mh+Ie1IHJQ=="
-    },
-    "crc32-stream": {
-      "version": "4.0.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/crc32-stream/-/crc32-stream-4.0.2.tgz",
-      "integrity": "sha512-DxFZ/Hk473b/muq1VJ///PMNLj0ZMnzye9thBpmjpJKCc5eMgB95aK8zCGrGfQ90cWo561Te6HK9D+j4KPdM6w==",
-      "requires": {
-        "crc-32": "^1.2.0",
-        "readable-stream": "^3.4.0"
-      }
-    },
-    "cross-spawn": {
-      "version": "7.0.3",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/cross-spawn/-/cross-spawn-7.0.3.tgz",
-      "integrity": "sha512-iRDPJKUPVEND7dHPO8rkbOnPpyDygcDFtWjpeWNCgy8WP2rXcxXL8TskReQl6OrB2G7+UJrags1q15Fudc7G6w==",
-      "requires": {
-        "path-key": "^3.1.0",
-        "shebang-command": "^2.0.0",
-        "which": "^2.0.1"
-      },
-      "dependencies": {
-        "which": {
-          "version": "2.0.2",
-          "resolved": "https://repo.huaweicloud.com/repository/npm/which/-/which-2.0.2.tgz",
-          "integrity": "sha512-BLI3Tl1TW3Pvl70l3yq3Y64i+awpwXqsGBYWkkqMtnbXgrMD+yj7rhW0kuEDxzJaYXGjEW5ogapKNMEKNMjibA==",
-          "requires": {
-            "isexe": "^2.0.0"
-          }
-        }
-      }
-    },
-    "d": {
-      "version": "1.0.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/d/-/d-1.0.1.tgz",
-      "integrity": "sha512-m62ShEObQ39CfralilEQRjH6oAMtNCV1xJyEx5LpRYUVN+EviphDgUc/F3hnYbADmkiNs67Y+3ylmlG7Lnu+FA==",
-      "requires": {
-        "es5-ext": "^0.10.50",
-        "type": "^1.0.1"
-      }
-    },
-    "date-format": {
-      "version": "4.0.6",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/date-format/-/date-format-4.0.6.tgz",
-      "integrity": "sha512-B9vvg5rHuQ8cbUXE/RMWMyX2YA5TecT3jKF5fLtGNlzPlU7zblSPmAm2OImDbWL+LDOQ6pUm+4LOFz+ywS41Zw=="
-    },
-    "debug": {
-      "version": "4.3.4",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/debug/-/debug-4.3.4.tgz",
-      "integrity": "sha512-PRWFHuSU3eDtQJPvnNY7Jcket1j0t5OuOsFzPPzsekD52Zl8qUfFIPEiswXqIvHWGVHOgX+7G/vCNNhehwxfkQ==",
-      "requires": {
-        "ms": "2.1.2"
-      }
-    },
-    "decamelize": {
-      "version": "1.2.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/decamelize/-/decamelize-1.2.0.tgz",
-      "integrity": "sha1-9lNNFRSCabIDUue+4m9QH5oZEpA="
-    },
-    "default-resolution": {
-      "version": "2.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/default-resolution/-/default-resolution-2.0.0.tgz",
-      "integrity": "sha1-vLgrqnKtebQmp2cy8aga1t8m1oQ="
-    },
-    "define-properties": {
-      "version": "1.1.3",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/define-properties/-/define-properties-1.1.3.tgz",
-      "integrity": "sha512-3MqfYKj2lLzdMSf8ZIZE/V+Zuy+BgD6f164e8K2w7dgnpKArBDerGYpM46IYYcjnkdPNMjPk9A6VFB8+3SKlXQ==",
-      "requires": {
-        "object-keys": "^1.0.12"
-      }
-    },
-    "detect-file": {
-      "version": "1.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/detect-file/-/detect-file-1.0.0.tgz",
-      "integrity": "sha1-8NZtA2cqglyxtzvbP+YjEMjlUrc="
-    },
-    "end-of-stream": {
-      "version": "1.4.4",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/end-of-stream/-/end-of-stream-1.4.4.tgz",
-      "integrity": "sha512-+uw1inIHVPQoaVuHzRyXd21icM+cnt4CzD5rW+NC1wjOUSTOs+Te7FOv7AhN7vS9x/oIyhLP5PR1H+phQAHu5Q==",
-      "requires": {
-        "once": "^1.4.0"
-      }
-    },
-    "error-ex": {
-      "version": "1.3.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/error-ex/-/error-ex-1.3.2.tgz",
-      "integrity": "sha512-7dFHNmqeFSEt2ZBsCriorKnn3Z2pj+fd9kmI6QoWw4//DL+icEBfc0U7qJCisqrTsKTjw4fNFy2pW9OqStD84g==",
-      "requires": {
-        "is-arrayish": "^0.2.1"
-      }
-    },
-    "es5-ext": {
-      "version": "0.10.59",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/es5-ext/-/es5-ext-0.10.59.tgz",
-      "integrity": "sha512-cOgyhW0tIJyQY1Kfw6Kr0viu9ZlUctVchRMZ7R0HiH3dxTSp5zJDLecwxUqPUrGKMsgBI1wd1FL+d9Jxfi4cLw==",
-      "requires": {
-        "es6-iterator": "^2.0.3",
-        "es6-symbol": "^3.1.3",
-        "next-tick": "^1.1.0"
-      }
-    },
-    "es6-iterator": {
-      "version": "2.0.3",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/es6-iterator/-/es6-iterator-2.0.3.tgz",
-      "integrity": "sha1-p96IkUGgWpSwhUQDstCg+/qY87c=",
-      "requires": {
-        "d": "1",
-        "es5-ext": "^0.10.35",
-        "es6-symbol": "^3.1.1"
-      }
-    },
-    "es6-symbol": {
-      "version": "3.1.3",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/es6-symbol/-/es6-symbol-3.1.3.tgz",
-      "integrity": "sha512-NJ6Yn3FuDinBaBRWl/q5X/s4koRHBrgKAu+yGI6JCBeiu3qrcbJhwT2GeR/EXVfylRk8dpQVJoLEFhK+Mu31NA==",
-      "requires": {
-        "d": "^1.0.1",
-        "ext": "^1.1.2"
-      }
-    },
-    "es6-weak-map": {
-      "version": "2.0.3",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/es6-weak-map/-/es6-weak-map-2.0.3.tgz",
-      "integrity": "sha512-p5um32HOTO1kP+w7PRnB+5lQ43Z6muuMuIMffvDN8ZB4GcnjLBV6zGStpbASIMk4DCAvEaamhe2zhyCb/QXXsA==",
-      "requires": {
-        "d": "1",
-        "es5-ext": "^0.10.46",
-        "es6-iterator": "^2.0.3",
-        "es6-symbol": "^3.1.1"
-      }
-    },
-    "execa": {
-      "version": "5.1.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/execa/-/execa-5.1.1.tgz",
-      "integrity": "sha512-8uSpZZocAZRBAPIEINJj3Lo9HyGitllczc27Eh5YYojjMFMn8yHMDMaUHE2Jqfq05D/wucwI4JGURyXt1vchyg==",
-      "requires": {
-        "cross-spawn": "^7.0.3",
-        "get-stream": "^6.0.0",
-        "human-signals": "^2.1.0",
-        "is-stream": "^2.0.0",
-        "merge-stream": "^2.0.0",
-        "npm-run-path": "^4.0.1",
-        "onetime": "^5.1.2",
-        "signal-exit": "^3.0.3",
-        "strip-final-newline": "^2.0.0"
-      }
-    },
-    "expand-tilde": {
-      "version": "2.0.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/expand-tilde/-/expand-tilde-2.0.2.tgz",
-      "integrity": "sha1-l+gBqgUt8CRU3kawK/YhZCzchQI=",
-      "requires": {
-        "homedir-polyfill": "^1.0.1"
-      }
-    },
-    "ext": {
-      "version": "1.6.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/ext/-/ext-1.6.0.tgz",
-      "integrity": "sha512-sdBImtzkq2HpkdRLtlLWDa6w4DX22ijZLKx8BMPUuKe1c5lbN6xwQDQCxSfxBQnHZ13ls/FH0MQZx/q/gr6FQg==",
-      "requires": {
-        "type": "^2.5.0"
-      },
-      "dependencies": {
-        "type": {
-          "version": "2.6.0",
-          "resolved": "https://repo.huaweicloud.com/repository/npm/type/-/type-2.6.0.tgz",
-          "integrity": "sha512-eiDBDOmkih5pMbo9OqsqPRGMljLodLcwd5XD5JbtNB0o89xZAwynY9EdCDsJU7LtcVCClu9DvM7/0Ep1hYX3EQ=="
-        }
-      }
-    },
-    "extend": {
-      "version": "3.0.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/extend/-/extend-3.0.2.tgz",
-      "integrity": "sha512-fjquC59cD7CyW6urNXK0FBufkZcoiGG80wTuPujX590cB5Ttln20E2UB4S/WARVqhXffZl2LNgS+gQdPIIim/g=="
-    },
-    "fast-deep-equal": {
-      "version": "3.1.3",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/fast-deep-equal/-/fast-deep-equal-3.1.3.tgz",
-      "integrity": "sha512-f3qQ9oQy9j2AhBe/H9VC91wLmKBCCU/gDOnKNAYG5hswO7BLKj09Hc5HYNz9cGI++xlpDCIgDaitVs03ATR84Q=="
-    },
-    "fill-range": {
-      "version": "7.0.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/fill-range/-/fill-range-7.0.1.tgz",
-      "integrity": "sha512-qOo9F+dMUmC2Lcb4BbVvnKJxTPjCm+RRpe4gDuGrzkL7mEVl/djYSu2OdQ2Pa302N4oqkSg9ir6jaLWJ2USVpQ==",
-      "requires": {
-        "to-regex-range": "^5.0.1"
-      }
-    },
-    "find-up": {
-      "version": "1.1.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/find-up/-/find-up-1.1.2.tgz",
-      "integrity": "sha1-ay6YIrGizgpgq2TWEOzK1TyyTQ8=",
-      "requires": {
-        "path-exists": "^2.0.0",
-        "pinkie-promise": "^2.0.0"
-      }
-    },
-    "findup-sync": {
-      "version": "5.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/findup-sync/-/findup-sync-5.0.0.tgz",
-      "integrity": "sha512-MzwXju70AuyflbgeOhzvQWAvvQdo1XL0A9bVvlXsYcFEBM87WR4OakL4OfZq+QRmr+duJubio+UtNQCPsVESzQ==",
-      "requires": {
-        "detect-file": "^1.0.0",
-        "is-glob": "^4.0.3",
-        "micromatch": "^4.0.4",
-        "resolve-dir": "^1.0.1"
-      }
-    },
-    "fined": {
-      "version": "2.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/fined/-/fined-2.0.0.tgz",
-      "integrity": "sha512-OFRzsL6ZMHz5s0JrsEr+TpdGNCtrVtnuG3x1yzGNiQHT0yaDnXAj8V/lWcpJVrnoDpcwXcASxAZYbuXda2Y82A==",
-      "requires": {
-        "expand-tilde": "^2.0.2",
-        "is-plain-object": "^5.0.0",
-        "object.defaults": "^1.1.0",
-        "object.pick": "^1.3.0",
-        "parse-filepath": "^1.0.2"
-      }
-    },
-    "flagged-respawn": {
-      "version": "2.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/flagged-respawn/-/flagged-respawn-2.0.0.tgz",
-      "integrity": "sha512-Gq/a6YCi8zexmGHMuJwahTGzXlAZAOsbCVKduWXC6TlLCjjFRlExMJc4GC2NYPYZ0r/brw9P7CpRgQmlPVeOoA=="
-    },
-    "flatted": {
-      "version": "3.2.5",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/flatted/-/flatted-3.2.5.tgz",
-      "integrity": "sha512-WIWGi2L3DyTUvUrwRKgGi9TwxQMUEqPOPQBVi71R96jZXJdFskXEmf54BoZaS1kknGODoIGASGEzBUYdyMCBJg=="
-    },
-    "for-in": {
-      "version": "1.0.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/for-in/-/for-in-1.0.2.tgz",
-      "integrity": "sha1-gQaNKVqBQuwKxybG4iAMMPttXoA="
-    },
-    "for-own": {
-      "version": "1.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/for-own/-/for-own-1.0.0.tgz",
-      "integrity": "sha1-xjMy9BXO3EsE2/5wz4NklMU8tEs=",
-      "requires": {
-        "for-in": "^1.0.1"
-      }
-    },
-    "fs-constants": {
-      "version": "1.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/fs-constants/-/fs-constants-1.0.0.tgz",
-      "integrity": "sha512-y6OAwoSIf7FyjMIv94u+b5rdheZEjzR63GTyZJm5qh4Bi+2YgwLCcI/fPFZkL5PSixOt6ZNKm+w+Hfp/Bciwow=="
-    },
-    "fs-extra": {
-      "version": "10.0.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/fs-extra/-/fs-extra-10.0.1.tgz",
-      "integrity": "sha512-NbdoVMZso2Lsrn/QwLXOy6rm0ufY2zEOKCDzJR/0kBsb0E6qed0P3iYK+Ath3BfvXEeu4JhEtXLgILx5psUfag==",
-      "requires": {
-        "graceful-fs": "^4.2.0",
-        "jsonfile": "^6.0.1",
-        "universalify": "^2.0.0"
-      }
-    },
-    "fs.realpath": {
-      "version": "1.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/fs.realpath/-/fs.realpath-1.0.0.tgz",
-      "integrity": "sha1-FQStJSMVjKpA20onh8sBQRmU6k8="
-    },
-    "function-bind": {
-      "version": "1.1.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/function-bind/-/function-bind-1.1.1.tgz",
-      "integrity": "sha512-yIovAzMX49sF8Yl58fSCWJ5svSLuaibPxXQJFLmBObTuCr0Mf1KiPopGM9NiFjiYBCbfaa2Fh6breQ6ANVTI0A=="
-    },
-    "get-caller-file": {
-      "version": "1.0.3",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/get-caller-file/-/get-caller-file-1.0.3.tgz",
-      "integrity": "sha512-3t6rVToeoZfYSGd8YoLFR2DJkiQrIiUrGcjvFX2mDw3bn6k2OtwHN0TNCLbBO+w8qTvimhDkv+LSscbJY1vE6w=="
-    },
-    "get-intrinsic": {
-      "version": "1.1.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/get-intrinsic/-/get-intrinsic-1.1.1.tgz",
-      "integrity": "sha512-kWZrnVM42QCiEA2Ig1bG8zjoIMOgxWwYCEeNdwY6Tv/cOSeGpcoX4pXHfKUxNKVoArnrEr2e9srnAxxGIraS9Q==",
-      "requires": {
-        "function-bind": "^1.1.1",
-        "has": "^1.0.3",
-        "has-symbols": "^1.0.1"
-      }
-    },
-    "get-stream": {
-      "version": "6.0.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/get-stream/-/get-stream-6.0.1.tgz",
-      "integrity": "sha512-ts6Wi+2j3jQjqi70w5AlN8DFnkSwC+MqmxEzdEALB2qXZYV3X/b1CTfgPLGJNMeAWxdPfU8FO1ms3NUfaHCPYg=="
-    },
-    "glob": {
-      "version": "7.2.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/glob/-/glob-7.2.0.tgz",
-      "integrity": "sha512-lmLf6gtyrPq8tTjSmrO94wBeQbFR3HbLHbuyD69wuyQkImp2hWqMGB47OX65FBkPffO641IP9jWa1z4ivqG26Q==",
-      "requires": {
-        "fs.realpath": "^1.0.0",
-        "inflight": "^1.0.4",
-        "inherits": "2",
-        "minimatch": "^3.0.4",
-        "once": "^1.3.0",
-        "path-is-absolute": "^1.0.0"
-      }
-    },
-    "global-modules": {
-      "version": "1.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/global-modules/-/global-modules-1.0.0.tgz",
-      "integrity": "sha512-sKzpEkf11GpOFuw0Zzjzmt4B4UZwjOcG757PPvrfhxcLFbq0wpsgpOqxpxtxFiCG4DtG93M6XRVbF2oGdev7bg==",
-      "requires": {
-        "global-prefix": "^1.0.1",
-        "is-windows": "^1.0.1",
-        "resolve-dir": "^1.0.0"
-      }
-    },
-    "global-prefix": {
-      "version": "1.0.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/global-prefix/-/global-prefix-1.0.2.tgz",
-      "integrity": "sha1-2/dDxsFJklk8ZVVoy2btMsASLr4=",
-      "requires": {
-        "expand-tilde": "^2.0.2",
-        "homedir-polyfill": "^1.0.1",
-        "ini": "^1.3.4",
-        "is-windows": "^1.0.1",
-        "which": "^1.2.14"
-      }
-    },
-    "graceful-fs": {
-      "version": "4.2.9",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/graceful-fs/-/graceful-fs-4.2.9.tgz",
-      "integrity": "sha512-NtNxqUcXgpW2iMrfqSfR73Glt39K+BLwWsPs94yR63v45T0Wbej7eRmL5cWfwEgqXnmjQp3zaJTshdRW/qC2ZQ=="
-    },
-    "has": {
-      "version": "1.0.3",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/has/-/has-1.0.3.tgz",
-      "integrity": "sha512-f2dvO0VU6Oej7RkWJGrehjbzMAjFp5/VKPp5tTpWIV4JHHZK1/BxbFRtf/siA2SWTe09caDmVtYYzWEIbBS4zw==",
-      "requires": {
-        "function-bind": "^1.1.1"
-      }
-    },
-    "has-symbols": {
-      "version": "1.0.3",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/has-symbols/-/has-symbols-1.0.3.tgz",
-      "integrity": "sha512-l3LCuF6MgDNwTDKkdYGEihYjt5pRPbEg46rtlmnSPlUbgmB8LOIrKJbYYFBSbnPaJexMKtiPO8hmeRjRz2Td+A=="
-    },
-    "homedir-polyfill": {
-      "version": "1.0.3",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/homedir-polyfill/-/homedir-polyfill-1.0.3.tgz",
-      "integrity": "sha512-eSmmWE5bZTK2Nou4g0AI3zZ9rswp7GRKoKXS1BLUkvPviOqs4YTN1djQIqrXy9k5gEtdLPy86JjRwsNM9tnDcA==",
-      "requires": {
-        "parse-passwd": "^1.0.0"
-      }
-    },
-    "hosted-git-info": {
-      "version": "2.8.9",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/hosted-git-info/-/hosted-git-info-2.8.9.tgz",
-      "integrity": "sha512-mxIDAb9Lsm6DoOJ7xH+5+X4y1LU/4Hi50L9C5sIswK3JzULS4bwk1FvjdBgvYR4bzT4tuUQiC15FE2f5HbLvYw=="
-    },
-    "human-signals": {
-      "version": "2.1.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/human-signals/-/human-signals-2.1.0.tgz",
-      "integrity": "sha512-B4FFZ6q/T2jhhksgkbEW3HBvWIfDW85snkQgawt07S7J5QXTk6BkNV+0yAeZrM5QpMAdYlocGoljn0sJ/WQkFw=="
-    },
-    "hypium": {
-      "version": "1.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/hypium/-/hypium-1.0.0.tgz",
-      "integrity": "sha512-nl+RQVv2AU/5FvFRhsXyWO5wh+2huhdqRZ3bszBWZzW+kpNI3AT4ydvVRYIfaQbYwV4UlX/rSc7BtFjLAezhow=="
-    },
-    "iconv-lite": {
-      "version": "0.6.3",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/iconv-lite/-/iconv-lite-0.6.3.tgz",
-      "integrity": "sha512-4fCk79wshMdzMp2rH06qWrJE4iolqLhCUH+OiuIgU++RB0+94NlDL81atO7GX55uUKueo0txHNtvEyI6D7WdMw==",
-      "requires": {
-        "safer-buffer": ">= 2.1.2 < 3.0.0"
-      }
-    },
-    "ieee754": {
-      "version": "1.2.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/ieee754/-/ieee754-1.2.1.tgz",
-      "integrity": "sha512-dcyqhDvX1C46lXZcVqCpK+FtMRQVdIMN6/Df5js2zouUsqG7I6sFxitIC+7KYK29KdXOLHdu9zL4sFnoVQnqaA=="
-    },
-    "inflight": {
-      "version": "1.0.6",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/inflight/-/inflight-1.0.6.tgz",
-      "integrity": "sha1-Sb1jMdfQLQwJvJEKEHW6gWW1bfk=",
-      "requires": {
-        "once": "^1.3.0",
-        "wrappy": "1"
-      }
-    },
-    "inherits": {
-      "version": "2.0.4",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/inherits/-/inherits-2.0.4.tgz",
-      "integrity": "sha512-k/vGaX4/Yla3WzyMCvTQOXYeIHvqOKtnqBduzTHpzpQZzAskKMhZ2K+EnBiSM9zGSoIFeMpXKxa4dYeZIQqewQ=="
-    },
-    "ini": {
-      "version": "1.3.8",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/ini/-/ini-1.3.8.tgz",
-      "integrity": "sha512-JV/yugV2uzW5iMRSiZAyDtQd+nxtUnjeLt0acNdw98kKLrvuRVyB80tsREOE7yvGVgalhZ6RNXCmEHkUKBKxew=="
-    },
-    "interpret": {
-      "version": "1.4.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/interpret/-/interpret-1.4.0.tgz",
-      "integrity": "sha512-agE4QfB2Lkp9uICn7BAqoscw4SZP9kTE2hxiFI3jBPmXJfdqiahTbUuKGsMoN2GtqL9AxhYioAcVvgsb1HvRbA=="
-    },
-    "invert-kv": {
-      "version": "1.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/invert-kv/-/invert-kv-1.0.0.tgz",
-      "integrity": "sha1-EEqOSqym09jNFXqO+L+rLXo//bY="
-    },
-    "is-absolute": {
-      "version": "1.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/is-absolute/-/is-absolute-1.0.0.tgz",
-      "integrity": "sha512-dOWoqflvcydARa360Gvv18DZ/gRuHKi2NU/wU5X1ZFzdYfH29nkiNZsF3mp4OJ3H4yo9Mx8A/uAGNzpzPN3yBA==",
-      "requires": {
-        "is-relative": "^1.0.0",
-        "is-windows": "^1.0.1"
-      }
-    },
-    "is-arrayish": {
-      "version": "0.2.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/is-arrayish/-/is-arrayish-0.2.1.tgz",
-      "integrity": "sha1-d8mYQFJ6qOyxqLppe4BkWnqSap0="
-    },
-    "is-core-module": {
-      "version": "2.8.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/is-core-module/-/is-core-module-2.8.1.tgz",
-      "integrity": "sha512-SdNCUs284hr40hFTFP6l0IfZ/RSrMXF3qgoRHd3/79unUTvrFO/JoXwkGm+5J/Oe3E/b5GsnG330uUNgRpu1PA==",
-      "requires": {
-        "has": "^1.0.3"
-      }
-    },
-    "is-extglob": {
-      "version": "2.1.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/is-extglob/-/is-extglob-2.1.1.tgz",
-      "integrity": "sha1-qIwCU1eR8C7TfHahueqXc8gz+MI="
-    },
-    "is-fullwidth-code-point": {
-      "version": "1.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/is-fullwidth-code-point/-/is-fullwidth-code-point-1.0.0.tgz",
-      "integrity": "sha1-754xOG8DGn8NZDr4L95QxFfvAMs=",
-      "requires": {
-        "number-is-nan": "^1.0.0"
-      }
-    },
-    "is-glob": {
-      "version": "4.0.3",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/is-glob/-/is-glob-4.0.3.tgz",
-      "integrity": "sha512-xelSayHH36ZgE7ZWhli7pW34hNbNl8Ojv5KVmkJD4hBdD3th8Tfk9vYasLM+mXWOZhFkgZfxhLSnrwRr4elSSg==",
-      "requires": {
-        "is-extglob": "^2.1.1"
-      }
-    },
-    "is-number": {
-      "version": "4.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/is-number/-/is-number-4.0.0.tgz",
-      "integrity": "sha512-rSklcAIlf1OmFdyAqbnWTLVelsQ58uvZ66S/ZyawjWqIviTWCjg2PzVGw8WUA+nNuPTqb4wgA+NszrJ+08LlgQ=="
-    },
-    "is-plain-object": {
-      "version": "5.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/is-plain-object/-/is-plain-object-5.0.0.tgz",
-      "integrity": "sha512-VRSzKkbMm5jMDoKLbltAkFQ5Qr7VDiTFGXxYFXXowVj387GeGNOCsOH6Msy00SGZ3Fp84b1Naa1psqgcCIEP5Q=="
-    },
-    "is-relative": {
-      "version": "1.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/is-relative/-/is-relative-1.0.0.tgz",
-      "integrity": "sha512-Kw/ReK0iqwKeu0MITLFuj0jbPAmEiOsIwyIXvvbfa6QfmN9pkD1M+8pdk7Rl/dTKbH34/XBFMbgD4iMJhLQbGA==",
-      "requires": {
-        "is-unc-path": "^1.0.0"
-      }
-    },
-    "is-stream": {
-      "version": "2.0.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/is-stream/-/is-stream-2.0.1.tgz",
-      "integrity": "sha512-hFoiJiTl63nn+kstHGBtewWSKnQLpyb155KHheA1l39uvtO9nWIop1p3udqPcUd/xbF1VLMO4n7OI6p7RbngDg=="
-    },
-    "is-unc-path": {
-      "version": "1.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/is-unc-path/-/is-unc-path-1.0.0.tgz",
-      "integrity": "sha512-mrGpVd0fs7WWLfVsStvgF6iEJnbjDFZh9/emhRDcGWTduTfNHd9CHeUwH3gYIjdbwo4On6hunkztwOaAw0yllQ==",
-      "requires": {
-        "unc-path-regex": "^0.1.2"
-      }
-    },
-    "is-utf8": {
-      "version": "0.2.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/is-utf8/-/is-utf8-0.2.1.tgz",
-      "integrity": "sha1-Sw2hRCEE0bM2NA6AeX6GXPOffXI="
-    },
-    "is-windows": {
-      "version": "1.0.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/is-windows/-/is-windows-1.0.2.tgz",
-      "integrity": "sha512-eXK1UInq2bPmjyX6e3VHIzMLobc4J94i4AWn+Hpq3OU5KkrRC96OAcR3PRJ/pGu6m8TRnBHP9dkXQVsT/COVIA=="
-    },
-    "isarray": {
-      "version": "1.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/isarray/-/isarray-1.0.0.tgz",
-      "integrity": "sha1-u5NdSFgsuhaMBoNJV6VKPgcSTxE="
-    },
-    "isexe": {
-      "version": "2.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/isexe/-/isexe-2.0.0.tgz",
-      "integrity": "sha1-6PvzdNxVb/iUehDcsFctYz8s+hA="
-    },
-    "isobject": {
-      "version": "3.0.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/isobject/-/isobject-3.0.1.tgz",
-      "integrity": "sha1-TkMekrEalzFjaqH5yNHMvP2reN8="
-    },
-    "json-schema-traverse": {
-      "version": "1.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/json-schema-traverse/-/json-schema-traverse-1.0.0.tgz",
-      "integrity": "sha512-NM8/P9n3XjXhIZn1lLhkFaACTOURQXjWhV4BA/RnOv8xvgqtqpAX9IO4mRQxSx1Rlo4tqzeqb0sOlruaOy3dug=="
-    },
-    "json5": {
-      "version": "2.2.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/json5/-/json5-2.2.0.tgz",
-      "integrity": "sha512-f+8cldu7X/y7RAJurMEJmdoKXGB/X550w2Nr3tTbezL6RwEE/iMcm+tZnXeoZtKuOq6ft8+CqzEkrIgx1fPoQA==",
-      "requires": {
-        "minimist": "^1.2.5"
-      }
-    },
-    "jsonfile": {
-      "version": "6.1.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/jsonfile/-/jsonfile-6.1.0.tgz",
-      "integrity": "sha512-5dgndWOriYSm5cnYaJNhalLNDKOqFwyDB/rr1E9ZsGciGvKPs8R2xYGCacuf3z6K1YKDz182fd+fY3cn3pMqXQ==",
-      "requires": {
-        "graceful-fs": "^4.1.6",
-        "universalify": "^2.0.0"
-      }
-    },
-    "kind-of": {
-      "version": "6.0.3",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/kind-of/-/kind-of-6.0.3.tgz",
-      "integrity": "sha512-dcS1ul+9tmeD95T+x28/ehLgd9mENa3LsvDTtzm3vyBEO7RPptvAD+t44WVXaUjTBRcrpFeFlC8WCruUR456hw=="
-    },
-    "last-run": {
-      "version": "1.1.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/last-run/-/last-run-1.1.1.tgz",
-      "integrity": "sha1-RblpQsF7HHnHchmCWbqUO+v4yls=",
-      "requires": {
-        "default-resolution": "^2.0.0",
-        "es6-weak-map": "^2.0.1"
-      }
-    },
-    "lazystream": {
-      "version": "1.0.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/lazystream/-/lazystream-1.0.1.tgz",
-      "integrity": "sha512-b94GiNHQNy6JNTrt5w6zNyffMrNkXZb3KTkCZJb2V1xaEGCk093vkZ2jk3tpaeP33/OiXC+WvK9AxUebnf5nbw==",
-      "requires": {
-        "readable-stream": "^2.0.5"
-      },
-      "dependencies": {
-        "readable-stream": {
-          "version": "2.3.7",
-          "resolved": "https://repo.huaweicloud.com/repository/npm/readable-stream/-/readable-stream-2.3.7.tgz",
-          "integrity": "sha512-Ebho8K4jIbHAxnuxi7o42OrZgF/ZTNcsZj6nRKyUmkhLFq8CHItp/fy6hQZuZmP/n3yZ9VBUbp4zz/mX8hmYPw==",
-          "requires": {
-            "core-util-is": "~1.0.0",
-            "inherits": "~2.0.3",
-            "isarray": "~1.0.0",
-            "process-nextick-args": "~2.0.0",
-            "safe-buffer": "~5.1.1",
-            "string_decoder": "~1.1.1",
-            "util-deprecate": "~1.0.1"
-          }
-        }
-      }
-    },
-    "lcid": {
-      "version": "1.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/lcid/-/lcid-1.0.0.tgz",
-      "integrity": "sha1-MIrMr6C8SDo4Z7S28rlQYlHRuDU=",
-      "requires": {
-        "invert-kv": "^1.0.0"
-      }
-    },
-    "liftoff": {
-      "version": "4.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/liftoff/-/liftoff-4.0.0.tgz",
-      "integrity": "sha512-rMGwYF8q7g2XhG2ulBmmJgWv25qBsqRbDn5gH0+wnuyeFt7QBJlHJmtg5qEdn4pN6WVAUMgXnIxytMFRX9c1aA==",
-      "requires": {
-        "extend": "^3.0.2",
-        "findup-sync": "^5.0.0",
-        "fined": "^2.0.0",
-        "flagged-respawn": "^2.0.0",
-        "is-plain-object": "^5.0.0",
-        "object.map": "^1.0.1",
-        "rechoir": "^0.8.0",
-        "resolve": "^1.20.0"
-      }
-    },
-    "load-json-file": {
-      "version": "1.1.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/load-json-file/-/load-json-file-1.1.0.tgz",
-      "integrity": "sha1-lWkFcI1YtLq0wiYbBPWfMcmTdMA=",
-      "requires": {
-        "graceful-fs": "^4.1.2",
-        "parse-json": "^2.2.0",
-        "pify": "^2.0.0",
-        "pinkie-promise": "^2.0.0",
-        "strip-bom": "^2.0.0"
-      }
-    },
-    "lodash": {
-      "version": "4.17.21",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/lodash/-/lodash-4.17.21.tgz",
-      "integrity": "sha512-v2kDEe57lecTulaDIuNTPy3Ry4gLGJ6Z1O3vE1krgXZNrsQ+LFTGHVxVjcXPs17LhbZVGedAJv8XZ1tvj5FvSg=="
-    },
-    "lodash.defaults": {
-      "version": "4.2.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/lodash.defaults/-/lodash.defaults-4.2.0.tgz",
-      "integrity": "sha1-0JF4cW/+pN3p5ft7N/bwgCJ0WAw="
-    },
-    "lodash.difference": {
-      "version": "4.5.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/lodash.difference/-/lodash.difference-4.5.0.tgz",
-      "integrity": "sha1-nMtOUF1Ia5FlE0V3KIWi3yf9AXw="
-    },
-    "lodash.flatten": {
-      "version": "4.4.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/lodash.flatten/-/lodash.flatten-4.4.0.tgz",
-      "integrity": "sha1-8xwiIlqWMtK7+OSt2+8kCqdlph8="
-    },
-    "lodash.isplainobject": {
-      "version": "4.0.6",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/lodash.isplainobject/-/lodash.isplainobject-4.0.6.tgz",
-      "integrity": "sha1-fFJqUtibRcRcxpC4gWO+BJf1UMs="
-    },
-    "lodash.union": {
-      "version": "4.6.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/lodash.union/-/lodash.union-4.6.0.tgz",
-      "integrity": "sha1-SLtQiECfFvGCFmZkHETdGqrjzYg="
-    },
-    "log4js": {
-      "version": "6.4.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/log4js/-/log4js-6.4.1.tgz",
-      "integrity": "sha512-iUiYnXqAmNKiIZ1XSAitQ4TmNs8CdZYTAWINARF3LjnsLN8tY5m0vRwd6uuWj/yNY0YHxeZodnbmxKFUOM2rMg==",
-      "requires": {
-        "date-format": "^4.0.3",
-        "debug": "^4.3.3",
-        "flatted": "^3.2.4",
-        "rfdc": "^1.3.0",
-        "streamroller": "^3.0.2"
-      }
-    },
-    "make-iterator": {
-      "version": "1.0.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/make-iterator/-/make-iterator-1.0.1.tgz",
-      "integrity": "sha512-pxiuXh0iVEq7VM7KMIhs5gxsfxCux2URptUQaXo4iZZJxBAzTPOLE2BumO5dbfVYq/hBJFBR/a1mFDmOx5AGmw==",
-      "requires": {
-        "kind-of": "^6.0.2"
-      }
-    },
-    "map-cache": {
-      "version": "0.2.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/map-cache/-/map-cache-0.2.2.tgz",
-      "integrity": "sha1-wyq9C9ZSXZsFFkW7TyasXcmKDb8="
-    },
-    "merge-stream": {
-      "version": "2.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/merge-stream/-/merge-stream-2.0.0.tgz",
-      "integrity": "sha512-abv/qOcuPfk3URPfDzmZU1LKmuw8kT+0nIHvKrKgFrwifol/doWcdA4ZqsWQ8ENrFKkd67Mfpo/LovbIUsbt3w=="
-    },
-    "micromatch": {
-      "version": "4.0.5",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/micromatch/-/micromatch-4.0.5.tgz",
-      "integrity": "sha512-DMy+ERcEW2q8Z2Po+WNXuw3c5YaUSFjAO5GsJqfEl7UjvtIuFKO6ZrKvcItdy98dwFI2N1tg3zNIdKaQT+aNdA==",
-      "requires": {
-        "braces": "^3.0.2",
-        "picomatch": "^2.3.1"
-      }
-    },
-    "mimic-fn": {
-      "version": "2.1.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/mimic-fn/-/mimic-fn-2.1.0.tgz",
-      "integrity": "sha512-OqbOk5oEQeAZ8WXWydlu9HJjz9WVdEIvamMCcXmuqUYjTknH/sqsWvhQ3vgwKFRR1HpjvNBKQ37nbJgYzGqGcg=="
-    },
-    "minimatch": {
-      "version": "3.1.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/minimatch/-/minimatch-3.1.2.tgz",
-      "integrity": "sha512-J7p63hRiAjw1NDEww1W7i37+ByIrOWO5XQQAzZ3VOcL0PNybwpfmV/N05zFAzwQ9USyEcX6t3UO+K5aqBQOIHw==",
-      "requires": {
-        "brace-expansion": "^1.1.7"
-      }
-    },
-    "minimist": {
-      "version": "1.2.6",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/minimist/-/minimist-1.2.6.tgz",
-      "integrity": "sha512-Jsjnk4bw3YJqYzbdyBiNsPWHPfO++UGG749Cxs6peCu5Xg4nrena6OVxOYxrQTqww0Jmwt+Ref8rggumkTLz9Q=="
-    },
-    "ms": {
-      "version": "2.1.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/ms/-/ms-2.1.2.tgz",
-      "integrity": "sha512-sGkPx+VjMtmA6MX27oA4FBFELFCZZ4S4XqeGOXCv68tT+jb3vk/RyaKWP0PTKyWtmLSM0b+adUTEvbs1PEaH2w=="
-    },
-    "mute-stdout": {
-      "version": "1.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/mute-stdout/-/mute-stdout-1.0.0.tgz",
-      "integrity": "sha1-WzLqB+tDyd7WEwQ0z5JvRrKn/U0="
-    },
-    "next-tick": {
-      "version": "1.1.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/next-tick/-/next-tick-1.1.0.tgz",
-      "integrity": "sha512-CXdUiJembsNjuToQvxayPZF9Vqht7hewsvy2sOWafLvi2awflj9mOC6bHIg50orX8IJvWKY9wYQ/zB2kogPslQ=="
-    },
-    "normalize-package-data": {
-      "version": "2.5.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/normalize-package-data/-/normalize-package-data-2.5.0.tgz",
-      "integrity": "sha512-/5CMN3T0R4XTj4DcGaexo+roZSdSFW/0AOOTROrjxzCG1wrWXEsGbRKevjlIL+ZDE4sZlJr5ED4YW0yqmkK+eA==",
-      "requires": {
-        "hosted-git-info": "^2.1.4",
-        "resolve": "^1.10.0",
-        "semver": "2 || 3 || 4 || 5",
-        "validate-npm-package-license": "^3.0.1"
-      }
-    },
-    "normalize-path": {
-      "version": "3.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/normalize-path/-/normalize-path-3.0.0.tgz",
-      "integrity": "sha512-6eZs5Ls3WtCisHWp9S2GUy8dqkpGi4BVSz3GaqiE6ezub0512ESztXUwUB6C6IKbQkY2Pnb/mD4WYojCRwcwLA=="
-    },
-    "now-and-later": {
-      "version": "2.0.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/now-and-later/-/now-and-later-2.0.1.tgz",
-      "integrity": "sha512-KGvQ0cB70AQfg107Xvs/Fbu+dGmZoTRJp2TaPwcwQm3/7PteUyN2BCgk8KBMPGBUXZdVwyWS8fDCGFygBm19UQ==",
-      "requires": {
-        "once": "^1.3.2"
-      }
-    },
-    "npm-run-path": {
-      "version": "4.0.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/npm-run-path/-/npm-run-path-4.0.1.tgz",
-      "integrity": "sha512-S48WzZW777zhNIrn7gxOlISNAqi9ZC/uQFnRdbeIHhZhCA6UqpkOT8T1G7BvfdgP4Er8gF4sUbaS0i7QvIfCWw==",
-      "requires": {
-        "path-key": "^3.0.0"
-      }
-    },
-    "number-is-nan": {
-      "version": "1.0.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/number-is-nan/-/number-is-nan-1.0.1.tgz",
-      "integrity": "sha1-CXtgK1NCKlIsGvuHkDGDNpQaAR0="
-    },
-    "object-keys": {
-      "version": "1.1.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/object-keys/-/object-keys-1.1.1.tgz",
-      "integrity": "sha512-NuAESUOUMrlIXOfHKzD6bpPu3tYt3xvjNdRIQ+FeT0lNb4K8WR70CaDxhuNguS2XG+GjkyMwOzsN5ZktImfhLA=="
-    },
-    "object.assign": {
-      "version": "4.1.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/object.assign/-/object.assign-4.1.2.tgz",
-      "integrity": "sha512-ixT2L5THXsApyiUPYKmW+2EHpXXe5Ii3M+f4e+aJFAHao5amFRW6J0OO6c/LU8Be47utCx2GL89hxGB6XSmKuQ==",
-      "requires": {
-        "call-bind": "^1.0.0",
-        "define-properties": "^1.1.3",
-        "has-symbols": "^1.0.1",
-        "object-keys": "^1.1.1"
-      }
-    },
-    "object.defaults": {
-      "version": "1.1.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/object.defaults/-/object.defaults-1.1.0.tgz",
-      "integrity": "sha1-On+GgzS0B96gbaFtiNXNKeQ1/s8=",
-      "requires": {
-        "array-each": "^1.0.1",
-        "array-slice": "^1.0.0",
-        "for-own": "^1.0.0",
-        "isobject": "^3.0.0"
-      }
-    },
-    "object.map": {
-      "version": "1.0.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/object.map/-/object.map-1.0.1.tgz",
-      "integrity": "sha1-z4Plncj8wK1fQlDh94s7gb2AHTc=",
-      "requires": {
-        "for-own": "^1.0.0",
-        "make-iterator": "^1.0.0"
-      }
-    },
-    "object.pick": {
-      "version": "1.3.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/object.pick/-/object.pick-1.3.0.tgz",
-      "integrity": "sha1-h6EKxMFpS9Lhy/U1kaZhQftd10c=",
-      "requires": {
-        "isobject": "^3.0.1"
-      }
-    },
-    "object.reduce": {
-      "version": "1.0.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/object.reduce/-/object.reduce-1.0.1.tgz",
-      "integrity": "sha1-b+NI8qx/oPlcpiEiZZkJaCW7A60=",
-      "requires": {
-        "for-own": "^1.0.0",
-        "make-iterator": "^1.0.0"
-      }
-    },
-    "once": {
-      "version": "1.4.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/once/-/once-1.4.0.tgz",
-      "integrity": "sha1-WDsap3WWHUsROsF9nFC6753Xa9E=",
-      "requires": {
-        "wrappy": "1"
-      }
-    },
-    "onetime": {
-      "version": "5.1.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/onetime/-/onetime-5.1.2.tgz",
-      "integrity": "sha512-kbpaSSGJTWdAY5KPVeMOKXSrPtr8C8C7wodJbcsd51jRnmD+GZu8Y0VoU6Dm5Z4vWr0Ig/1NKuWRKf7j5aaYSg==",
-      "requires": {
-        "mimic-fn": "^2.1.0"
-      }
-    },
-    "os-locale": {
-      "version": "1.4.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/os-locale/-/os-locale-1.4.0.tgz",
-      "integrity": "sha1-IPnxeuKe00XoveWDsT0gCYA8FNk=",
-      "requires": {
-        "lcid": "^1.0.0"
-      }
-    },
-    "parse-filepath": {
-      "version": "1.0.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/parse-filepath/-/parse-filepath-1.0.2.tgz",
-      "integrity": "sha1-pjISf1Oq89FYdvWHLz/6x2PWyJE=",
-      "requires": {
-        "is-absolute": "^1.0.0",
-        "map-cache": "^0.2.0",
-        "path-root": "^0.1.1"
-      }
-    },
-    "parse-json": {
-      "version": "2.2.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/parse-json/-/parse-json-2.2.0.tgz",
-      "integrity": "sha1-9ID0BDTvgHQfhGkJn43qGPVaTck=",
-      "requires": {
-        "error-ex": "^1.2.0"
-      }
-    },
-    "parse-passwd": {
-      "version": "1.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/parse-passwd/-/parse-passwd-1.0.0.tgz",
-      "integrity": "sha1-bVuTSkVpk7I9N/QKOC1vFmao5cY="
-    },
-    "path-exists": {
-      "version": "2.1.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/path-exists/-/path-exists-2.1.0.tgz",
-      "integrity": "sha1-D+tsZPD8UY2adU3V77YscCJ2H0s=",
-      "requires": {
-        "pinkie-promise": "^2.0.0"
-      }
-    },
-    "path-is-absolute": {
-      "version": "1.0.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/path-is-absolute/-/path-is-absolute-1.0.1.tgz",
-      "integrity": "sha1-F0uSaHNVNP+8es5r9TpanhtcX18="
-    },
-    "path-key": {
-      "version": "3.1.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/path-key/-/path-key-3.1.1.tgz",
-      "integrity": "sha512-ojmeN0qd+y0jszEtoY48r0Peq5dwMEkIlCOu6Q5f41lfkswXuKtYrhgoTpLnyIcHm24Uhqx+5Tqm2InSwLhE6Q=="
-    },
-    "path-parse": {
-      "version": "1.0.7",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/path-parse/-/path-parse-1.0.7.tgz",
-      "integrity": "sha512-LDJzPVEEEPR+y48z93A0Ed0yXb8pAByGWo/k5YYdYgpY2/2EsOsksJrq7lOHxryrVOn1ejG6oAp8ahvOIQD8sw=="
-    },
-    "path-root": {
-      "version": "0.1.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/path-root/-/path-root-0.1.1.tgz",
-      "integrity": "sha1-mkpoFMrBwM1zNgqV8yCDyOpHRbc=",
-      "requires": {
-        "path-root-regex": "^0.1.0"
-      }
-    },
-    "path-root-regex": {
-      "version": "0.1.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/path-root-regex/-/path-root-regex-0.1.2.tgz",
-      "integrity": "sha1-v8zcjfWxLcUsi0PsONGNcsBLqW0="
-    },
-    "path-type": {
-      "version": "1.1.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/path-type/-/path-type-1.1.0.tgz",
-      "integrity": "sha1-WcRPfuSR2nBNpBXaWkBwuk+P5EE=",
-      "requires": {
-        "graceful-fs": "^4.1.2",
-        "pify": "^2.0.0",
-        "pinkie-promise": "^2.0.0"
-      }
-    },
-    "picomatch": {
-      "version": "2.3.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/picomatch/-/picomatch-2.3.1.tgz",
-      "integrity": "sha512-JU3teHTNjmE2VCGFzuY8EXzCDVwEqB2a8fsIvwaStHhAWJEeVd1o1QD80CU6+ZdEXXSLbSsuLwJjkCBWqRQUVA=="
-    },
-    "pify": {
-      "version": "2.3.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/pify/-/pify-2.3.0.tgz",
-      "integrity": "sha1-7RQaasBDqEnqWISY59yosVMw6Qw="
-    },
-    "pinkie": {
-      "version": "2.0.4",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/pinkie/-/pinkie-2.0.4.tgz",
-      "integrity": "sha1-clVrgM+g1IqXToDnckjoDtT3+HA="
-    },
-    "pinkie-promise": {
-      "version": "2.0.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/pinkie-promise/-/pinkie-promise-2.0.1.tgz",
-      "integrity": "sha1-ITXW36ejWMBprJsXh3YogihFD/o=",
-      "requires": {
-        "pinkie": "^2.0.0"
-      }
-    },
-    "pretty-hrtime": {
-      "version": "1.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/pretty-hrtime/-/pretty-hrtime-1.0.0.tgz",
-      "integrity": "sha1-9ualItPmBwRSK/Db5oVu0g515Nw="
-    },
-    "process-nextick-args": {
-      "version": "2.0.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/process-nextick-args/-/process-nextick-args-2.0.1.tgz",
-      "integrity": "sha512-3ouUOpQhtgrbOa17J7+uxOTpITYWaGP7/AhoR3+A+/1e9skrzelGi/dXzEYyvbxubEF6Wn2ypscTKiKJFFn1ag=="
-    },
-    "punycode": {
-      "version": "2.1.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/punycode/-/punycode-2.1.1.tgz",
-      "integrity": "sha512-XRsRjdf+j5ml+y/6GKHPZbrF/8p2Yga0JPtdqTIY2Xe5ohJPD9saDJJLPvp9+NSBprVvevdXZybnj2cv8OEd0A=="
-    },
-    "read-pkg": {
-      "version": "1.1.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/read-pkg/-/read-pkg-1.1.0.tgz",
-      "integrity": "sha1-9f+qXs0pyzHAR0vKfXVra7KePyg=",
-      "requires": {
-        "load-json-file": "^1.0.0",
-        "normalize-package-data": "^2.3.2",
-        "path-type": "^1.0.0"
-      }
-    },
-    "read-pkg-up": {
-      "version": "1.0.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/read-pkg-up/-/read-pkg-up-1.0.1.tgz",
-      "integrity": "sha1-nWPBMnbAZZGNV/ACpX9AobZD+wI=",
-      "requires": {
-        "find-up": "^1.0.0",
-        "read-pkg": "^1.0.0"
-      }
-    },
-    "readable-stream": {
-      "version": "3.6.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/readable-stream/-/readable-stream-3.6.0.tgz",
-      "integrity": "sha512-BViHy7LKeTz4oNnkcLJ+lVSL6vpiFeX6/d3oSH8zCW7UxP2onchk+vTGB143xuFjHS3deTgkKoXXymXqymiIdA==",
-      "requires": {
-        "inherits": "^2.0.3",
-        "string_decoder": "^1.1.1",
-        "util-deprecate": "^1.0.1"
-      }
-    },
-    "readdir-glob": {
-      "version": "1.1.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/readdir-glob/-/readdir-glob-1.1.1.tgz",
-      "integrity": "sha512-91/k1EzZwDx6HbERR+zucygRFfiPl2zkIYZtv3Jjr6Mn7SkKcVct8aVO+sSRiGMc6fLf72du3d92/uY63YPdEA==",
-      "requires": {
-        "minimatch": "^3.0.4"
-      }
-    },
-    "rechoir": {
-      "version": "0.8.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/rechoir/-/rechoir-0.8.0.tgz",
-      "integrity": "sha512-/vxpCXddiX8NGfGO/mTafwjq4aFa/71pvamip0++IQk3zG8cbCj0fifNPrjjF1XMXUne91jL9OoxmdykoEtifQ==",
-      "requires": {
-        "resolve": "^1.20.0"
-      }
-    },
-    "require-directory": {
-      "version": "2.1.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/require-directory/-/require-directory-2.1.1.tgz",
-      "integrity": "sha1-jGStX9MNqxyXbiNE/+f3kqam30I="
-    },
-    "require-from-string": {
-      "version": "2.0.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/require-from-string/-/require-from-string-2.0.2.tgz",
-      "integrity": "sha512-Xf0nWe6RseziFMu+Ap9biiUbmplq6S9/p+7w7YXP/JBHhrUDDUhwa+vANyubuqfZWTveU//DYVGsDG7RKL/vEw=="
-    },
-    "require-main-filename": {
-      "version": "1.0.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/require-main-filename/-/require-main-filename-1.0.1.tgz",
-      "integrity": "sha1-l/cXtp1IeE9fUmpsWqj/3aBVpNE="
-    },
-    "resolve": {
-      "version": "1.22.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/resolve/-/resolve-1.22.0.tgz",
-      "integrity": "sha512-Hhtrw0nLeSrFQ7phPp4OOcVjLPIeMnRlr5mcnVuMe7M/7eBn98A3hmFRLoFo3DLZkivSYwhRUJTyPyWAk56WLw==",
-      "requires": {
-        "is-core-module": "^2.8.1",
-        "path-parse": "^1.0.7",
-        "supports-preserve-symlinks-flag": "^1.0.0"
-      }
-    },
-    "resolve-dir": {
-      "version": "1.0.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/resolve-dir/-/resolve-dir-1.0.1.tgz",
-      "integrity": "sha1-eaQGRMNivoLybv/nOcm7U4IEb0M=",
-      "requires": {
-        "expand-tilde": "^2.0.0",
-        "global-modules": "^1.0.0"
-      }
-    },
-    "resolve-package-path": {
-      "version": "4.0.3",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/resolve-package-path/-/resolve-package-path-4.0.3.tgz",
-      "integrity": "sha512-SRpNAPW4kewOaNUt8VPqhJ0UMxawMwzJD8V7m1cJfdSTK9ieZwS6K7Dabsm4bmLFM96Z5Y/UznrpG5kt1im8yA==",
-      "requires": {
-        "path-root": "^0.1.1"
-      }
-    },
-    "rfdc": {
-      "version": "1.3.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/rfdc/-/rfdc-1.3.0.tgz",
-      "integrity": "sha512-V2hovdzFbOi77/WajaSMXk2OLm+xNIeQdMMuB7icj7bk6zi2F8GGAxigcnDFpJHbNyNcgyJDiP+8nOrY5cZGrA=="
-    },
-    "safe-buffer": {
-      "version": "5.1.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/safe-buffer/-/safe-buffer-5.1.2.tgz",
-      "integrity": "sha512-Gd2UZBJDkXlY7GbJxfsE8/nvKkUEU1G38c1siN6QP6a9PT9MmHB8GnpscSmMJSoF8LOIrt8ud/wPtojys4G6+g=="
-    },
-    "safer-buffer": {
-      "version": "2.1.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/safer-buffer/-/safer-buffer-2.1.2.tgz",
-      "integrity": "sha512-YZo3K82SD7Riyi0E1EQPojLz7kpepnSQI9IyPbHHg1XXXevb5dJI7tpyN2ADxGcQbHG7vcyRHk0cbwqcQriUtg=="
-    },
-    "semver": {
-      "version": "5.7.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/semver/-/semver-5.7.1.tgz",
-      "integrity": "sha512-sauaDf/PZdVgrLTNYHRtpXa1iRiKcaebiKQ1BJdpQlWH2lCvexQdX55snPFyK7QzpudqbCI0qXFfOasHdyNDGQ=="
-    },
-    "set-blocking": {
-      "version": "2.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/set-blocking/-/set-blocking-2.0.0.tgz",
-      "integrity": "sha1-BF+XgtARrppoA93TgrJDkrPYkPc="
-    },
-    "shebang-command": {
-      "version": "2.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/shebang-command/-/shebang-command-2.0.0.tgz",
-      "integrity": "sha512-kHxr2zZpYtdmrN1qDjrrX/Z1rR1kG8Dx+gkpK1G4eXmvXswmcE1hTWBWYUzlraYw1/yZp6YuDY77YtvbN0dmDA==",
-      "requires": {
-        "shebang-regex": "^3.0.0"
-      }
-    },
-    "shebang-regex": {
-      "version": "3.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/shebang-regex/-/shebang-regex-3.0.0.tgz",
-      "integrity": "sha512-7++dFhtcx3353uBaq8DDR4NuxBetBzC7ZQOhmTQInHEd6bSrXdiEyzCvG07Z44UYdLShWUyXt5M/yhz8ekcb1A=="
-    },
-    "signal-exit": {
-      "version": "3.0.7",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/signal-exit/-/signal-exit-3.0.7.tgz",
-      "integrity": "sha512-wnD2ZE+l+SPC/uoS0vXeE9L1+0wuaMqKlfz9AMUo38JsyLSBWSFcHR1Rri62LZc12vLr1gb3jl7iwQhgwpAbGQ=="
-    },
-    "spdx-correct": {
-      "version": "3.1.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/spdx-correct/-/spdx-correct-3.1.1.tgz",
-      "integrity": "sha512-cOYcUWwhCuHCXi49RhFRCyJEK3iPj1Ziz9DpViV3tbZOwXD49QzIN3MpOLJNxh2qwq2lJJZaKMVw9qNi4jTC0w==",
-      "requires": {
-        "spdx-expression-parse": "^3.0.0",
-        "spdx-license-ids": "^3.0.0"
-      }
-    },
-    "spdx-exceptions": {
-      "version": "2.3.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/spdx-exceptions/-/spdx-exceptions-2.3.0.tgz",
-      "integrity": "sha512-/tTrYOC7PPI1nUAgx34hUpqXuyJG+DTHJTnIULG4rDygi4xu/tfgmq1e1cIRwRzwZgo4NLySi+ricLkZkw4i5A=="
-    },
-    "spdx-expression-parse": {
-      "version": "3.0.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/spdx-expression-parse/-/spdx-expression-parse-3.0.1.tgz",
-      "integrity": "sha512-cbqHunsQWnJNE6KhVSMsMeH5H/L9EpymbzqTQ3uLwNCLZ1Q481oWaofqH7nO6V07xlXwY6PhQdQ2IedWx/ZK4Q==",
-      "requires": {
-        "spdx-exceptions": "^2.1.0",
-        "spdx-license-ids": "^3.0.0"
-      }
-    },
-    "spdx-license-ids": {
-      "version": "3.0.11",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/spdx-license-ids/-/spdx-license-ids-3.0.11.tgz",
-      "integrity": "sha512-Ctl2BrFiM0X3MANYgj3CkygxhRmr9mi6xhejbdO960nF6EDJApTYpn0BQnDKlnNBULKiCN1n3w9EBkHK8ZWg+g=="
-    },
-    "stream-exhaust": {
-      "version": "1.0.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/stream-exhaust/-/stream-exhaust-1.0.2.tgz",
-      "integrity": "sha512-b/qaq/GlBK5xaq1yrK9/zFcyRSTNxmcZwFLGSTG0mXgZl/4Z6GgiyYOXOvY7N3eEvFRAG1bkDRz5EPGSvPYQlw=="
-    },
-    "streamroller": {
-      "version": "3.0.6",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/streamroller/-/streamroller-3.0.6.tgz",
-      "integrity": "sha512-Qz32plKq/MZywYyhEatxyYc8vs994Gz0Hu2MSYXXLD233UyPeIeRBZARIIGwFer4Mdb8r3Y2UqKkgyDghM6QCg==",
-      "requires": {
-        "date-format": "^4.0.6",
-        "debug": "^4.3.4",
-        "fs-extra": "^10.0.1"
-      }
-    },
-    "string-width": {
-      "version": "1.0.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/string-width/-/string-width-1.0.2.tgz",
-      "integrity": "sha1-EYvfW4zcUaKn5w0hHgfisLmxB9M=",
-      "requires": {
-        "code-point-at": "^1.0.0",
-        "is-fullwidth-code-point": "^1.0.0",
-        "strip-ansi": "^3.0.0"
-      }
-    },
-    "string_decoder": {
-      "version": "1.1.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/string_decoder/-/string_decoder-1.1.1.tgz",
-      "integrity": "sha512-n/ShnvDi6FHbbVfviro+WojiFzv+s8MPMHBczVePfUpDJLwoLT0ht1l4YwBCbi8pJAveEEdnkHyPyTP/mzRfwg==",
-      "requires": {
-        "safe-buffer": "~5.1.0"
-      }
-    },
-    "strip-ansi": {
-      "version": "3.0.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/strip-ansi/-/strip-ansi-3.0.1.tgz",
-      "integrity": "sha1-ajhfuIU9lS1f8F0Oiq+UJ43GPc8=",
-      "requires": {
-        "ansi-regex": "^2.0.0"
-      }
-    },
-    "strip-bom": {
-      "version": "2.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/strip-bom/-/strip-bom-2.0.0.tgz",
-      "integrity": "sha1-YhmoVhZSBJHzV4i9vxRHqZx+aw4=",
-      "requires": {
-        "is-utf8": "^0.2.0"
-      }
-    },
-    "strip-final-newline": {
-      "version": "2.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/strip-final-newline/-/strip-final-newline-2.0.0.tgz",
-      "integrity": "sha512-BrpvfNAE3dcvq7ll3xVumzjKjZQ5tI1sEUIKr3Uoks0XUl45St3FlatVqef9prk4jRDzhW6WZg+3bk93y6pLjA=="
-    },
-    "supports-preserve-symlinks-flag": {
-      "version": "1.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/supports-preserve-symlinks-flag/-/supports-preserve-symlinks-flag-1.0.0.tgz",
-      "integrity": "sha512-ot0WnXS9fgdkgIcePe6RHNk1WA8+muPa6cSjeR3V8K27q9BB1rTE3R1p7Hv0z1ZyAc8s6Vvv8DIyWf681MAt0w=="
-    },
-    "tar-stream": {
-      "version": "2.2.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/tar-stream/-/tar-stream-2.2.0.tgz",
-      "integrity": "sha512-ujeqbceABgwMZxEJnk2HDY2DlnUZ+9oEcb1KzTVfYHio0UE6dG71n60d8D2I4qNvleWrrXpmjpt7vZeF1LnMZQ==",
-      "requires": {
-        "bl": "^4.0.3",
-        "end-of-stream": "^1.4.1",
-        "fs-constants": "^1.0.0",
-        "inherits": "^2.0.3",
-        "readable-stream": "^3.1.1"
-      }
-    },
-    "to-regex-range": {
-      "version": "5.0.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/to-regex-range/-/to-regex-range-5.0.1.tgz",
-      "integrity": "sha512-65P7iz6X5yEr1cwcgvQxbbIw7Uk3gOy5dIdtZ4rDveLqhrdJP+Li/Hx6tyK0NEb+2GCyneCMJiGqrADCSNk8sQ==",
-      "requires": {
-        "is-number": "^7.0.0"
-      },
-      "dependencies": {
-        "is-number": {
-          "version": "7.0.0",
-          "resolved": "https://repo.huaweicloud.com/repository/npm/is-number/-/is-number-7.0.0.tgz",
-          "integrity": "sha512-41Cifkg6e8TylSpdtTpeLVMqvSBEVzTttHvERD741+pnZ8ANv0004MRL43QKPDlK9cGvNp6NZWZUBlbGXYxxng=="
-        }
-      }
-    },
-    "type": {
-      "version": "1.2.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/type/-/type-1.2.0.tgz",
-      "integrity": "sha512-+5nt5AAniqsCnu2cEQQdpzCAh33kVx8n0VoFidKpB1dVVLAN/F+bgVOqOJqOnEnrhp222clB5p3vUlD+1QAnfg=="
-    },
-    "unc-path-regex": {
-      "version": "0.1.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/unc-path-regex/-/unc-path-regex-0.1.2.tgz",
-      "integrity": "sha1-5z3T17DXxe2G+6xrCufYxqadUPo="
-    },
-    "undertaker": {
-      "version": "1.2.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/undertaker/-/undertaker-1.2.1.tgz",
-      "integrity": "sha512-71WxIzDkgYk9ZS+spIB8iZXchFhAdEo2YU8xYqBYJ39DIUIqziK78ftm26eecoIY49X0J2MLhG4hr18Yp6/CMA==",
-      "requires": {
-        "arr-flatten": "^1.0.1",
-        "arr-map": "^2.0.0",
-        "bach": "^1.0.0",
-        "collection-map": "^1.0.0",
-        "es6-weak-map": "^2.0.1",
-        "last-run": "^1.1.0",
-        "object.defaults": "^1.0.0",
-        "object.reduce": "^1.0.0",
-        "undertaker-registry": "^1.0.0"
-      }
-    },
-    "undertaker-registry": {
-      "version": "1.0.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/undertaker-registry/-/undertaker-registry-1.0.1.tgz",
-      "integrity": "sha1-XkvaMI5KiirlhPm5pDWaSZglzFA="
-    },
-    "universalify": {
-      "version": "2.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/universalify/-/universalify-2.0.0.tgz",
-      "integrity": "sha512-hAZsKq7Yy11Zu1DE0OzWjw7nnLZmJZYTDZZyEFHZdUhV8FkH5MCfoU1XMaxXovpyW5nq5scPqq0ZDP9Zyl04oQ=="
-    },
-    "uri-js": {
-      "version": "4.4.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/uri-js/-/uri-js-4.4.1.tgz",
-      "integrity": "sha512-7rKUyy33Q1yc98pQ1DAmLtwX109F7TIfWlW1Ydo8Wl1ii1SeHieeh0HHfPeL2fMXK6z0s8ecKs9frCuLJvndBg==",
-      "requires": {
-        "punycode": "^2.1.0"
-      }
-    },
-    "util-deprecate": {
-      "version": "1.0.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/util-deprecate/-/util-deprecate-1.0.2.tgz",
-      "integrity": "sha1-RQ1Nyfpw3nMnYvvS1KKJgUGaDM8="
-    },
-    "v8flags": {
-      "version": "3.2.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/v8flags/-/v8flags-3.2.0.tgz",
-      "integrity": "sha512-mH8etigqMfiGWdeXpaaqGfs6BndypxusHHcv2qSHyZkGEznCd/qAXCWWRzeowtL54147cktFOC4P5y+kl8d8Jg==",
-      "requires": {
-        "homedir-polyfill": "^1.0.1"
-      }
-    },
-    "validate-npm-package-license": {
-      "version": "3.0.4",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/validate-npm-package-license/-/validate-npm-package-license-3.0.4.tgz",
-      "integrity": "sha512-DpKm2Ui/xN7/HQKCtpZxoRWBhZ9Z0kqtygG8XCgNQ8ZlDnxuQmWhj566j8fN4Cu3/JmbhsDo7fcAJq4s9h27Ew==",
-      "requires": {
-        "spdx-correct": "^3.0.0",
-        "spdx-expression-parse": "^3.0.0"
-      }
-    },
-    "which": {
-      "version": "1.3.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/which/-/which-1.3.1.tgz",
-      "integrity": "sha512-HxJdYWq1MTIQbJ3nw0cqssHoTNU267KlrDuGZ1WYlxDStUtKUhOaJmh112/TZmHxxUfuJqPXSOm7tDyas0OSIQ==",
-      "requires": {
-        "isexe": "^2.0.0"
-      }
-    },
-    "which-module": {
-      "version": "1.0.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/which-module/-/which-module-1.0.0.tgz",
-      "integrity": "sha1-u6Y8qGGUiZT/MHc2CJ47lgJsKk8="
-    },
-    "wrap-ansi": {
-      "version": "2.1.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/wrap-ansi/-/wrap-ansi-2.1.0.tgz",
-      "integrity": "sha1-2Pw9KE3QV5T+hJc8rs3Rz4JP3YU=",
-      "requires": {
-        "string-width": "^1.0.1",
-        "strip-ansi": "^3.0.1"
-      }
-    },
-    "wrappy": {
-      "version": "1.0.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/wrappy/-/wrappy-1.0.2.tgz",
-      "integrity": "sha1-tSQ9jz7BqjXxNkYFvA0QNuMKtp8="
-    },
-    "y18n": {
-      "version": "3.2.2",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/y18n/-/y18n-3.2.2.tgz",
-      "integrity": "sha512-uGZHXkHnhF0XeeAPgnKfPv1bgKAYyVvmNL1xlKsPYZPaIHxGti2hHqvOCQv71XMsLxu1QjergkqogUnms5D3YQ=="
-    },
-    "yargs": {
-      "version": "7.1.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/yargs/-/yargs-7.1.0.tgz",
-      "integrity": "sha1-a6MY6xaWFyf10oT46gA+jWFU0Mg=",
-      "requires": {
-        "camelcase": "^3.0.0",
-        "cliui": "^3.2.0",
-        "decamelize": "^1.1.1",
-        "get-caller-file": "^1.0.1",
-        "os-locale": "^1.4.0",
-        "read-pkg-up": "^1.0.1",
-        "require-directory": "^2.1.1",
-        "require-main-filename": "^1.0.1",
-        "set-blocking": "^2.0.0",
-        "string-width": "^1.0.2",
-        "which-module": "^1.0.0",
-        "y18n": "^3.2.1",
-        "yargs-parser": "^5.0.0"
-      }
-    },
-    "yargs-parser": {
-      "version": "5.0.1",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/yargs-parser/-/yargs-parser-5.0.1.tgz",
-      "integrity": "sha512-wpav5XYiddjXxirPoCTUPbqM0PXvJ9hiBMvuJgInvo4/lAOTZzUprArw17q2O1P2+GHhbBr18/iQwjL5Z9BqfA==",
-      "requires": {
-        "camelcase": "^3.0.0",
-        "object.assign": "^4.1.0"
-      }
-    },
-    "zip-stream": {
-      "version": "4.1.0",
-      "resolved": "https://repo.huaweicloud.com/repository/npm/zip-stream/-/zip-stream-4.1.0.tgz",
-      "integrity": "sha512-zshzwQW7gG7hjpBlgeQP9RuyPGNxvJdzR8SUM3QhxCnLjWN2E7j3dOvpeDcQoETfHx0urRS7EtmVToql7YpU4A==",
-      "requires": {
-        "archiver-utils": "^2.1.0",
-        "compress-commons": "^4.1.0",
-        "readable-stream": "^3.6.0"
-      }
-    }
-  }
-}
+{
+  "name": "permissionmanager",
+  "version": "1.0.0",
+  "lockfileVersion": 1,
+  "requires": true,
+  "dependencies": {
+    "@ohos/hvigor": {
+      "version": "1.0.6",
+      "resolved": "https://repo.harmonyos.com/npm/@ohos/hvigor/-/@ohos/hvigor-1.0.6.tgz",
+      "integrity": "sha512-jjp7vpvUOMW1Nf7TdyhOtonwWHoSyBJLUiZTQqIx/GJV4UJyIqsiURUOqFwncQ4L7PDdeHuWly4uEelknYeWhg==",
+      "requires": {
+        "@ohos/hvigor-base": "1.0.6",
+        "interpret": "1.4.0",
+        "liftoff": "4.0.0",
+        "mute-stdout": "1.0.0",
+        "pretty-hrtime": "1.0.0",
+        "v8flags": "3.2.0",
+        "yargs": "7.1.0"
+      }
+    },
+    "@ohos/hvigor-base": {
+      "version": "1.0.6",
+      "resolved": "https://repo.harmonyos.com/npm/@ohos/hvigor-base/-/@ohos/hvigor-base-1.0.6.tgz",
+      "integrity": "sha512-cRDnWICTxmpNiFb9clIioqP5Oik1seLCICztXVhZqultrHuxwTheCRUZrHwlpyWdkSB2Al+FFBqmSwzIgZX4IQ==",
+      "requires": {
+        "json5": "2.2.0",
+        "log4js": "6.4.1",
+        "undertaker": "1.2.1"
+      }
+    },
+    "@ohos/hvigor-ohos-plugin": {
+      "version": "1.0.6",
+      "resolved": "https://repo.harmonyos.com/npm/@ohos/hvigor-ohos-plugin/-/@ohos/hvigor-ohos-plugin-1.0.6.tgz",
+      "integrity": "sha512-MAAi8uJxMzODUoSSNfBr+fU4HQ20dfQtkje9I+X4asc7qY2kAplW/q9f5XS8IOvv8zhC8OcSgsAXOAJuLMstOQ==",
+      "requires": {
+        "@ohos/hvigor-base": "1.0.6",
+        "@ohos/sdkmanager-common": "1.1.3",
+        "ajv": "8.10.0",
+        "archiver": "5.3.0",
+        "execa": "5.1.1",
+        "fs-extra": "10.0.0",
+        "glob": "7.2.0",
+        "iconv-lite": "0.6.3",
+        "json5": "2.2.0",
+        "lodash": "4.17.21",
+        "pretty-hrtime": "1.0.3",
+        "resolve-package-path": "4.0.3"
+      },
+      "dependencies": {
+        "fs-extra": {
+          "version": "10.0.0",
+          "resolved": "https://repo.huaweicloud.com/repository/npm/fs-extra/-/fs-extra-10.0.0.tgz",
+          "integrity": "sha512-C5owb14u9eJwizKGdchcDUQeFtlSHHthBk8pbX9Vc1PFZrLombudjDnNns88aYslCyF6IY5SUw3Roz6xShcEIQ==",
+          "requires": {
+            "graceful-fs": "^4.2.0",
+            "jsonfile": "^6.0.1",
+            "universalify": "^2.0.0"
+          }
+        },
+        "pretty-hrtime": {
+          "version": "1.0.3",
+          "resolved": "https://repo.huaweicloud.com/repository/npm/pretty-hrtime/-/pretty-hrtime-1.0.3.tgz",
+          "integrity": "sha1-t+PqQkNaTJsnWdmeDyAesZWALuE="
+        }
+      }
+    },
+    "@ohos/sdkmanager-common": {
+      "version": "1.1.3",
+      "resolved": "https://repo.harmonyos.com/npm/@ohos/sdkmanager-common/-/@ohos/sdkmanager-common-1.1.3.tgz",
+      "integrity": "sha512-d2uhVauDDJZIUvyyaWWoavG4N/jLyfF5IH5kEXKV6R8HNf3606H1zDQzA+UZtOfwwJFXhD9djRjnVFNB8xc7aw=="
+    },
+    "ajv": {
+      "version": "8.10.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/ajv/-/ajv-8.10.0.tgz",
+      "integrity": "sha512-bzqAEZOjkrUMl2afH8dknrq5KEk2SrwdBROR+vH1EKVQTqaUbJVPdc/gEdggTMM0Se+s+Ja4ju4TlNcStKl2Hw==",
+      "requires": {
+        "fast-deep-equal": "^3.1.1",
+        "json-schema-traverse": "^1.0.0",
+        "require-from-string": "^2.0.2",
+        "uri-js": "^4.2.2"
+      }
+    },
+    "ansi-regex": {
+      "version": "2.1.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/ansi-regex/-/ansi-regex-2.1.1.tgz",
+      "integrity": "sha1-w7M6te42DYbg5ijwRorn7yfWVN8="
+    },
+    "archiver": {
+      "version": "5.3.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/archiver/-/archiver-5.3.0.tgz",
+      "integrity": "sha512-iUw+oDwK0fgNpvveEsdQ0Ase6IIKztBJU2U0E9MzszMfmVVUyv1QJhS2ITW9ZCqx8dktAxVAjWWkKehuZE8OPg==",
+      "requires": {
+        "archiver-utils": "^2.1.0",
+        "async": "^3.2.0",
+        "buffer-crc32": "^0.2.1",
+        "readable-stream": "^3.6.0",
+        "readdir-glob": "^1.0.0",
+        "tar-stream": "^2.2.0",
+        "zip-stream": "^4.1.0"
+      }
+    },
+    "archiver-utils": {
+      "version": "2.1.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/archiver-utils/-/archiver-utils-2.1.0.tgz",
+      "integrity": "sha512-bEL/yUb/fNNiNTuUz979Z0Yg5L+LzLxGJz8x79lYmR54fmTIb6ob/hNQgkQnIUDWIFjZVQwl9Xs356I6BAMHfw==",
+      "requires": {
+        "glob": "^7.1.4",
+        "graceful-fs": "^4.2.0",
+        "lazystream": "^1.0.0",
+        "lodash.defaults": "^4.2.0",
+        "lodash.difference": "^4.5.0",
+        "lodash.flatten": "^4.4.0",
+        "lodash.isplainobject": "^4.0.6",
+        "lodash.union": "^4.6.0",
+        "normalize-path": "^3.0.0",
+        "readable-stream": "^2.0.0"
+      },
+      "dependencies": {
+        "readable-stream": {
+          "version": "2.3.7",
+          "resolved": "https://repo.huaweicloud.com/repository/npm/readable-stream/-/readable-stream-2.3.7.tgz",
+          "integrity": "sha512-Ebho8K4jIbHAxnuxi7o42OrZgF/ZTNcsZj6nRKyUmkhLFq8CHItp/fy6hQZuZmP/n3yZ9VBUbp4zz/mX8hmYPw==",
+          "requires": {
+            "core-util-is": "~1.0.0",
+            "inherits": "~2.0.3",
+            "isarray": "~1.0.0",
+            "process-nextick-args": "~2.0.0",
+            "safe-buffer": "~5.1.1",
+            "string_decoder": "~1.1.1",
+            "util-deprecate": "~1.0.1"
+          }
+        }
+      }
+    },
+    "arr-filter": {
+      "version": "1.1.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/arr-filter/-/arr-filter-1.1.2.tgz",
+      "integrity": "sha1-Q/3d0JHo7xGqTEXZzcGOLf8XEe4=",
+      "requires": {
+        "make-iterator": "^1.0.0"
+      }
+    },
+    "arr-flatten": {
+      "version": "1.1.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/arr-flatten/-/arr-flatten-1.1.0.tgz",
+      "integrity": "sha512-L3hKV5R/p5o81R7O02IGnwpDmkp6E982XhtbuwSe3O4qOtMMMtodicASA1Cny2U+aCXcNpml+m4dPsvsJ3jatg=="
+    },
+    "arr-map": {
+      "version": "2.0.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/arr-map/-/arr-map-2.0.2.tgz",
+      "integrity": "sha1-Onc0X/wc814qkYJWAfnljy4kysQ=",
+      "requires": {
+        "make-iterator": "^1.0.0"
+      }
+    },
+    "array-each": {
+      "version": "1.0.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/array-each/-/array-each-1.0.1.tgz",
+      "integrity": "sha1-p5SvDAWrF1KEbudTofIRoFugxE8="
+    },
+    "array-initial": {
+      "version": "1.1.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/array-initial/-/array-initial-1.1.0.tgz",
+      "integrity": "sha1-L6dLJnOTccOUe9enrcc74zSz15U=",
+      "requires": {
+        "array-slice": "^1.0.0",
+        "is-number": "^4.0.0"
+      }
+    },
+    "array-last": {
+      "version": "1.3.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/array-last/-/array-last-1.3.0.tgz",
+      "integrity": "sha512-eOCut5rXlI6aCOS7Z7kCplKRKyiFQ6dHFBem4PwlwKeNFk2/XxTrhRh5T9PyaEWGy/NHTZWbY+nsZlNFJu9rYg==",
+      "requires": {
+        "is-number": "^4.0.0"
+      }
+    },
+    "array-slice": {
+      "version": "1.1.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/array-slice/-/array-slice-1.1.0.tgz",
+      "integrity": "sha512-B1qMD3RBP7O8o0H2KbrXDyB0IccejMF15+87Lvlor12ONPRHP6gTjXMNkt/d3ZuOGbAe66hFmaCfECI24Ufp6w=="
+    },
+    "async": {
+      "version": "3.2.3",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/async/-/async-3.2.3.tgz",
+      "integrity": "sha512-spZRyzKL5l5BZQrr/6m/SqFdBN0q3OCI0f9rjfBzCMBIP4p75P620rR3gTmaksNOhmzgdxcaxdNfMy6anrbM0g=="
+    },
+    "async-done": {
+      "version": "1.3.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/async-done/-/async-done-1.3.2.tgz",
+      "integrity": "sha512-uYkTP8dw2og1tu1nmza1n1CMW0qb8gWWlwqMmLb7MhBVs4BXrFziT6HXUd+/RlRA/i4H9AkofYloUbs1fwMqlw==",
+      "requires": {
+        "end-of-stream": "^1.1.0",
+        "once": "^1.3.2",
+        "process-nextick-args": "^2.0.0",
+        "stream-exhaust": "^1.0.1"
+      }
+    },
+    "async-settle": {
+      "version": "1.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/async-settle/-/async-settle-1.0.0.tgz",
+      "integrity": "sha1-HQqRS7Aldb7IqPOnTlCA9yssDGs=",
+      "requires": {
+        "async-done": "^1.2.2"
+      }
+    },
+    "bach": {
+      "version": "1.2.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/bach/-/bach-1.2.0.tgz",
+      "integrity": "sha1-Szzpa/JxNPeaG0FKUcFONMO9mIA=",
+      "requires": {
+        "arr-filter": "^1.1.1",
+        "arr-flatten": "^1.0.1",
+        "arr-map": "^2.0.0",
+        "array-each": "^1.0.0",
+        "array-initial": "^1.0.0",
+        "array-last": "^1.1.1",
+        "async-done": "^1.2.2",
+        "async-settle": "^1.0.0",
+        "now-and-later": "^2.0.0"
+      }
+    },
+    "balanced-match": {
+      "version": "1.0.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/balanced-match/-/balanced-match-1.0.2.tgz",
+      "integrity": "sha512-3oSeUO0TMV67hN1AmbXsK4yaqU7tjiHlbxRDZOpH0KW9+CeX4bRAaX0Anxt0tx2MrpRpWwQaPwIlISEJhYU5Pw=="
+    },
+    "base64-js": {
+      "version": "1.5.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/base64-js/-/base64-js-1.5.1.tgz",
+      "integrity": "sha512-AKpaYlHn8t4SVbOHCy+b5+KKgvR4vrsD8vbvrbiQJps7fKDTkjkDry6ji0rUJjC0kzbNePLwzxq8iypo41qeWA=="
+    },
+    "bl": {
+      "version": "4.1.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/bl/-/bl-4.1.0.tgz",
+      "integrity": "sha512-1W07cM9gS6DcLperZfFSj+bWLtaPGSOHWhPiGzXmvVJbRLdG82sH/Kn8EtW1VqWVA54AKf2h5k5BbnIbwF3h6w==",
+      "requires": {
+        "buffer": "^5.5.0",
+        "inherits": "^2.0.4",
+        "readable-stream": "^3.4.0"
+      }
+    },
+    "brace-expansion": {
+      "version": "1.1.11",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/brace-expansion/-/brace-expansion-1.1.11.tgz",
+      "integrity": "sha512-iCuPHDFgrHX7H2vEI/5xpz07zSHB00TpugqhmYtVmMO6518mCuRMoOYFldEBl0g187ufozdaHgWKcYFb61qGiA==",
+      "requires": {
+        "balanced-match": "^1.0.0",
+        "concat-map": "0.0.1"
+      }
+    },
+    "braces": {
+      "version": "3.0.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/braces/-/braces-3.0.2.tgz",
+      "integrity": "sha512-b8um+L1RzM3WDSzvhm6gIz1yfTbBt6YTlcEKAvsmqCZZFw46z626lVj9j1yEPW33H5H+lBQpZMP1k8l+78Ha0A==",
+      "requires": {
+        "fill-range": "^7.0.1"
+      }
+    },
+    "buffer": {
+      "version": "5.7.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/buffer/-/buffer-5.7.1.tgz",
+      "integrity": "sha512-EHcyIPBQ4BSGlvjB16k5KgAJ27CIsHY/2JBmCRReo48y9rQ3MaUzWX3KVlBa4U7MyX02HdVj0K7C3WaB3ju7FQ==",
+      "requires": {
+        "base64-js": "^1.3.1",
+        "ieee754": "^1.1.13"
+      }
+    },
+    "buffer-crc32": {
+      "version": "0.2.13",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/buffer-crc32/-/buffer-crc32-0.2.13.tgz",
+      "integrity": "sha1-DTM+PwDqxQqhRUq9MO+MKl2ackI="
+    },
+    "call-bind": {
+      "version": "1.0.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/call-bind/-/call-bind-1.0.2.tgz",
+      "integrity": "sha512-7O+FbCihrB5WGbFYesctwmTKae6rOiIzmz1icreWJ+0aA7LJfuqhEso2T9ncpcFtzMQtzXf2QGGueWJGTYsqrA==",
+      "requires": {
+        "function-bind": "^1.1.1",
+        "get-intrinsic": "^1.0.2"
+      }
+    },
+    "camelcase": {
+      "version": "3.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/camelcase/-/camelcase-3.0.0.tgz",
+      "integrity": "sha1-MvxLn82vhF/N9+c7uXysImHwqwo="
+    },
+    "cliui": {
+      "version": "3.2.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/cliui/-/cliui-3.2.0.tgz",
+      "integrity": "sha1-EgYBU3qRbSmUD5NNo7SNWFo5IT0=",
+      "requires": {
+        "string-width": "^1.0.1",
+        "strip-ansi": "^3.0.1",
+        "wrap-ansi": "^2.0.0"
+      }
+    },
+    "code-point-at": {
+      "version": "1.1.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/code-point-at/-/code-point-at-1.1.0.tgz",
+      "integrity": "sha1-DQcLTQQ6W+ozovGkDi7bPZpMz3c="
+    },
+    "collection-map": {
+      "version": "1.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/collection-map/-/collection-map-1.0.0.tgz",
+      "integrity": "sha1-rqDwb40mx4DCt1SUOFVEsiVa8Yw=",
+      "requires": {
+        "arr-map": "^2.0.2",
+        "for-own": "^1.0.0",
+        "make-iterator": "^1.0.0"
+      }
+    },
+    "compress-commons": {
+      "version": "4.1.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/compress-commons/-/compress-commons-4.1.1.tgz",
+      "integrity": "sha512-QLdDLCKNV2dtoTorqgxngQCMA+gWXkM/Nwu7FpeBhk/RdkzimqC3jueb/FDmaZeXh+uby1jkBqE3xArsLBE5wQ==",
+      "requires": {
+        "buffer-crc32": "^0.2.13",
+        "crc32-stream": "^4.0.2",
+        "normalize-path": "^3.0.0",
+        "readable-stream": "^3.6.0"
+      }
+    },
+    "concat-map": {
+      "version": "0.0.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/concat-map/-/concat-map-0.0.1.tgz",
+      "integrity": "sha1-2Klr13/Wjfd5OnMDajug1UBdR3s="
+    },
+    "core-util-is": {
+      "version": "1.0.3",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/core-util-is/-/core-util-is-1.0.3.tgz",
+      "integrity": "sha512-ZQBvi1DcpJ4GDqanjucZ2Hj3wEO5pZDS89BWbkcrvdxksJorwUDDZamX9ldFkp9aw2lmBDLgkObEA4DWNJ9FYQ=="
+    },
+    "crc-32": {
+      "version": "1.2.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/crc-32/-/crc-32-1.2.2.tgz",
+      "integrity": "sha512-ROmzCKrTnOwybPcJApAA6WBWij23HVfGVNKqqrZpuyZOHqK2CwHSvpGuyt/UNNvaIjEd8X5IFGp4Mh+Ie1IHJQ=="
+    },
+    "crc32-stream": {
+      "version": "4.0.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/crc32-stream/-/crc32-stream-4.0.2.tgz",
+      "integrity": "sha512-DxFZ/Hk473b/muq1VJ///PMNLj0ZMnzye9thBpmjpJKCc5eMgB95aK8zCGrGfQ90cWo561Te6HK9D+j4KPdM6w==",
+      "requires": {
+        "crc-32": "^1.2.0",
+        "readable-stream": "^3.4.0"
+      }
+    },
+    "cross-spawn": {
+      "version": "7.0.3",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/cross-spawn/-/cross-spawn-7.0.3.tgz",
+      "integrity": "sha512-iRDPJKUPVEND7dHPO8rkbOnPpyDygcDFtWjpeWNCgy8WP2rXcxXL8TskReQl6OrB2G7+UJrags1q15Fudc7G6w==",
+      "requires": {
+        "path-key": "^3.1.0",
+        "shebang-command": "^2.0.0",
+        "which": "^2.0.1"
+      },
+      "dependencies": {
+        "which": {
+          "version": "2.0.2",
+          "resolved": "https://repo.huaweicloud.com/repository/npm/which/-/which-2.0.2.tgz",
+          "integrity": "sha512-BLI3Tl1TW3Pvl70l3yq3Y64i+awpwXqsGBYWkkqMtnbXgrMD+yj7rhW0kuEDxzJaYXGjEW5ogapKNMEKNMjibA==",
+          "requires": {
+            "isexe": "^2.0.0"
+          }
+        }
+      }
+    },
+    "d": {
+      "version": "1.0.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/d/-/d-1.0.1.tgz",
+      "integrity": "sha512-m62ShEObQ39CfralilEQRjH6oAMtNCV1xJyEx5LpRYUVN+EviphDgUc/F3hnYbADmkiNs67Y+3ylmlG7Lnu+FA==",
+      "requires": {
+        "es5-ext": "^0.10.50",
+        "type": "^1.0.1"
+      }
+    },
+    "date-format": {
+      "version": "4.0.6",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/date-format/-/date-format-4.0.6.tgz",
+      "integrity": "sha512-B9vvg5rHuQ8cbUXE/RMWMyX2YA5TecT3jKF5fLtGNlzPlU7zblSPmAm2OImDbWL+LDOQ6pUm+4LOFz+ywS41Zw=="
+    },
+    "debug": {
+      "version": "4.3.4",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/debug/-/debug-4.3.4.tgz",
+      "integrity": "sha512-PRWFHuSU3eDtQJPvnNY7Jcket1j0t5OuOsFzPPzsekD52Zl8qUfFIPEiswXqIvHWGVHOgX+7G/vCNNhehwxfkQ==",
+      "requires": {
+        "ms": "2.1.2"
+      }
+    },
+    "decamelize": {
+      "version": "1.2.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/decamelize/-/decamelize-1.2.0.tgz",
+      "integrity": "sha1-9lNNFRSCabIDUue+4m9QH5oZEpA="
+    },
+    "default-resolution": {
+      "version": "2.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/default-resolution/-/default-resolution-2.0.0.tgz",
+      "integrity": "sha1-vLgrqnKtebQmp2cy8aga1t8m1oQ="
+    },
+    "define-properties": {
+      "version": "1.1.3",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/define-properties/-/define-properties-1.1.3.tgz",
+      "integrity": "sha512-3MqfYKj2lLzdMSf8ZIZE/V+Zuy+BgD6f164e8K2w7dgnpKArBDerGYpM46IYYcjnkdPNMjPk9A6VFB8+3SKlXQ==",
+      "requires": {
+        "object-keys": "^1.0.12"
+      }
+    },
+    "detect-file": {
+      "version": "1.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/detect-file/-/detect-file-1.0.0.tgz",
+      "integrity": "sha1-8NZtA2cqglyxtzvbP+YjEMjlUrc="
+    },
+    "end-of-stream": {
+      "version": "1.4.4",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/end-of-stream/-/end-of-stream-1.4.4.tgz",
+      "integrity": "sha512-+uw1inIHVPQoaVuHzRyXd21icM+cnt4CzD5rW+NC1wjOUSTOs+Te7FOv7AhN7vS9x/oIyhLP5PR1H+phQAHu5Q==",
+      "requires": {
+        "once": "^1.4.0"
+      }
+    },
+    "error-ex": {
+      "version": "1.3.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/error-ex/-/error-ex-1.3.2.tgz",
+      "integrity": "sha512-7dFHNmqeFSEt2ZBsCriorKnn3Z2pj+fd9kmI6QoWw4//DL+icEBfc0U7qJCisqrTsKTjw4fNFy2pW9OqStD84g==",
+      "requires": {
+        "is-arrayish": "^0.2.1"
+      }
+    },
+    "es5-ext": {
+      "version": "0.10.59",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/es5-ext/-/es5-ext-0.10.59.tgz",
+      "integrity": "sha512-cOgyhW0tIJyQY1Kfw6Kr0viu9ZlUctVchRMZ7R0HiH3dxTSp5zJDLecwxUqPUrGKMsgBI1wd1FL+d9Jxfi4cLw==",
+      "requires": {
+        "es6-iterator": "^2.0.3",
+        "es6-symbol": "^3.1.3",
+        "next-tick": "^1.1.0"
+      }
+    },
+    "es6-iterator": {
+      "version": "2.0.3",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/es6-iterator/-/es6-iterator-2.0.3.tgz",
+      "integrity": "sha1-p96IkUGgWpSwhUQDstCg+/qY87c=",
+      "requires": {
+        "d": "1",
+        "es5-ext": "^0.10.35",
+        "es6-symbol": "^3.1.1"
+      }
+    },
+    "es6-symbol": {
+      "version": "3.1.3",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/es6-symbol/-/es6-symbol-3.1.3.tgz",
+      "integrity": "sha512-NJ6Yn3FuDinBaBRWl/q5X/s4koRHBrgKAu+yGI6JCBeiu3qrcbJhwT2GeR/EXVfylRk8dpQVJoLEFhK+Mu31NA==",
+      "requires": {
+        "d": "^1.0.1",
+        "ext": "^1.1.2"
+      }
+    },
+    "es6-weak-map": {
+      "version": "2.0.3",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/es6-weak-map/-/es6-weak-map-2.0.3.tgz",
+      "integrity": "sha512-p5um32HOTO1kP+w7PRnB+5lQ43Z6muuMuIMffvDN8ZB4GcnjLBV6zGStpbASIMk4DCAvEaamhe2zhyCb/QXXsA==",
+      "requires": {
+        "d": "1",
+        "es5-ext": "^0.10.46",
+        "es6-iterator": "^2.0.3",
+        "es6-symbol": "^3.1.1"
+      }
+    },
+    "execa": {
+      "version": "5.1.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/execa/-/execa-5.1.1.tgz",
+      "integrity": "sha512-8uSpZZocAZRBAPIEINJj3Lo9HyGitllczc27Eh5YYojjMFMn8yHMDMaUHE2Jqfq05D/wucwI4JGURyXt1vchyg==",
+      "requires": {
+        "cross-spawn": "^7.0.3",
+        "get-stream": "^6.0.0",
+        "human-signals": "^2.1.0",
+        "is-stream": "^2.0.0",
+        "merge-stream": "^2.0.0",
+        "npm-run-path": "^4.0.1",
+        "onetime": "^5.1.2",
+        "signal-exit": "^3.0.3",
+        "strip-final-newline": "^2.0.0"
+      }
+    },
+    "expand-tilde": {
+      "version": "2.0.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/expand-tilde/-/expand-tilde-2.0.2.tgz",
+      "integrity": "sha1-l+gBqgUt8CRU3kawK/YhZCzchQI=",
+      "requires": {
+        "homedir-polyfill": "^1.0.1"
+      }
+    },
+    "ext": {
+      "version": "1.6.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/ext/-/ext-1.6.0.tgz",
+      "integrity": "sha512-sdBImtzkq2HpkdRLtlLWDa6w4DX22ijZLKx8BMPUuKe1c5lbN6xwQDQCxSfxBQnHZ13ls/FH0MQZx/q/gr6FQg==",
+      "requires": {
+        "type": "^2.5.0"
+      },
+      "dependencies": {
+        "type": {
+          "version": "2.6.0",
+          "resolved": "https://repo.huaweicloud.com/repository/npm/type/-/type-2.6.0.tgz",
+          "integrity": "sha512-eiDBDOmkih5pMbo9OqsqPRGMljLodLcwd5XD5JbtNB0o89xZAwynY9EdCDsJU7LtcVCClu9DvM7/0Ep1hYX3EQ=="
+        }
+      }
+    },
+    "extend": {
+      "version": "3.0.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/extend/-/extend-3.0.2.tgz",
+      "integrity": "sha512-fjquC59cD7CyW6urNXK0FBufkZcoiGG80wTuPujX590cB5Ttln20E2UB4S/WARVqhXffZl2LNgS+gQdPIIim/g=="
+    },
+    "fast-deep-equal": {
+      "version": "3.1.3",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/fast-deep-equal/-/fast-deep-equal-3.1.3.tgz",
+      "integrity": "sha512-f3qQ9oQy9j2AhBe/H9VC91wLmKBCCU/gDOnKNAYG5hswO7BLKj09Hc5HYNz9cGI++xlpDCIgDaitVs03ATR84Q=="
+    },
+    "fill-range": {
+      "version": "7.0.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/fill-range/-/fill-range-7.0.1.tgz",
+      "integrity": "sha512-qOo9F+dMUmC2Lcb4BbVvnKJxTPjCm+RRpe4gDuGrzkL7mEVl/djYSu2OdQ2Pa302N4oqkSg9ir6jaLWJ2USVpQ==",
+      "requires": {
+        "to-regex-range": "^5.0.1"
+      }
+    },
+    "find-up": {
+      "version": "1.1.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/find-up/-/find-up-1.1.2.tgz",
+      "integrity": "sha1-ay6YIrGizgpgq2TWEOzK1TyyTQ8=",
+      "requires": {
+        "path-exists": "^2.0.0",
+        "pinkie-promise": "^2.0.0"
+      }
+    },
+    "findup-sync": {
+      "version": "5.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/findup-sync/-/findup-sync-5.0.0.tgz",
+      "integrity": "sha512-MzwXju70AuyflbgeOhzvQWAvvQdo1XL0A9bVvlXsYcFEBM87WR4OakL4OfZq+QRmr+duJubio+UtNQCPsVESzQ==",
+      "requires": {
+        "detect-file": "^1.0.0",
+        "is-glob": "^4.0.3",
+        "micromatch": "^4.0.4",
+        "resolve-dir": "^1.0.1"
+      }
+    },
+    "fined": {
+      "version": "2.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/fined/-/fined-2.0.0.tgz",
+      "integrity": "sha512-OFRzsL6ZMHz5s0JrsEr+TpdGNCtrVtnuG3x1yzGNiQHT0yaDnXAj8V/lWcpJVrnoDpcwXcASxAZYbuXda2Y82A==",
+      "requires": {
+        "expand-tilde": "^2.0.2",
+        "is-plain-object": "^5.0.0",
+        "object.defaults": "^1.1.0",
+        "object.pick": "^1.3.0",
+        "parse-filepath": "^1.0.2"
+      }
+    },
+    "flagged-respawn": {
+      "version": "2.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/flagged-respawn/-/flagged-respawn-2.0.0.tgz",
+      "integrity": "sha512-Gq/a6YCi8zexmGHMuJwahTGzXlAZAOsbCVKduWXC6TlLCjjFRlExMJc4GC2NYPYZ0r/brw9P7CpRgQmlPVeOoA=="
+    },
+    "flatted": {
+      "version": "3.2.5",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/flatted/-/flatted-3.2.5.tgz",
+      "integrity": "sha512-WIWGi2L3DyTUvUrwRKgGi9TwxQMUEqPOPQBVi71R96jZXJdFskXEmf54BoZaS1kknGODoIGASGEzBUYdyMCBJg=="
+    },
+    "for-in": {
+      "version": "1.0.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/for-in/-/for-in-1.0.2.tgz",
+      "integrity": "sha1-gQaNKVqBQuwKxybG4iAMMPttXoA="
+    },
+    "for-own": {
+      "version": "1.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/for-own/-/for-own-1.0.0.tgz",
+      "integrity": "sha1-xjMy9BXO3EsE2/5wz4NklMU8tEs=",
+      "requires": {
+        "for-in": "^1.0.1"
+      }
+    },
+    "fs-constants": {
+      "version": "1.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/fs-constants/-/fs-constants-1.0.0.tgz",
+      "integrity": "sha512-y6OAwoSIf7FyjMIv94u+b5rdheZEjzR63GTyZJm5qh4Bi+2YgwLCcI/fPFZkL5PSixOt6ZNKm+w+Hfp/Bciwow=="
+    },
+    "fs-extra": {
+      "version": "10.0.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/fs-extra/-/fs-extra-10.0.1.tgz",
+      "integrity": "sha512-NbdoVMZso2Lsrn/QwLXOy6rm0ufY2zEOKCDzJR/0kBsb0E6qed0P3iYK+Ath3BfvXEeu4JhEtXLgILx5psUfag==",
+      "requires": {
+        "graceful-fs": "^4.2.0",
+        "jsonfile": "^6.0.1",
+        "universalify": "^2.0.0"
+      }
+    },
+    "fs.realpath": {
+      "version": "1.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/fs.realpath/-/fs.realpath-1.0.0.tgz",
+      "integrity": "sha1-FQStJSMVjKpA20onh8sBQRmU6k8="
+    },
+    "function-bind": {
+      "version": "1.1.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/function-bind/-/function-bind-1.1.1.tgz",
+      "integrity": "sha512-yIovAzMX49sF8Yl58fSCWJ5svSLuaibPxXQJFLmBObTuCr0Mf1KiPopGM9NiFjiYBCbfaa2Fh6breQ6ANVTI0A=="
+    },
+    "get-caller-file": {
+      "version": "1.0.3",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/get-caller-file/-/get-caller-file-1.0.3.tgz",
+      "integrity": "sha512-3t6rVToeoZfYSGd8YoLFR2DJkiQrIiUrGcjvFX2mDw3bn6k2OtwHN0TNCLbBO+w8qTvimhDkv+LSscbJY1vE6w=="
+    },
+    "get-intrinsic": {
+      "version": "1.1.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/get-intrinsic/-/get-intrinsic-1.1.1.tgz",
+      "integrity": "sha512-kWZrnVM42QCiEA2Ig1bG8zjoIMOgxWwYCEeNdwY6Tv/cOSeGpcoX4pXHfKUxNKVoArnrEr2e9srnAxxGIraS9Q==",
+      "requires": {
+        "function-bind": "^1.1.1",
+        "has": "^1.0.3",
+        "has-symbols": "^1.0.1"
+      }
+    },
+    "get-stream": {
+      "version": "6.0.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/get-stream/-/get-stream-6.0.1.tgz",
+      "integrity": "sha512-ts6Wi+2j3jQjqi70w5AlN8DFnkSwC+MqmxEzdEALB2qXZYV3X/b1CTfgPLGJNMeAWxdPfU8FO1ms3NUfaHCPYg=="
+    },
+    "glob": {
+      "version": "7.2.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/glob/-/glob-7.2.0.tgz",
+      "integrity": "sha512-lmLf6gtyrPq8tTjSmrO94wBeQbFR3HbLHbuyD69wuyQkImp2hWqMGB47OX65FBkPffO641IP9jWa1z4ivqG26Q==",
+      "requires": {
+        "fs.realpath": "^1.0.0",
+        "inflight": "^1.0.4",
+        "inherits": "2",
+        "minimatch": "^3.0.4",
+        "once": "^1.3.0",
+        "path-is-absolute": "^1.0.0"
+      }
+    },
+    "global-modules": {
+      "version": "1.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/global-modules/-/global-modules-1.0.0.tgz",
+      "integrity": "sha512-sKzpEkf11GpOFuw0Zzjzmt4B4UZwjOcG757PPvrfhxcLFbq0wpsgpOqxpxtxFiCG4DtG93M6XRVbF2oGdev7bg==",
+      "requires": {
+        "global-prefix": "^1.0.1",
+        "is-windows": "^1.0.1",
+        "resolve-dir": "^1.0.0"
+      }
+    },
+    "global-prefix": {
+      "version": "1.0.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/global-prefix/-/global-prefix-1.0.2.tgz",
+      "integrity": "sha1-2/dDxsFJklk8ZVVoy2btMsASLr4=",
+      "requires": {
+        "expand-tilde": "^2.0.2",
+        "homedir-polyfill": "^1.0.1",
+        "ini": "^1.3.4",
+        "is-windows": "^1.0.1",
+        "which": "^1.2.14"
+      }
+    },
+    "graceful-fs": {
+      "version": "4.2.9",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/graceful-fs/-/graceful-fs-4.2.9.tgz",
+      "integrity": "sha512-NtNxqUcXgpW2iMrfqSfR73Glt39K+BLwWsPs94yR63v45T0Wbej7eRmL5cWfwEgqXnmjQp3zaJTshdRW/qC2ZQ=="
+    },
+    "has": {
+      "version": "1.0.3",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/has/-/has-1.0.3.tgz",
+      "integrity": "sha512-f2dvO0VU6Oej7RkWJGrehjbzMAjFp5/VKPp5tTpWIV4JHHZK1/BxbFRtf/siA2SWTe09caDmVtYYzWEIbBS4zw==",
+      "requires": {
+        "function-bind": "^1.1.1"
+      }
+    },
+    "has-symbols": {
+      "version": "1.0.3",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/has-symbols/-/has-symbols-1.0.3.tgz",
+      "integrity": "sha512-l3LCuF6MgDNwTDKkdYGEihYjt5pRPbEg46rtlmnSPlUbgmB8LOIrKJbYYFBSbnPaJexMKtiPO8hmeRjRz2Td+A=="
+    },
+    "homedir-polyfill": {
+      "version": "1.0.3",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/homedir-polyfill/-/homedir-polyfill-1.0.3.tgz",
+      "integrity": "sha512-eSmmWE5bZTK2Nou4g0AI3zZ9rswp7GRKoKXS1BLUkvPviOqs4YTN1djQIqrXy9k5gEtdLPy86JjRwsNM9tnDcA==",
+      "requires": {
+        "parse-passwd": "^1.0.0"
+      }
+    },
+    "hosted-git-info": {
+      "version": "2.8.9",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/hosted-git-info/-/hosted-git-info-2.8.9.tgz",
+      "integrity": "sha512-mxIDAb9Lsm6DoOJ7xH+5+X4y1LU/4Hi50L9C5sIswK3JzULS4bwk1FvjdBgvYR4bzT4tuUQiC15FE2f5HbLvYw=="
+    },
+    "human-signals": {
+      "version": "2.1.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/human-signals/-/human-signals-2.1.0.tgz",
+      "integrity": "sha512-B4FFZ6q/T2jhhksgkbEW3HBvWIfDW85snkQgawt07S7J5QXTk6BkNV+0yAeZrM5QpMAdYlocGoljn0sJ/WQkFw=="
+    },
+    "hypium": {
+      "version": "1.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/hypium/-/hypium-1.0.0.tgz",
+      "integrity": "sha512-nl+RQVv2AU/5FvFRhsXyWO5wh+2huhdqRZ3bszBWZzW+kpNI3AT4ydvVRYIfaQbYwV4UlX/rSc7BtFjLAezhow=="
+    },
+    "iconv-lite": {
+      "version": "0.6.3",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/iconv-lite/-/iconv-lite-0.6.3.tgz",
+      "integrity": "sha512-4fCk79wshMdzMp2rH06qWrJE4iolqLhCUH+OiuIgU++RB0+94NlDL81atO7GX55uUKueo0txHNtvEyI6D7WdMw==",
+      "requires": {
+        "safer-buffer": ">= 2.1.2 < 3.0.0"
+      }
+    },
+    "ieee754": {
+      "version": "1.2.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/ieee754/-/ieee754-1.2.1.tgz",
+      "integrity": "sha512-dcyqhDvX1C46lXZcVqCpK+FtMRQVdIMN6/Df5js2zouUsqG7I6sFxitIC+7KYK29KdXOLHdu9zL4sFnoVQnqaA=="
+    },
+    "inflight": {
+      "version": "1.0.6",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/inflight/-/inflight-1.0.6.tgz",
+      "integrity": "sha1-Sb1jMdfQLQwJvJEKEHW6gWW1bfk=",
+      "requires": {
+        "once": "^1.3.0",
+        "wrappy": "1"
+      }
+    },
+    "inherits": {
+      "version": "2.0.4",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/inherits/-/inherits-2.0.4.tgz",
+      "integrity": "sha512-k/vGaX4/Yla3WzyMCvTQOXYeIHvqOKtnqBduzTHpzpQZzAskKMhZ2K+EnBiSM9zGSoIFeMpXKxa4dYeZIQqewQ=="
+    },
+    "ini": {
+      "version": "1.3.8",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/ini/-/ini-1.3.8.tgz",
+      "integrity": "sha512-JV/yugV2uzW5iMRSiZAyDtQd+nxtUnjeLt0acNdw98kKLrvuRVyB80tsREOE7yvGVgalhZ6RNXCmEHkUKBKxew=="
+    },
+    "interpret": {
+      "version": "1.4.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/interpret/-/interpret-1.4.0.tgz",
+      "integrity": "sha512-agE4QfB2Lkp9uICn7BAqoscw4SZP9kTE2hxiFI3jBPmXJfdqiahTbUuKGsMoN2GtqL9AxhYioAcVvgsb1HvRbA=="
+    },
+    "invert-kv": {
+      "version": "1.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/invert-kv/-/invert-kv-1.0.0.tgz",
+      "integrity": "sha1-EEqOSqym09jNFXqO+L+rLXo//bY="
+    },
+    "is-absolute": {
+      "version": "1.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/is-absolute/-/is-absolute-1.0.0.tgz",
+      "integrity": "sha512-dOWoqflvcydARa360Gvv18DZ/gRuHKi2NU/wU5X1ZFzdYfH29nkiNZsF3mp4OJ3H4yo9Mx8A/uAGNzpzPN3yBA==",
+      "requires": {
+        "is-relative": "^1.0.0",
+        "is-windows": "^1.0.1"
+      }
+    },
+    "is-arrayish": {
+      "version": "0.2.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/is-arrayish/-/is-arrayish-0.2.1.tgz",
+      "integrity": "sha1-d8mYQFJ6qOyxqLppe4BkWnqSap0="
+    },
+    "is-core-module": {
+      "version": "2.8.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/is-core-module/-/is-core-module-2.8.1.tgz",
+      "integrity": "sha512-SdNCUs284hr40hFTFP6l0IfZ/RSrMXF3qgoRHd3/79unUTvrFO/JoXwkGm+5J/Oe3E/b5GsnG330uUNgRpu1PA==",
+      "requires": {
+        "has": "^1.0.3"
+      }
+    },
+    "is-extglob": {
+      "version": "2.1.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/is-extglob/-/is-extglob-2.1.1.tgz",
+      "integrity": "sha1-qIwCU1eR8C7TfHahueqXc8gz+MI="
+    },
+    "is-fullwidth-code-point": {
+      "version": "1.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/is-fullwidth-code-point/-/is-fullwidth-code-point-1.0.0.tgz",
+      "integrity": "sha1-754xOG8DGn8NZDr4L95QxFfvAMs=",
+      "requires": {
+        "number-is-nan": "^1.0.0"
+      }
+    },
+    "is-glob": {
+      "version": "4.0.3",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/is-glob/-/is-glob-4.0.3.tgz",
+      "integrity": "sha512-xelSayHH36ZgE7ZWhli7pW34hNbNl8Ojv5KVmkJD4hBdD3th8Tfk9vYasLM+mXWOZhFkgZfxhLSnrwRr4elSSg==",
+      "requires": {
+        "is-extglob": "^2.1.1"
+      }
+    },
+    "is-number": {
+      "version": "4.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/is-number/-/is-number-4.0.0.tgz",
+      "integrity": "sha512-rSklcAIlf1OmFdyAqbnWTLVelsQ58uvZ66S/ZyawjWqIviTWCjg2PzVGw8WUA+nNuPTqb4wgA+NszrJ+08LlgQ=="
+    },
+    "is-plain-object": {
+      "version": "5.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/is-plain-object/-/is-plain-object-5.0.0.tgz",
+      "integrity": "sha512-VRSzKkbMm5jMDoKLbltAkFQ5Qr7VDiTFGXxYFXXowVj387GeGNOCsOH6Msy00SGZ3Fp84b1Naa1psqgcCIEP5Q=="
+    },
+    "is-relative": {
+      "version": "1.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/is-relative/-/is-relative-1.0.0.tgz",
+      "integrity": "sha512-Kw/ReK0iqwKeu0MITLFuj0jbPAmEiOsIwyIXvvbfa6QfmN9pkD1M+8pdk7Rl/dTKbH34/XBFMbgD4iMJhLQbGA==",
+      "requires": {
+        "is-unc-path": "^1.0.0"
+      }
+    },
+    "is-stream": {
+      "version": "2.0.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/is-stream/-/is-stream-2.0.1.tgz",
+      "integrity": "sha512-hFoiJiTl63nn+kstHGBtewWSKnQLpyb155KHheA1l39uvtO9nWIop1p3udqPcUd/xbF1VLMO4n7OI6p7RbngDg=="
+    },
+    "is-unc-path": {
+      "version": "1.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/is-unc-path/-/is-unc-path-1.0.0.tgz",
+      "integrity": "sha512-mrGpVd0fs7WWLfVsStvgF6iEJnbjDFZh9/emhRDcGWTduTfNHd9CHeUwH3gYIjdbwo4On6hunkztwOaAw0yllQ==",
+      "requires": {
+        "unc-path-regex": "^0.1.2"
+      }
+    },
+    "is-utf8": {
+      "version": "0.2.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/is-utf8/-/is-utf8-0.2.1.tgz",
+      "integrity": "sha1-Sw2hRCEE0bM2NA6AeX6GXPOffXI="
+    },
+    "is-windows": {
+      "version": "1.0.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/is-windows/-/is-windows-1.0.2.tgz",
+      "integrity": "sha512-eXK1UInq2bPmjyX6e3VHIzMLobc4J94i4AWn+Hpq3OU5KkrRC96OAcR3PRJ/pGu6m8TRnBHP9dkXQVsT/COVIA=="
+    },
+    "isarray": {
+      "version": "1.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/isarray/-/isarray-1.0.0.tgz",
+      "integrity": "sha1-u5NdSFgsuhaMBoNJV6VKPgcSTxE="
+    },
+    "isexe": {
+      "version": "2.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/isexe/-/isexe-2.0.0.tgz",
+      "integrity": "sha1-6PvzdNxVb/iUehDcsFctYz8s+hA="
+    },
+    "isobject": {
+      "version": "3.0.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/isobject/-/isobject-3.0.1.tgz",
+      "integrity": "sha1-TkMekrEalzFjaqH5yNHMvP2reN8="
+    },
+    "json-schema-traverse": {
+      "version": "1.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/json-schema-traverse/-/json-schema-traverse-1.0.0.tgz",
+      "integrity": "sha512-NM8/P9n3XjXhIZn1lLhkFaACTOURQXjWhV4BA/RnOv8xvgqtqpAX9IO4mRQxSx1Rlo4tqzeqb0sOlruaOy3dug=="
+    },
+    "json5": {
+      "version": "2.2.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/json5/-/json5-2.2.0.tgz",
+      "integrity": "sha512-f+8cldu7X/y7RAJurMEJmdoKXGB/X550w2Nr3tTbezL6RwEE/iMcm+tZnXeoZtKuOq6ft8+CqzEkrIgx1fPoQA==",
+      "requires": {
+        "minimist": "^1.2.5"
+      }
+    },
+    "jsonfile": {
+      "version": "6.1.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/jsonfile/-/jsonfile-6.1.0.tgz",
+      "integrity": "sha512-5dgndWOriYSm5cnYaJNhalLNDKOqFwyDB/rr1E9ZsGciGvKPs8R2xYGCacuf3z6K1YKDz182fd+fY3cn3pMqXQ==",
+      "requires": {
+        "graceful-fs": "^4.1.6",
+        "universalify": "^2.0.0"
+      }
+    },
+    "kind-of": {
+      "version": "6.0.3",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/kind-of/-/kind-of-6.0.3.tgz",
+      "integrity": "sha512-dcS1ul+9tmeD95T+x28/ehLgd9mENa3LsvDTtzm3vyBEO7RPptvAD+t44WVXaUjTBRcrpFeFlC8WCruUR456hw=="
+    },
+    "last-run": {
+      "version": "1.1.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/last-run/-/last-run-1.1.1.tgz",
+      "integrity": "sha1-RblpQsF7HHnHchmCWbqUO+v4yls=",
+      "requires": {
+        "default-resolution": "^2.0.0",
+        "es6-weak-map": "^2.0.1"
+      }
+    },
+    "lazystream": {
+      "version": "1.0.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/lazystream/-/lazystream-1.0.1.tgz",
+      "integrity": "sha512-b94GiNHQNy6JNTrt5w6zNyffMrNkXZb3KTkCZJb2V1xaEGCk093vkZ2jk3tpaeP33/OiXC+WvK9AxUebnf5nbw==",
+      "requires": {
+        "readable-stream": "^2.0.5"
+      },
+      "dependencies": {
+        "readable-stream": {
+          "version": "2.3.7",
+          "resolved": "https://repo.huaweicloud.com/repository/npm/readable-stream/-/readable-stream-2.3.7.tgz",
+          "integrity": "sha512-Ebho8K4jIbHAxnuxi7o42OrZgF/ZTNcsZj6nRKyUmkhLFq8CHItp/fy6hQZuZmP/n3yZ9VBUbp4zz/mX8hmYPw==",
+          "requires": {
+            "core-util-is": "~1.0.0",
+            "inherits": "~2.0.3",
+            "isarray": "~1.0.0",
+            "process-nextick-args": "~2.0.0",
+            "safe-buffer": "~5.1.1",
+            "string_decoder": "~1.1.1",
+            "util-deprecate": "~1.0.1"
+          }
+        }
+      }
+    },
+    "lcid": {
+      "version": "1.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/lcid/-/lcid-1.0.0.tgz",
+      "integrity": "sha1-MIrMr6C8SDo4Z7S28rlQYlHRuDU=",
+      "requires": {
+        "invert-kv": "^1.0.0"
+      }
+    },
+    "liftoff": {
+      "version": "4.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/liftoff/-/liftoff-4.0.0.tgz",
+      "integrity": "sha512-rMGwYF8q7g2XhG2ulBmmJgWv25qBsqRbDn5gH0+wnuyeFt7QBJlHJmtg5qEdn4pN6WVAUMgXnIxytMFRX9c1aA==",
+      "requires": {
+        "extend": "^3.0.2",
+        "findup-sync": "^5.0.0",
+        "fined": "^2.0.0",
+        "flagged-respawn": "^2.0.0",
+        "is-plain-object": "^5.0.0",
+        "object.map": "^1.0.1",
+        "rechoir": "^0.8.0",
+        "resolve": "^1.20.0"
+      }
+    },
+    "load-json-file": {
+      "version": "1.1.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/load-json-file/-/load-json-file-1.1.0.tgz",
+      "integrity": "sha1-lWkFcI1YtLq0wiYbBPWfMcmTdMA=",
+      "requires": {
+        "graceful-fs": "^4.1.2",
+        "parse-json": "^2.2.0",
+        "pify": "^2.0.0",
+        "pinkie-promise": "^2.0.0",
+        "strip-bom": "^2.0.0"
+      }
+    },
+    "lodash": {
+      "version": "4.17.21",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/lodash/-/lodash-4.17.21.tgz",
+      "integrity": "sha512-v2kDEe57lecTulaDIuNTPy3Ry4gLGJ6Z1O3vE1krgXZNrsQ+LFTGHVxVjcXPs17LhbZVGedAJv8XZ1tvj5FvSg=="
+    },
+    "lodash.defaults": {
+      "version": "4.2.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/lodash.defaults/-/lodash.defaults-4.2.0.tgz",
+      "integrity": "sha1-0JF4cW/+pN3p5ft7N/bwgCJ0WAw="
+    },
+    "lodash.difference": {
+      "version": "4.5.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/lodash.difference/-/lodash.difference-4.5.0.tgz",
+      "integrity": "sha1-nMtOUF1Ia5FlE0V3KIWi3yf9AXw="
+    },
+    "lodash.flatten": {
+      "version": "4.4.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/lodash.flatten/-/lodash.flatten-4.4.0.tgz",
+      "integrity": "sha1-8xwiIlqWMtK7+OSt2+8kCqdlph8="
+    },
+    "lodash.isplainobject": {
+      "version": "4.0.6",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/lodash.isplainobject/-/lodash.isplainobject-4.0.6.tgz",
+      "integrity": "sha1-fFJqUtibRcRcxpC4gWO+BJf1UMs="
+    },
+    "lodash.union": {
+      "version": "4.6.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/lodash.union/-/lodash.union-4.6.0.tgz",
+      "integrity": "sha1-SLtQiECfFvGCFmZkHETdGqrjzYg="
+    },
+    "log4js": {
+      "version": "6.4.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/log4js/-/log4js-6.4.1.tgz",
+      "integrity": "sha512-iUiYnXqAmNKiIZ1XSAitQ4TmNs8CdZYTAWINARF3LjnsLN8tY5m0vRwd6uuWj/yNY0YHxeZodnbmxKFUOM2rMg==",
+      "requires": {
+        "date-format": "^4.0.3",
+        "debug": "^4.3.3",
+        "flatted": "^3.2.4",
+        "rfdc": "^1.3.0",
+        "streamroller": "^3.0.2"
+      }
+    },
+    "make-iterator": {
+      "version": "1.0.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/make-iterator/-/make-iterator-1.0.1.tgz",
+      "integrity": "sha512-pxiuXh0iVEq7VM7KMIhs5gxsfxCux2URptUQaXo4iZZJxBAzTPOLE2BumO5dbfVYq/hBJFBR/a1mFDmOx5AGmw==",
+      "requires": {
+        "kind-of": "^6.0.2"
+      }
+    },
+    "map-cache": {
+      "version": "0.2.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/map-cache/-/map-cache-0.2.2.tgz",
+      "integrity": "sha1-wyq9C9ZSXZsFFkW7TyasXcmKDb8="
+    },
+    "merge-stream": {
+      "version": "2.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/merge-stream/-/merge-stream-2.0.0.tgz",
+      "integrity": "sha512-abv/qOcuPfk3URPfDzmZU1LKmuw8kT+0nIHvKrKgFrwifol/doWcdA4ZqsWQ8ENrFKkd67Mfpo/LovbIUsbt3w=="
+    },
+    "micromatch": {
+      "version": "4.0.5",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/micromatch/-/micromatch-4.0.5.tgz",
+      "integrity": "sha512-DMy+ERcEW2q8Z2Po+WNXuw3c5YaUSFjAO5GsJqfEl7UjvtIuFKO6ZrKvcItdy98dwFI2N1tg3zNIdKaQT+aNdA==",
+      "requires": {
+        "braces": "^3.0.2",
+        "picomatch": "^2.3.1"
+      }
+    },
+    "mimic-fn": {
+      "version": "2.1.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/mimic-fn/-/mimic-fn-2.1.0.tgz",
+      "integrity": "sha512-OqbOk5oEQeAZ8WXWydlu9HJjz9WVdEIvamMCcXmuqUYjTknH/sqsWvhQ3vgwKFRR1HpjvNBKQ37nbJgYzGqGcg=="
+    },
+    "minimatch": {
+      "version": "3.1.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/minimatch/-/minimatch-3.1.2.tgz",
+      "integrity": "sha512-J7p63hRiAjw1NDEww1W7i37+ByIrOWO5XQQAzZ3VOcL0PNybwpfmV/N05zFAzwQ9USyEcX6t3UO+K5aqBQOIHw==",
+      "requires": {
+        "brace-expansion": "^1.1.7"
+      }
+    },
+    "minimist": {
+      "version": "1.2.6",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/minimist/-/minimist-1.2.6.tgz",
+      "integrity": "sha512-Jsjnk4bw3YJqYzbdyBiNsPWHPfO++UGG749Cxs6peCu5Xg4nrena6OVxOYxrQTqww0Jmwt+Ref8rggumkTLz9Q=="
+    },
+    "ms": {
+      "version": "2.1.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/ms/-/ms-2.1.2.tgz",
+      "integrity": "sha512-sGkPx+VjMtmA6MX27oA4FBFELFCZZ4S4XqeGOXCv68tT+jb3vk/RyaKWP0PTKyWtmLSM0b+adUTEvbs1PEaH2w=="
+    },
+    "mute-stdout": {
+      "version": "1.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/mute-stdout/-/mute-stdout-1.0.0.tgz",
+      "integrity": "sha1-WzLqB+tDyd7WEwQ0z5JvRrKn/U0="
+    },
+    "next-tick": {
+      "version": "1.1.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/next-tick/-/next-tick-1.1.0.tgz",
+      "integrity": "sha512-CXdUiJembsNjuToQvxayPZF9Vqht7hewsvy2sOWafLvi2awflj9mOC6bHIg50orX8IJvWKY9wYQ/zB2kogPslQ=="
+    },
+    "normalize-package-data": {
+      "version": "2.5.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/normalize-package-data/-/normalize-package-data-2.5.0.tgz",
+      "integrity": "sha512-/5CMN3T0R4XTj4DcGaexo+roZSdSFW/0AOOTROrjxzCG1wrWXEsGbRKevjlIL+ZDE4sZlJr5ED4YW0yqmkK+eA==",
+      "requires": {
+        "hosted-git-info": "^2.1.4",
+        "resolve": "^1.10.0",
+        "semver": "2 || 3 || 4 || 5",
+        "validate-npm-package-license": "^3.0.1"
+      }
+    },
+    "normalize-path": {
+      "version": "3.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/normalize-path/-/normalize-path-3.0.0.tgz",
+      "integrity": "sha512-6eZs5Ls3WtCisHWp9S2GUy8dqkpGi4BVSz3GaqiE6ezub0512ESztXUwUB6C6IKbQkY2Pnb/mD4WYojCRwcwLA=="
+    },
+    "now-and-later": {
+      "version": "2.0.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/now-and-later/-/now-and-later-2.0.1.tgz",
+      "integrity": "sha512-KGvQ0cB70AQfg107Xvs/Fbu+dGmZoTRJp2TaPwcwQm3/7PteUyN2BCgk8KBMPGBUXZdVwyWS8fDCGFygBm19UQ==",
+      "requires": {
+        "once": "^1.3.2"
+      }
+    },
+    "npm-run-path": {
+      "version": "4.0.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/npm-run-path/-/npm-run-path-4.0.1.tgz",
+      "integrity": "sha512-S48WzZW777zhNIrn7gxOlISNAqi9ZC/uQFnRdbeIHhZhCA6UqpkOT8T1G7BvfdgP4Er8gF4sUbaS0i7QvIfCWw==",
+      "requires": {
+        "path-key": "^3.0.0"
+      }
+    },
+    "number-is-nan": {
+      "version": "1.0.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/number-is-nan/-/number-is-nan-1.0.1.tgz",
+      "integrity": "sha1-CXtgK1NCKlIsGvuHkDGDNpQaAR0="
+    },
+    "object-keys": {
+      "version": "1.1.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/object-keys/-/object-keys-1.1.1.tgz",
+      "integrity": "sha512-NuAESUOUMrlIXOfHKzD6bpPu3tYt3xvjNdRIQ+FeT0lNb4K8WR70CaDxhuNguS2XG+GjkyMwOzsN5ZktImfhLA=="
+    },
+    "object.assign": {
+      "version": "4.1.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/object.assign/-/object.assign-4.1.2.tgz",
+      "integrity": "sha512-ixT2L5THXsApyiUPYKmW+2EHpXXe5Ii3M+f4e+aJFAHao5amFRW6J0OO6c/LU8Be47utCx2GL89hxGB6XSmKuQ==",
+      "requires": {
+        "call-bind": "^1.0.0",
+        "define-properties": "^1.1.3",
+        "has-symbols": "^1.0.1",
+        "object-keys": "^1.1.1"
+      }
+    },
+    "object.defaults": {
+      "version": "1.1.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/object.defaults/-/object.defaults-1.1.0.tgz",
+      "integrity": "sha1-On+GgzS0B96gbaFtiNXNKeQ1/s8=",
+      "requires": {
+        "array-each": "^1.0.1",
+        "array-slice": "^1.0.0",
+        "for-own": "^1.0.0",
+        "isobject": "^3.0.0"
+      }
+    },
+    "object.map": {
+      "version": "1.0.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/object.map/-/object.map-1.0.1.tgz",
+      "integrity": "sha1-z4Plncj8wK1fQlDh94s7gb2AHTc=",
+      "requires": {
+        "for-own": "^1.0.0",
+        "make-iterator": "^1.0.0"
+      }
+    },
+    "object.pick": {
+      "version": "1.3.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/object.pick/-/object.pick-1.3.0.tgz",
+      "integrity": "sha1-h6EKxMFpS9Lhy/U1kaZhQftd10c=",
+      "requires": {
+        "isobject": "^3.0.1"
+      }
+    },
+    "object.reduce": {
+      "version": "1.0.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/object.reduce/-/object.reduce-1.0.1.tgz",
+      "integrity": "sha1-b+NI8qx/oPlcpiEiZZkJaCW7A60=",
+      "requires": {
+        "for-own": "^1.0.0",
+        "make-iterator": "^1.0.0"
+      }
+    },
+    "once": {
+      "version": "1.4.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/once/-/once-1.4.0.tgz",
+      "integrity": "sha1-WDsap3WWHUsROsF9nFC6753Xa9E=",
+      "requires": {
+        "wrappy": "1"
+      }
+    },
+    "onetime": {
+      "version": "5.1.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/onetime/-/onetime-5.1.2.tgz",
+      "integrity": "sha512-kbpaSSGJTWdAY5KPVeMOKXSrPtr8C8C7wodJbcsd51jRnmD+GZu8Y0VoU6Dm5Z4vWr0Ig/1NKuWRKf7j5aaYSg==",
+      "requires": {
+        "mimic-fn": "^2.1.0"
+      }
+    },
+    "os-locale": {
+      "version": "1.4.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/os-locale/-/os-locale-1.4.0.tgz",
+      "integrity": "sha1-IPnxeuKe00XoveWDsT0gCYA8FNk=",
+      "requires": {
+        "lcid": "^1.0.0"
+      }
+    },
+    "parse-filepath": {
+      "version": "1.0.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/parse-filepath/-/parse-filepath-1.0.2.tgz",
+      "integrity": "sha1-pjISf1Oq89FYdvWHLz/6x2PWyJE=",
+      "requires": {
+        "is-absolute": "^1.0.0",
+        "map-cache": "^0.2.0",
+        "path-root": "^0.1.1"
+      }
+    },
+    "parse-json": {
+      "version": "2.2.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/parse-json/-/parse-json-2.2.0.tgz",
+      "integrity": "sha1-9ID0BDTvgHQfhGkJn43qGPVaTck=",
+      "requires": {
+        "error-ex": "^1.2.0"
+      }
+    },
+    "parse-passwd": {
+      "version": "1.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/parse-passwd/-/parse-passwd-1.0.0.tgz",
+      "integrity": "sha1-bVuTSkVpk7I9N/QKOC1vFmao5cY="
+    },
+    "path-exists": {
+      "version": "2.1.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/path-exists/-/path-exists-2.1.0.tgz",
+      "integrity": "sha1-D+tsZPD8UY2adU3V77YscCJ2H0s=",
+      "requires": {
+        "pinkie-promise": "^2.0.0"
+      }
+    },
+    "path-is-absolute": {
+      "version": "1.0.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/path-is-absolute/-/path-is-absolute-1.0.1.tgz",
+      "integrity": "sha1-F0uSaHNVNP+8es5r9TpanhtcX18="
+    },
+    "path-key": {
+      "version": "3.1.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/path-key/-/path-key-3.1.1.tgz",
+      "integrity": "sha512-ojmeN0qd+y0jszEtoY48r0Peq5dwMEkIlCOu6Q5f41lfkswXuKtYrhgoTpLnyIcHm24Uhqx+5Tqm2InSwLhE6Q=="
+    },
+    "path-parse": {
+      "version": "1.0.7",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/path-parse/-/path-parse-1.0.7.tgz",
+      "integrity": "sha512-LDJzPVEEEPR+y48z93A0Ed0yXb8pAByGWo/k5YYdYgpY2/2EsOsksJrq7lOHxryrVOn1ejG6oAp8ahvOIQD8sw=="
+    },
+    "path-root": {
+      "version": "0.1.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/path-root/-/path-root-0.1.1.tgz",
+      "integrity": "sha1-mkpoFMrBwM1zNgqV8yCDyOpHRbc=",
+      "requires": {
+        "path-root-regex": "^0.1.0"
+      }
+    },
+    "path-root-regex": {
+      "version": "0.1.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/path-root-regex/-/path-root-regex-0.1.2.tgz",
+      "integrity": "sha1-v8zcjfWxLcUsi0PsONGNcsBLqW0="
+    },
+    "path-type": {
+      "version": "1.1.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/path-type/-/path-type-1.1.0.tgz",
+      "integrity": "sha1-WcRPfuSR2nBNpBXaWkBwuk+P5EE=",
+      "requires": {
+        "graceful-fs": "^4.1.2",
+        "pify": "^2.0.0",
+        "pinkie-promise": "^2.0.0"
+      }
+    },
+    "picomatch": {
+      "version": "2.3.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/picomatch/-/picomatch-2.3.1.tgz",
+      "integrity": "sha512-JU3teHTNjmE2VCGFzuY8EXzCDVwEqB2a8fsIvwaStHhAWJEeVd1o1QD80CU6+ZdEXXSLbSsuLwJjkCBWqRQUVA=="
+    },
+    "pify": {
+      "version": "2.3.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/pify/-/pify-2.3.0.tgz",
+      "integrity": "sha1-7RQaasBDqEnqWISY59yosVMw6Qw="
+    },
+    "pinkie": {
+      "version": "2.0.4",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/pinkie/-/pinkie-2.0.4.tgz",
+      "integrity": "sha1-clVrgM+g1IqXToDnckjoDtT3+HA="
+    },
+    "pinkie-promise": {
+      "version": "2.0.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/pinkie-promise/-/pinkie-promise-2.0.1.tgz",
+      "integrity": "sha1-ITXW36ejWMBprJsXh3YogihFD/o=",
+      "requires": {
+        "pinkie": "^2.0.0"
+      }
+    },
+    "pretty-hrtime": {
+      "version": "1.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/pretty-hrtime/-/pretty-hrtime-1.0.0.tgz",
+      "integrity": "sha1-9ualItPmBwRSK/Db5oVu0g515Nw="
+    },
+    "process-nextick-args": {
+      "version": "2.0.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/process-nextick-args/-/process-nextick-args-2.0.1.tgz",
+      "integrity": "sha512-3ouUOpQhtgrbOa17J7+uxOTpITYWaGP7/AhoR3+A+/1e9skrzelGi/dXzEYyvbxubEF6Wn2ypscTKiKJFFn1ag=="
+    },
+    "punycode": {
+      "version": "2.1.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/punycode/-/punycode-2.1.1.tgz",
+      "integrity": "sha512-XRsRjdf+j5ml+y/6GKHPZbrF/8p2Yga0JPtdqTIY2Xe5ohJPD9saDJJLPvp9+NSBprVvevdXZybnj2cv8OEd0A=="
+    },
+    "read-pkg": {
+      "version": "1.1.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/read-pkg/-/read-pkg-1.1.0.tgz",
+      "integrity": "sha1-9f+qXs0pyzHAR0vKfXVra7KePyg=",
+      "requires": {
+        "load-json-file": "^1.0.0",
+        "normalize-package-data": "^2.3.2",
+        "path-type": "^1.0.0"
+      }
+    },
+    "read-pkg-up": {
+      "version": "1.0.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/read-pkg-up/-/read-pkg-up-1.0.1.tgz",
+      "integrity": "sha1-nWPBMnbAZZGNV/ACpX9AobZD+wI=",
+      "requires": {
+        "find-up": "^1.0.0",
+        "read-pkg": "^1.0.0"
+      }
+    },
+    "readable-stream": {
+      "version": "3.6.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/readable-stream/-/readable-stream-3.6.0.tgz",
+      "integrity": "sha512-BViHy7LKeTz4oNnkcLJ+lVSL6vpiFeX6/d3oSH8zCW7UxP2onchk+vTGB143xuFjHS3deTgkKoXXymXqymiIdA==",
+      "requires": {
+        "inherits": "^2.0.3",
+        "string_decoder": "^1.1.1",
+        "util-deprecate": "^1.0.1"
+      }
+    },
+    "readdir-glob": {
+      "version": "1.1.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/readdir-glob/-/readdir-glob-1.1.1.tgz",
+      "integrity": "sha512-91/k1EzZwDx6HbERR+zucygRFfiPl2zkIYZtv3Jjr6Mn7SkKcVct8aVO+sSRiGMc6fLf72du3d92/uY63YPdEA==",
+      "requires": {
+        "minimatch": "^3.0.4"
+      }
+    },
+    "rechoir": {
+      "version": "0.8.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/rechoir/-/rechoir-0.8.0.tgz",
+      "integrity": "sha512-/vxpCXddiX8NGfGO/mTafwjq4aFa/71pvamip0++IQk3zG8cbCj0fifNPrjjF1XMXUne91jL9OoxmdykoEtifQ==",
+      "requires": {
+        "resolve": "^1.20.0"
+      }
+    },
+    "require-directory": {
+      "version": "2.1.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/require-directory/-/require-directory-2.1.1.tgz",
+      "integrity": "sha1-jGStX9MNqxyXbiNE/+f3kqam30I="
+    },
+    "require-from-string": {
+      "version": "2.0.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/require-from-string/-/require-from-string-2.0.2.tgz",
+      "integrity": "sha512-Xf0nWe6RseziFMu+Ap9biiUbmplq6S9/p+7w7YXP/JBHhrUDDUhwa+vANyubuqfZWTveU//DYVGsDG7RKL/vEw=="
+    },
+    "require-main-filename": {
+      "version": "1.0.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/require-main-filename/-/require-main-filename-1.0.1.tgz",
+      "integrity": "sha1-l/cXtp1IeE9fUmpsWqj/3aBVpNE="
+    },
+    "resolve": {
+      "version": "1.22.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/resolve/-/resolve-1.22.0.tgz",
+      "integrity": "sha512-Hhtrw0nLeSrFQ7phPp4OOcVjLPIeMnRlr5mcnVuMe7M/7eBn98A3hmFRLoFo3DLZkivSYwhRUJTyPyWAk56WLw==",
+      "requires": {
+        "is-core-module": "^2.8.1",
+        "path-parse": "^1.0.7",
+        "supports-preserve-symlinks-flag": "^1.0.0"
+      }
+    },
+    "resolve-dir": {
+      "version": "1.0.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/resolve-dir/-/resolve-dir-1.0.1.tgz",
+      "integrity": "sha1-eaQGRMNivoLybv/nOcm7U4IEb0M=",
+      "requires": {
+        "expand-tilde": "^2.0.0",
+        "global-modules": "^1.0.0"
+      }
+    },
+    "resolve-package-path": {
+      "version": "4.0.3",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/resolve-package-path/-/resolve-package-path-4.0.3.tgz",
+      "integrity": "sha512-SRpNAPW4kewOaNUt8VPqhJ0UMxawMwzJD8V7m1cJfdSTK9ieZwS6K7Dabsm4bmLFM96Z5Y/UznrpG5kt1im8yA==",
+      "requires": {
+        "path-root": "^0.1.1"
+      }
+    },
+    "rfdc": {
+      "version": "1.3.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/rfdc/-/rfdc-1.3.0.tgz",
+      "integrity": "sha512-V2hovdzFbOi77/WajaSMXk2OLm+xNIeQdMMuB7icj7bk6zi2F8GGAxigcnDFpJHbNyNcgyJDiP+8nOrY5cZGrA=="
+    },
+    "safe-buffer": {
+      "version": "5.1.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/safe-buffer/-/safe-buffer-5.1.2.tgz",
+      "integrity": "sha512-Gd2UZBJDkXlY7GbJxfsE8/nvKkUEU1G38c1siN6QP6a9PT9MmHB8GnpscSmMJSoF8LOIrt8ud/wPtojys4G6+g=="
+    },
+    "safer-buffer": {
+      "version": "2.1.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/safer-buffer/-/safer-buffer-2.1.2.tgz",
+      "integrity": "sha512-YZo3K82SD7Riyi0E1EQPojLz7kpepnSQI9IyPbHHg1XXXevb5dJI7tpyN2ADxGcQbHG7vcyRHk0cbwqcQriUtg=="
+    },
+    "semver": {
+      "version": "5.7.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/semver/-/semver-5.7.1.tgz",
+      "integrity": "sha512-sauaDf/PZdVgrLTNYHRtpXa1iRiKcaebiKQ1BJdpQlWH2lCvexQdX55snPFyK7QzpudqbCI0qXFfOasHdyNDGQ=="
+    },
+    "set-blocking": {
+      "version": "2.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/set-blocking/-/set-blocking-2.0.0.tgz",
+      "integrity": "sha1-BF+XgtARrppoA93TgrJDkrPYkPc="
+    },
+    "shebang-command": {
+      "version": "2.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/shebang-command/-/shebang-command-2.0.0.tgz",
+      "integrity": "sha512-kHxr2zZpYtdmrN1qDjrrX/Z1rR1kG8Dx+gkpK1G4eXmvXswmcE1hTWBWYUzlraYw1/yZp6YuDY77YtvbN0dmDA==",
+      "requires": {
+        "shebang-regex": "^3.0.0"
+      }
+    },
+    "shebang-regex": {
+      "version": "3.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/shebang-regex/-/shebang-regex-3.0.0.tgz",
+      "integrity": "sha512-7++dFhtcx3353uBaq8DDR4NuxBetBzC7ZQOhmTQInHEd6bSrXdiEyzCvG07Z44UYdLShWUyXt5M/yhz8ekcb1A=="
+    },
+    "signal-exit": {
+      "version": "3.0.7",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/signal-exit/-/signal-exit-3.0.7.tgz",
+      "integrity": "sha512-wnD2ZE+l+SPC/uoS0vXeE9L1+0wuaMqKlfz9AMUo38JsyLSBWSFcHR1Rri62LZc12vLr1gb3jl7iwQhgwpAbGQ=="
+    },
+    "spdx-correct": {
+      "version": "3.1.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/spdx-correct/-/spdx-correct-3.1.1.tgz",
+      "integrity": "sha512-cOYcUWwhCuHCXi49RhFRCyJEK3iPj1Ziz9DpViV3tbZOwXD49QzIN3MpOLJNxh2qwq2lJJZaKMVw9qNi4jTC0w==",
+      "requires": {
+        "spdx-expression-parse": "^3.0.0",
+        "spdx-license-ids": "^3.0.0"
+      }
+    },
+    "spdx-exceptions": {
+      "version": "2.3.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/spdx-exceptions/-/spdx-exceptions-2.3.0.tgz",
+      "integrity": "sha512-/tTrYOC7PPI1nUAgx34hUpqXuyJG+DTHJTnIULG4rDygi4xu/tfgmq1e1cIRwRzwZgo4NLySi+ricLkZkw4i5A=="
+    },
+    "spdx-expression-parse": {
+      "version": "3.0.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/spdx-expression-parse/-/spdx-expression-parse-3.0.1.tgz",
+      "integrity": "sha512-cbqHunsQWnJNE6KhVSMsMeH5H/L9EpymbzqTQ3uLwNCLZ1Q481oWaofqH7nO6V07xlXwY6PhQdQ2IedWx/ZK4Q==",
+      "requires": {
+        "spdx-exceptions": "^2.1.0",
+        "spdx-license-ids": "^3.0.0"
+      }
+    },
+    "spdx-license-ids": {
+      "version": "3.0.11",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/spdx-license-ids/-/spdx-license-ids-3.0.11.tgz",
+      "integrity": "sha512-Ctl2BrFiM0X3MANYgj3CkygxhRmr9mi6xhejbdO960nF6EDJApTYpn0BQnDKlnNBULKiCN1n3w9EBkHK8ZWg+g=="
+    },
+    "stream-exhaust": {
+      "version": "1.0.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/stream-exhaust/-/stream-exhaust-1.0.2.tgz",
+      "integrity": "sha512-b/qaq/GlBK5xaq1yrK9/zFcyRSTNxmcZwFLGSTG0mXgZl/4Z6GgiyYOXOvY7N3eEvFRAG1bkDRz5EPGSvPYQlw=="
+    },
+    "streamroller": {
+      "version": "3.0.6",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/streamroller/-/streamroller-3.0.6.tgz",
+      "integrity": "sha512-Qz32plKq/MZywYyhEatxyYc8vs994Gz0Hu2MSYXXLD233UyPeIeRBZARIIGwFer4Mdb8r3Y2UqKkgyDghM6QCg==",
+      "requires": {
+        "date-format": "^4.0.6",
+        "debug": "^4.3.4",
+        "fs-extra": "^10.0.1"
+      }
+    },
+    "string-width": {
+      "version": "1.0.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/string-width/-/string-width-1.0.2.tgz",
+      "integrity": "sha1-EYvfW4zcUaKn5w0hHgfisLmxB9M=",
+      "requires": {
+        "code-point-at": "^1.0.0",
+        "is-fullwidth-code-point": "^1.0.0",
+        "strip-ansi": "^3.0.0"
+      }
+    },
+    "string_decoder": {
+      "version": "1.1.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/string_decoder/-/string_decoder-1.1.1.tgz",
+      "integrity": "sha512-n/ShnvDi6FHbbVfviro+WojiFzv+s8MPMHBczVePfUpDJLwoLT0ht1l4YwBCbi8pJAveEEdnkHyPyTP/mzRfwg==",
+      "requires": {
+        "safe-buffer": "~5.1.0"
+      }
+    },
+    "strip-ansi": {
+      "version": "3.0.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/strip-ansi/-/strip-ansi-3.0.1.tgz",
+      "integrity": "sha1-ajhfuIU9lS1f8F0Oiq+UJ43GPc8=",
+      "requires": {
+        "ansi-regex": "^2.0.0"
+      }
+    },
+    "strip-bom": {
+      "version": "2.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/strip-bom/-/strip-bom-2.0.0.tgz",
+      "integrity": "sha1-YhmoVhZSBJHzV4i9vxRHqZx+aw4=",
+      "requires": {
+        "is-utf8": "^0.2.0"
+      }
+    },
+    "strip-final-newline": {
+      "version": "2.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/strip-final-newline/-/strip-final-newline-2.0.0.tgz",
+      "integrity": "sha512-BrpvfNAE3dcvq7ll3xVumzjKjZQ5tI1sEUIKr3Uoks0XUl45St3FlatVqef9prk4jRDzhW6WZg+3bk93y6pLjA=="
+    },
+    "supports-preserve-symlinks-flag": {
+      "version": "1.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/supports-preserve-symlinks-flag/-/supports-preserve-symlinks-flag-1.0.0.tgz",
+      "integrity": "sha512-ot0WnXS9fgdkgIcePe6RHNk1WA8+muPa6cSjeR3V8K27q9BB1rTE3R1p7Hv0z1ZyAc8s6Vvv8DIyWf681MAt0w=="
+    },
+    "tar-stream": {
+      "version": "2.2.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/tar-stream/-/tar-stream-2.2.0.tgz",
+      "integrity": "sha512-ujeqbceABgwMZxEJnk2HDY2DlnUZ+9oEcb1KzTVfYHio0UE6dG71n60d8D2I4qNvleWrrXpmjpt7vZeF1LnMZQ==",
+      "requires": {
+        "bl": "^4.0.3",
+        "end-of-stream": "^1.4.1",
+        "fs-constants": "^1.0.0",
+        "inherits": "^2.0.3",
+        "readable-stream": "^3.1.1"
+      }
+    },
+    "to-regex-range": {
+      "version": "5.0.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/to-regex-range/-/to-regex-range-5.0.1.tgz",
+      "integrity": "sha512-65P7iz6X5yEr1cwcgvQxbbIw7Uk3gOy5dIdtZ4rDveLqhrdJP+Li/Hx6tyK0NEb+2GCyneCMJiGqrADCSNk8sQ==",
+      "requires": {
+        "is-number": "^7.0.0"
+      },
+      "dependencies": {
+        "is-number": {
+          "version": "7.0.0",
+          "resolved": "https://repo.huaweicloud.com/repository/npm/is-number/-/is-number-7.0.0.tgz",
+          "integrity": "sha512-41Cifkg6e8TylSpdtTpeLVMqvSBEVzTttHvERD741+pnZ8ANv0004MRL43QKPDlK9cGvNp6NZWZUBlbGXYxxng=="
+        }
+      }
+    },
+    "type": {
+      "version": "1.2.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/type/-/type-1.2.0.tgz",
+      "integrity": "sha512-+5nt5AAniqsCnu2cEQQdpzCAh33kVx8n0VoFidKpB1dVVLAN/F+bgVOqOJqOnEnrhp222clB5p3vUlD+1QAnfg=="
+    },
+    "unc-path-regex": {
+      "version": "0.1.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/unc-path-regex/-/unc-path-regex-0.1.2.tgz",
+      "integrity": "sha1-5z3T17DXxe2G+6xrCufYxqadUPo="
+    },
+    "undertaker": {
+      "version": "1.2.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/undertaker/-/undertaker-1.2.1.tgz",
+      "integrity": "sha512-71WxIzDkgYk9ZS+spIB8iZXchFhAdEo2YU8xYqBYJ39DIUIqziK78ftm26eecoIY49X0J2MLhG4hr18Yp6/CMA==",
+      "requires": {
+        "arr-flatten": "^1.0.1",
+        "arr-map": "^2.0.0",
+        "bach": "^1.0.0",
+        "collection-map": "^1.0.0",
+        "es6-weak-map": "^2.0.1",
+        "last-run": "^1.1.0",
+        "object.defaults": "^1.0.0",
+        "object.reduce": "^1.0.0",
+        "undertaker-registry": "^1.0.0"
+      }
+    },
+    "undertaker-registry": {
+      "version": "1.0.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/undertaker-registry/-/undertaker-registry-1.0.1.tgz",
+      "integrity": "sha1-XkvaMI5KiirlhPm5pDWaSZglzFA="
+    },
+    "universalify": {
+      "version": "2.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/universalify/-/universalify-2.0.0.tgz",
+      "integrity": "sha512-hAZsKq7Yy11Zu1DE0OzWjw7nnLZmJZYTDZZyEFHZdUhV8FkH5MCfoU1XMaxXovpyW5nq5scPqq0ZDP9Zyl04oQ=="
+    },
+    "uri-js": {
+      "version": "4.4.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/uri-js/-/uri-js-4.4.1.tgz",
+      "integrity": "sha512-7rKUyy33Q1yc98pQ1DAmLtwX109F7TIfWlW1Ydo8Wl1ii1SeHieeh0HHfPeL2fMXK6z0s8ecKs9frCuLJvndBg==",
+      "requires": {
+        "punycode": "^2.1.0"
+      }
+    },
+    "util-deprecate": {
+      "version": "1.0.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/util-deprecate/-/util-deprecate-1.0.2.tgz",
+      "integrity": "sha1-RQ1Nyfpw3nMnYvvS1KKJgUGaDM8="
+    },
+    "v8flags": {
+      "version": "3.2.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/v8flags/-/v8flags-3.2.0.tgz",
+      "integrity": "sha512-mH8etigqMfiGWdeXpaaqGfs6BndypxusHHcv2qSHyZkGEznCd/qAXCWWRzeowtL54147cktFOC4P5y+kl8d8Jg==",
+      "requires": {
+        "homedir-polyfill": "^1.0.1"
+      }
+    },
+    "validate-npm-package-license": {
+      "version": "3.0.4",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/validate-npm-package-license/-/validate-npm-package-license-3.0.4.tgz",
+      "integrity": "sha512-DpKm2Ui/xN7/HQKCtpZxoRWBhZ9Z0kqtygG8XCgNQ8ZlDnxuQmWhj566j8fN4Cu3/JmbhsDo7fcAJq4s9h27Ew==",
+      "requires": {
+        "spdx-correct": "^3.0.0",
+        "spdx-expression-parse": "^3.0.0"
+      }
+    },
+    "which": {
+      "version": "1.3.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/which/-/which-1.3.1.tgz",
+      "integrity": "sha512-HxJdYWq1MTIQbJ3nw0cqssHoTNU267KlrDuGZ1WYlxDStUtKUhOaJmh112/TZmHxxUfuJqPXSOm7tDyas0OSIQ==",
+      "requires": {
+        "isexe": "^2.0.0"
+      }
+    },
+    "which-module": {
+      "version": "1.0.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/which-module/-/which-module-1.0.0.tgz",
+      "integrity": "sha1-u6Y8qGGUiZT/MHc2CJ47lgJsKk8="
+    },
+    "wrap-ansi": {
+      "version": "2.1.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/wrap-ansi/-/wrap-ansi-2.1.0.tgz",
+      "integrity": "sha1-2Pw9KE3QV5T+hJc8rs3Rz4JP3YU=",
+      "requires": {
+        "string-width": "^1.0.1",
+        "strip-ansi": "^3.0.1"
+      }
+    },
+    "wrappy": {
+      "version": "1.0.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/wrappy/-/wrappy-1.0.2.tgz",
+      "integrity": "sha1-tSQ9jz7BqjXxNkYFvA0QNuMKtp8="
+    },
+    "y18n": {
+      "version": "3.2.2",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/y18n/-/y18n-3.2.2.tgz",
+      "integrity": "sha512-uGZHXkHnhF0XeeAPgnKfPv1bgKAYyVvmNL1xlKsPYZPaIHxGti2hHqvOCQv71XMsLxu1QjergkqogUnms5D3YQ=="
+    },
+    "yargs": {
+      "version": "7.1.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/yargs/-/yargs-7.1.0.tgz",
+      "integrity": "sha1-a6MY6xaWFyf10oT46gA+jWFU0Mg=",
+      "requires": {
+        "camelcase": "^3.0.0",
+        "cliui": "^3.2.0",
+        "decamelize": "^1.1.1",
+        "get-caller-file": "^1.0.1",
+        "os-locale": "^1.4.0",
+        "read-pkg-up": "^1.0.1",
+        "require-directory": "^2.1.1",
+        "require-main-filename": "^1.0.1",
+        "set-blocking": "^2.0.0",
+        "string-width": "^1.0.2",
+        "which-module": "^1.0.0",
+        "y18n": "^3.2.1",
+        "yargs-parser": "^5.0.0"
+      }
+    },
+    "yargs-parser": {
+      "version": "5.0.1",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/yargs-parser/-/yargs-parser-5.0.1.tgz",
+      "integrity": "sha512-wpav5XYiddjXxirPoCTUPbqM0PXvJ9hiBMvuJgInvo4/lAOTZzUprArw17q2O1P2+GHhbBr18/iQwjL5Z9BqfA==",
+      "requires": {
+        "camelcase": "^3.0.0",
+        "object.assign": "^4.1.0"
+      }
+    },
+    "zip-stream": {
+      "version": "4.1.0",
+      "resolved": "https://repo.huaweicloud.com/repository/npm/zip-stream/-/zip-stream-4.1.0.tgz",
+      "integrity": "sha512-zshzwQW7gG7hjpBlgeQP9RuyPGNxvJdzR8SUM3QhxCnLjWN2E7j3dOvpeDcQoETfHx0urRS7EtmVToql7YpU4A==",
+      "requires": {
+        "archiver-utils": "^2.1.0",
+        "compress-commons": "^4.1.0",
+        "readable-stream": "^3.6.0"
+      }
+    }
+  }
+}
diff --git a/frameworks/com.ohos.permissionmanager/package.json b/frameworks/com.ohos.permissionmanager/package.json
index eff7afc86f02b7523b2a155f4c5c8198841011dd..e0cb99de987961be04f5d01d0b57db79120adaa9 100644
--- a/frameworks/com.ohos.permissionmanager/package.json
+++ b/frameworks/com.ohos.permissionmanager/package.json
@@ -1,18 +1,18 @@
-{
-	"license":"ISC",
-	"devDependencies":{},
-	"name":"permissionmanager",
-	"ohos":{
-		"org":"huawei",
-		"directoryLevel":"project",
-		"buildTool":"hvigor"
-	},
-	"description":"example description",
-	"repository":{},
-	"version":"1.0.0",
-	"dependencies":{
-		"@ohos/hvigor-ohos-plugin":"1.0.6",
-		"hypium":"^1.0.0",
-		"@ohos/hvigor":"1.0.6"
-	}
+{
+	"license":"ISC",
+	"devDependencies":{},
+	"name":"permissionmanager",
+	"ohos":{
+		"org":"huawei",
+		"directoryLevel":"project",
+		"buildTool":"hvigor"
+	},
+	"description":"example description",
+	"repository":{},
+	"version":"1.0.0",
+	"dependencies":{
+		"@ohos/hvigor-ohos-plugin":"1.0.6",
+		"hypium":"^1.0.0",
+		"@ohos/hvigor":"1.0.6"
+	}
 }
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/.gitignore b/frameworks/com.ohos.permissionmanager/permissionmanager/.gitignore
index 4f9a973815d0b5e49bc8547681a6b4bc7a178d12..16ad22851d8b327b59cf74d965ddae2598a56e11 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/.gitignore
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/.gitignore
@@ -1,3 +1,3 @@
-/node_modules
-/.preview
+/node_modules
+/.preview
 /build
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/build-profile.json5 b/frameworks/com.ohos.permissionmanager/permissionmanager/build-profile.json5
index 8d4191ee3893b90de4b15ff67cfce2e295b0609f..e4f8a47c03ef66b1bf9200814c5475fecbe6c25e 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/build-profile.json5
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/build-profile.json5
@@ -1,28 +1,28 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-{
-  "apiType": 'stageMode',
-  "buildOption": {
-  },
-  "targets": [
-    {
-      "name": "default",
-    },
-    {
-      "name": "ohosTest",
-    }
-  ]
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+{
+  "apiType": 'stageMode',
+  "buildOption": {
+  },
+  "targets": [
+    {
+      "name": "default",
+    },
+    {
+      "name": "ohosTest",
+    }
+  ]
 }
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/hvigorfile.js b/frameworks/com.ohos.permissionmanager/permissionmanager/hvigorfile.js
index d7720ee6a7aad5c617d1fd2f6fc8c87067bfa32c..fda93c709ee47976559e87a7d0c5c47ea7d5dd5c 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/hvigorfile.js
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/hvigorfile.js
@@ -1,2 +1,2 @@
-// Script for compiling build behavior. It is built in the build plug-in and cannot be modified currently.
-module.exports = require('@ohos/hvigor-ohos-plugin').hapTasks
+// Script for compiling build behavior. It is built in the build plug-in and cannot be modified currently.
+module.exports = require('@ohos/hvigor-ohos-plugin').hapTasks
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/package-lock.json b/frameworks/com.ohos.permissionmanager/permissionmanager/package-lock.json
index af634257bf3cf5c0ebedba056385bf0128ec7623..62d37a750fec9d2f36caa72b1a3326bd9144769f 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/package-lock.json
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/package-lock.json
@@ -1,5 +1,5 @@
-{
-  "name": "permissionmanager",
-  "version": "1.0.0",
-  "lockfileVersion": 1
-}
+{
+  "name": "permissionmanager",
+  "version": "1.0.0",
+  "lockfileVersion": 1
+}
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/package.json b/frameworks/com.ohos.permissionmanager/permissionmanager/package.json
index 980ccad2bde65ef3e13f50d37b9c6b8a3db99915..983c48aafa7e41fe0e586518ec78f7872abcc3fd 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/package.json
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/package.json
@@ -1,14 +1,14 @@
-{
-	"license": "ISC",
-	"devDependencies": {},
-	"name": "permissionmanager",
-	"ohos": {
-		"org": "huawei",
-		"directoryLevel": "module",
-		"buildTool": "hvigor"
-	},
-	"description": "example description",
-	"repository": {},
-	"version": "1.0.0",
-	"dependencies": {}
-}
+{
+	"license": "ISC",
+	"devDependencies": {},
+	"name": "permissionmanager",
+	"ohos": {
+		"org": "huawei",
+		"directoryLevel": "module",
+		"buildTool": "hvigor"
+	},
+	"description": "example description",
+	"repository": {},
+	"version": "1.0.0",
+	"dependencies": {}
+}
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/Application/AbilityStage.ts b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/Application/AbilityStage.ts
index c5840e536fb35e184dc92643ebfc9955d883353f..4219d854218edb7d81013b5fc6c14c48409b859a 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/Application/AbilityStage.ts
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/Application/AbilityStage.ts
@@ -1,24 +1,24 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-import AbilityStage from "@ohos.application.AbilityStage"
-
-var TAG = "PermissionManager_MainAbility:"
-
-export default class MyAbilityStage extends AbilityStage {
-    onCreate() {
-        console.log(TAG + "MyAbilityStage onCreate.")
-    }
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+import AbilityStage from "@ohos.application.AbilityStage"
+
+var TAG = "PermissionManager_MainAbility:"
+
+export default class MyAbilityStage extends AbilityStage {
+    onCreate() {
+        console.log(TAG + "MyAbilityStage onCreate.")
+    }
 }
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/MainAbility/MainAbility.ts b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/MainAbility/MainAbility.ts
index fd4781d8994a80e6069ddf8f28c477aaaa50c152..b5393843d039fb36b411c0903cf4575eedfc838c 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/MainAbility/MainAbility.ts
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/MainAbility/MainAbility.ts
@@ -1,55 +1,55 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-import Ability from '@ohos.application.Ability';
-
-var TAG = "PermissionManager_MainAbility:";
-
-export default class MainAbility extends Ability {
-    onCreate(want, launchParam) {
-        console.log(TAG + "MainAbility onCreate, ability name is " + want.abilityName + ".");
-        globalThis.context = this.context;
-    }
-
-    onWindowStageCreate(windowStage) {
-        // Main window is created, set main page for this ability
-        console.log(TAG + "MainAbility onWindowStageCreate.");
-
-        globalThis.context = this.context;
-
-        windowStage.setUIContent(this.context, "pages/authority-management", null);
-    }
-
-    onForeground() {
-        // Ability has brought to foreground
-        console.log(TAG + "MainAbility onForeground.");
-    }
-
-    onBackground() {
-        // Ability has back to background
-        console.log(TAG + "MainAbility onBackground.");
-
-//        this.context.terminateSelf();
-    }
-
-    onDestroy() {
-        console.log(TAG + "MainAbility onDestroy.");
-    }
-
-    onWindowStageDestroy() {
-        // Main window is destroyed, release UI related resources
-        console.log(TAG + "MainAbility onWindowStageDestroy.");
-    }
-};
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+import Ability from '@ohos.application.Ability';
+
+var TAG = "PermissionManager_MainAbility:";
+
+export default class MainAbility extends Ability {
+    onCreate(want, launchParam) {
+        console.log(TAG + "MainAbility onCreate, ability name is " + want.abilityName + ".");
+        globalThis.context = this.context;
+    }
+
+    onWindowStageCreate(windowStage) {
+        // Main window is created, set main page for this ability
+        console.log(TAG + "MainAbility onWindowStageCreate.");
+
+        globalThis.context = this.context;
+
+        windowStage.setUIContent(this.context, "pages/authority-management", null);
+    }
+
+    onForeground() {
+        // Ability has brought to foreground
+        console.log(TAG + "MainAbility onForeground.");
+    }
+
+    onBackground() {
+        // Ability has back to background
+        console.log(TAG + "MainAbility onBackground.");
+
+//        this.context.terminateSelf();
+    }
+
+    onDestroy() {
+        console.log(TAG + "MainAbility onDestroy.");
+    }
+
+    onWindowStageDestroy() {
+        // Main window is destroyed, release UI related resources
+        console.log(TAG + "MainAbility onWindowStageDestroy.");
+    }
+};
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/ServiceExtAbility/ServiceExtAbility.ts b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/ServiceExtAbility/ServiceExtAbility.ts
index bd3544ad7f8ddd4efd8512fcdcc29ce2dc07a5c8..52b4db3c546df1c4deb1f18155f7988430957b39 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/ServiceExtAbility/ServiceExtAbility.ts
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/ServiceExtAbility/ServiceExtAbility.ts
@@ -1,81 +1,81 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-import extension from '@ohos.application.ServiceExtensionAbility';
-import window from '@ohos.window';
-import display from '@ohos.display';
-
-var TAG = "PermissionManager_Log:";
-const MAX_WIDTH = 790;
-const MAX_HEIGHT = 1100;
-
-export default class ServiceExtensionAbility extends extension {
-    /**
-     * Lifecycle function, called back when a service extension is started for initialization.
-     */
-    onCreate(want) {
-        console.info(TAG + "ServiceExtensionAbility onCreate, ability name is " + want.abilityName);
-
-        globalThis.extensionContext = this.context;
-        globalThis.windowNum = 0
-    }
-
-    /**
-     * Lifecycle function, called back when a service extension is started or recall.
-     */
-    onRequest(want, startId) {
-        globalThis.abilityWant = want
-        console.info(TAG + "ServiceExtensionAbility onRequest. start id is " + startId);
-        console.info(TAG + "want: " + JSON.stringify(want))
-
-        display.getDefaultDisplay().then(dis => {
-            let navigationBarRect = {
-                left: (dis.width - MAX_WIDTH)/2,
-                top: (dis.height - MAX_HEIGHT)/2,
-                width: MAX_WIDTH,
-                height: MAX_HEIGHT
-            }
-            this.createWindow("permissionDialog" + startId, window.WindowType.TYPE_DIALOG, navigationBarRect)
-        })
-    }
-
-    /**
-     * Lifecycle function, called back before a service extension is destroyed.
-     */
-    onDestroy() {
-        console.info(TAG + "ServiceExtensionAbility onDestroy.");
-    }
-
-    private async createWindow(name: string, windowType: number, rect) {
-        console.info(TAG + "create window")
-        try {
-            const win = await window.create(globalThis.extensionContext, name, windowType)
-            globalThis.extensionWin = win
-            await win.bindDialogTarget(globalThis.abilityWant.parameters['ohos.ability.params.token'].value, () => {
-                win.destroy()
-                globalThis.windowNum --
-                if(globalThis.windowNum == 0) this.context.terminateSelf()
-            })
-            await win.moveTo(rect.left, rect.top)
-            await win.resetSize(rect.width, rect.height)
-            await win.loadContent('pages/dialogPlus')
-            await win.setBackgroundColor('#00000000')
-            await win.show()
-            globalThis.windowNum ++
-        } catch {
-            console.info(TAG + "window create failed!")
-        }
-    }
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+import extension from '@ohos.application.ServiceExtensionAbility';
+import window from '@ohos.window';
+import display from '@ohos.display';
+
+var TAG = "PermissionManager_Log:";
+const MAX_WIDTH = 790;
+const MAX_HEIGHT = 1100;
+
+export default class ServiceExtensionAbility extends extension {
+    /**
+     * Lifecycle function, called back when a service extension is started for initialization.
+     */
+    onCreate(want) {
+        console.info(TAG + "ServiceExtensionAbility onCreate, ability name is " + want.abilityName);
+
+        globalThis.extensionContext = this.context;
+        globalThis.windowNum = 0
+    }
+
+    /**
+     * Lifecycle function, called back when a service extension is started or recall.
+     */
+    onRequest(want, startId) {
+        globalThis.abilityWant = want
+        console.info(TAG + "ServiceExtensionAbility onRequest. start id is " + startId);
+        console.info(TAG + "want: " + JSON.stringify(want))
+
+        display.getDefaultDisplay().then(dis => {
+            let navigationBarRect = {
+                left: (dis.width - MAX_WIDTH)/2,
+                top: (dis.height - MAX_HEIGHT)/2,
+                width: MAX_WIDTH,
+                height: MAX_HEIGHT
+            }
+            this.createWindow("permissionDialog" + startId, window.WindowType.TYPE_DIALOG, navigationBarRect)
+        })
+    }
+
+    /**
+     * Lifecycle function, called back before a service extension is destroyed.
+     */
+    onDestroy() {
+        console.info(TAG + "ServiceExtensionAbility onDestroy.");
+    }
+
+    private async createWindow(name: string, windowType: number, rect) {
+        console.info(TAG + "create window")
+        try {
+            const win = await window.create(globalThis.extensionContext, name, windowType)
+            globalThis.extensionWin = win
+            await win.bindDialogTarget(globalThis.abilityWant.parameters['ohos.ability.params.token'].value, () => {
+                win.destroy()
+                globalThis.windowNum --
+                if(globalThis.windowNum == 0) this.context.terminateSelf()
+            })
+            await win.moveTo(rect.left, rect.top)
+            await win.resetSize(rect.width, rect.height)
+            await win.loadContent('pages/dialogPlus')
+            await win.setBackgroundColor('#00000000')
+            await win.show()
+            globalThis.windowNum ++
+        } catch {
+            console.info(TAG + "window create failed!")
+        }
+    }
 };
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/components/alphabeticalIndex.ets b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/components/alphabeticalIndex.ets
index a8270d1ee12efdd89d161aa4d2e22996c56c815d..faeca72072b5cdb19cb3cc6741d3e87e9ce32be6 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/components/alphabeticalIndex.ets
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/components/alphabeticalIndex.ets
@@ -1,77 +1,77 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-import Constants from '../utils/constant';
-
-@Component
-export struct alphabetIndexerComponent {
-  private value: string[] = [
-    '#',
-    'A',
-    'B',
-    'C',
-    'D',
-    'E',
-    'F',
-    'G',
-    'H',
-    'I',
-    'J',
-    'K',
-    'L',
-    'M',
-    'N',
-    'O',
-    'P',
-    'Q',
-    'R',
-    'S',
-    'T',
-    'U',
-    'V',
-    'W',
-    'X',
-    'Y',
-    'Z'
-  ]; // Array of alphabetically indexed names
-  @Link applicationItem: any; // application info array
-  @Link oldApplicationItem: any; // Original application information array
-  @State index: number = 0; // alphabetical index
-
-  build() {
-    AlphabetIndexer({ arrayValue: this.value, selected: this.index })
-      .selectedColor($r('app.color.selected_Color')) // selected color
-      .popupColor($r('app.color.popup_Color')) // popover color
-      .selectedBackgroundColor($r('app.color.selected_Background_Color')) // Check background color
-      .popupBackground($r('app.color.popup_Background_Color')) // popover background color
-      .usingPopup(true) // whether to show a popup
-      .selectedFont({ size: Constants.ALPHABETINDEXER_SELECTEDFONT_SIZE, weight: FontWeight.Bolder }) // selected style
-      .popupFont({ size: Constants.ALPHABETINDEXER_POPUPFONT_SIZE, weight: FontWeight.Bolder }) // Demo of the popup
-      .itemSize(Constants.ALPHABETINDEXER_ITEMSIZE) // size square of each item
-      .alignStyle(IndexerAlign.Left) // Align left
-      .onSelected((index: number) => {
-        this.index = index;
-        if (this.value[index] === '#' || this.value[index] === '☆') {
-          this.applicationItem = this.oldApplicationItem;
-        } else {
-          this.applicationItem = this.oldApplicationItem.filter((item) => {
-            return item.alphabeticalIndex.toUpperCase() === this.value[index];
-          })
-        }
-      })
-      .height(Constants.ALPHABETINDEXER_HEIGHT)
-      .width(Constants.ALPHABETINDEXER_WIDTH)
-  }
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+import Constants from '../utils/constant';
+
+@Component
+export struct alphabetIndexerComponent {
+  private value: string[] = [
+    '#',
+    'A',
+    'B',
+    'C',
+    'D',
+    'E',
+    'F',
+    'G',
+    'H',
+    'I',
+    'J',
+    'K',
+    'L',
+    'M',
+    'N',
+    'O',
+    'P',
+    'Q',
+    'R',
+    'S',
+    'T',
+    'U',
+    'V',
+    'W',
+    'X',
+    'Y',
+    'Z'
+  ]; // Array of alphabetically indexed names
+  @Link applicationItem: any; // application info array
+  @Link oldApplicationItem: any; // Original application information array
+  @State index: number = 0; // alphabetical index
+
+  build() {
+    AlphabetIndexer({ arrayValue: this.value, selected: this.index })
+      .selectedColor($r('app.color.selected_Color')) // selected color
+      .popupColor($r('app.color.popup_Color')) // popover color
+      .selectedBackgroundColor($r('app.color.selected_Background_Color')) // Check background color
+      .popupBackground($r('app.color.popup_Background_Color')) // popover background color
+      .usingPopup(true) // whether to show a popup
+      .selectedFont({ size: Constants.ALPHABETINDEXER_SELECTEDFONT_SIZE, weight: FontWeight.Bolder }) // selected style
+      .popupFont({ size: Constants.ALPHABETINDEXER_POPUPFONT_SIZE, weight: FontWeight.Bolder }) // Demo of the popup
+      .itemSize(Constants.ALPHABETINDEXER_ITEMSIZE) // size square of each item
+      .alignStyle(IndexerAlign.Left) // Align left
+      .onSelected((index: number) => {
+        this.index = index;
+        if (this.value[index] === '#' || this.value[index] === '☆') {
+          this.applicationItem = this.oldApplicationItem;
+        } else {
+          this.applicationItem = this.oldApplicationItem.filter((item) => {
+            return item.alphabeticalIndex.toUpperCase() === this.value[index];
+          })
+        }
+      })
+      .height(Constants.ALPHABETINDEXER_HEIGHT)
+      .width(Constants.ALPHABETINDEXER_WIDTH)
+  }
 }
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/components/backBar.ets b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/components/backBar.ets
index 8145d91d70bc59cb672b42667540d3cdbb96ac11..7843f1524820e9bb8b5f1b0e4fea87e4dd0aee9b 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/components/backBar.ets
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/components/backBar.ets
@@ -1,78 +1,78 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-import router from '@system.router';
-import Resmgr from '@ohos.resourceManager'
-import Constants from '../utils/constant';
-
-@Component
-export struct backBar {
-  @Prop title: string; // return title name
-  @Prop recordable: boolean
-  @State record: string = ''
-
-  build() {
-    Column() {
-      Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
-        Image($r('app.media.left'))
-          .objectFit(ImageFit.Contain)
-          .height(Constants.BACKBAR_IMAGE_HEIGHT)
-          .width(Constants.BACKBAR_IMAGE_WIDTH)
-          .margin({
-            top: Constants.BACKBAR_IMAGE_MARGIN_TOP,
-            left: Constants.BACKBAR_IMAGE_MARGIN_LEFT,
-            right: Constants.BACKBAR_IMAGE_MARGIN_RIGHT
-          })
-          .onClick(() => {
-            var length = router.getLength()
-            Number(length) == 1 ? globalThis.context.terminateSelf() : router.back()
-          })
-        Text(JSON.parse(this.title))
-          .fontColor($r('app.color.text_color'))
-          .fontSize(Constants.BACKBAR_TEXT_FONT_SIZE)
-          .flexGrow(Constants.BACKBAR_TEXT_FLEX_GROW)
-          .fontWeight(FontWeight.Bold)
-          .margin({ top: Constants.BACKBAR_TEXT_MARGIN_TOP })
-        if(this.recordable) {
-          Image($r("app.media.gongneng_dian"))
-            .objectFit(ImageFit.Contain)
-            .height(Constants.BACKBAR_IMAGE_HEIGHT)
-            .width(Constants.BACKBAR_IMAGE_WIDTH)
-            .margin({ top: Constants.BACKBAR_TEXT_MARGIN_TOP, right: Constants.BACKBAR_IMAGE_MARGIN_RIGHT })
-            .bindMenu([
-              {
-                value: this.record,
-                action: () => {
-                  router.push({ uri: 'pages/permission-access-record' })
-                }
-              }
-            ])
-        }
-      }
-    }
-    .height(Constants.BACKBAR_HEIGHT)
-    .constraintSize({ minHeight: Constants.BACKBAR_MINHEIGHT })
-    .alignItems(HorizontalAlign.Start)
-    .backgroundColor($r('app.color.background_color'))
-  }
-
-  aboutToAppear() {
-    Resmgr.getResourceManager(globalThis.context, Constants.BUNDLE_NAME).then(item => {
-      item.getString($r("app.string.permission_access_record").id, (err, val) => {
-        this.record = val
-      })
-    })
-  }
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+import router from '@system.router';
+import Resmgr from '@ohos.resourceManager'
+import Constants from '../utils/constant';
+
+@Component
+export struct backBar {
+  @Prop title: string; // return title name
+  @Prop recordable: boolean
+  @State record: string = ''
+
+  build() {
+    Column() {
+      Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
+        Image($r('app.media.left'))
+          .objectFit(ImageFit.Contain)
+          .height(Constants.BACKBAR_IMAGE_HEIGHT)
+          .width(Constants.BACKBAR_IMAGE_WIDTH)
+          .margin({
+            top: Constants.BACKBAR_IMAGE_MARGIN_TOP,
+            left: Constants.BACKBAR_IMAGE_MARGIN_LEFT,
+            right: Constants.BACKBAR_IMAGE_MARGIN_RIGHT
+          })
+          .onClick(() => {
+            var length = router.getLength()
+            Number(length) == 1 ? globalThis.context.terminateSelf() : router.back()
+          })
+        Text(JSON.parse(this.title))
+          .fontColor($r('app.color.text_color'))
+          .fontSize(Constants.BACKBAR_TEXT_FONT_SIZE)
+          .flexGrow(Constants.BACKBAR_TEXT_FLEX_GROW)
+          .fontWeight(FontWeight.Bold)
+          .margin({ top: Constants.BACKBAR_TEXT_MARGIN_TOP })
+        if(this.recordable) {
+          Image($r("app.media.gongneng_dian"))
+            .objectFit(ImageFit.Contain)
+            .height(Constants.BACKBAR_IMAGE_HEIGHT)
+            .width(Constants.BACKBAR_IMAGE_WIDTH)
+            .margin({ top: Constants.BACKBAR_TEXT_MARGIN_TOP, right: Constants.BACKBAR_IMAGE_MARGIN_RIGHT })
+            .bindMenu([
+              {
+                value: this.record,
+                action: () => {
+                  router.push({ uri: 'pages/permission-access-record' })
+                }
+              }
+            ])
+        }
+      }
+    }
+    .height(Constants.BACKBAR_HEIGHT)
+    .constraintSize({ minHeight: Constants.BACKBAR_MINHEIGHT })
+    .alignItems(HorizontalAlign.Start)
+    .backgroundColor($r('app.color.background_color'))
+  }
+
+  aboutToAppear() {
+    Resmgr.getResourceManager(globalThis.context, Constants.BUNDLE_NAME).then(item => {
+      item.getString($r("app.string.permission_access_record").id, (err, val) => {
+        this.record = val
+      })
+    })
+  }
 }
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/components/dialog.ets b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/components/dialog.ets
index 8e86dd6ab1ad56d5e7c698305ad2f8ea837d2cd5..bea633677a98a939b993e02046dbbcdb8c78e3dc 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/components/dialog.ets
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/components/dialog.ets
@@ -1,40 +1,40 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-import Constants from '../utils/constant';
-
-@CustomDialog
-export struct authorizeDialog {
-  controller: CustomDialogController;
-  cancel: () => void;
-  confirm: () => void;
-
-  build() {
-    Column() {
-      Row() {
-        Flex({ justifyContent: FlexAlign.Center }) {
-          Text($r("app.string.Authorization_failed")).fontSize(Constants.DIALOG_TEXT_FONT_SIZE)
-            .margin({
-              top: Constants.DIALOG_TEXT_MARGIN_TOP
-            })
-        }
-      }
-    }
-    .backgroundColor($r('app.color.default_background_color'))
-    .borderRadius(Constants.DIALOG_BORDER_RADIUS)
-    .height(Constants.DIALOG_HEIGHT)
-    .width(Constants.DIALOG_WIDTH)
-  }
-}
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+import Constants from '../utils/constant';
+
+@CustomDialog
+export struct authorizeDialog {
+  controller: CustomDialogController;
+  cancel: () => void;
+  confirm: () => void;
+
+  build() {
+    Column() {
+      Row() {
+        Flex({ justifyContent: FlexAlign.Center }) {
+          Text($r("app.string.Authorization_failed")).fontSize(Constants.DIALOG_TEXT_FONT_SIZE)
+            .margin({
+              top: Constants.DIALOG_TEXT_MARGIN_TOP
+            })
+        }
+      }
+    }
+    .backgroundColor($r('app.color.default_background_color'))
+    .borderRadius(Constants.DIALOG_BORDER_RADIUS)
+    .height(Constants.DIALOG_HEIGHT)
+    .width(Constants.DIALOG_WIDTH)
+  }
+}
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/components/search.ets b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/components/search.ets
index 72fa15f01bfa0dbac97bf193e78dcf42c5faae38..12b040e6876eab06eda6ab8a0b38bf81f7d7609a 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/components/search.ets
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/components/search.ets
@@ -1,63 +1,63 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-import Constants from '../utils/constant';
-
-@Component
-export struct textInput {
-  @Prop placeholder: string; // Prompt text when no input
-  @Link applicationItem: any; // application info array
-  @Link oldApplicationItem: any; // Original application information array
-  @Link searchResult: boolean; // search results
-
-  build() {
-    Column() {
-      Flex({ alignContent: FlexAlign.Start }) {
-        TextInput({ placeholder: this.placeholder })
-          .backgroundColor($r('app.color.default_background_color'))
-          .padding({ left: Constants.TEXTINPUT_PADDING_LEFT })
-          .type(InputType.Normal)
-          .border({ width: Constants.TEXTINPUT_BORDER_WIDTH, color: $r("app.color.label_color_20"), radius: Constants.TEXTINPUT_BORDER_RADIUS })
-          .placeholderColor(Color.Grey)
-          .placeholderFont({ size: Constants.TEXTINPUT_PLACEHOLDER_Font_SIZE, weight: FontWeight.Normal, family: "sans-serif", style: FontStyle.Normal })
-          .caretColor($r('app.color.secondary_font_color'))
-          .height(Constants.TEXTINPUT_HEIGHT)
-          .onChange((value: string) => {
-            if (value === '' || value === null) {
-              this.applicationItem = this.oldApplicationItem;
-            } else {
-              this.applicationItem = this.oldApplicationItem.filter((item) => {
-                  return item.labelId.indexOf(value) > -1;
-              })
-            }
-            if (this.applicationItem.length) {
-              this.searchResult = true;
-            } else {
-              this.searchResult = false;
-            }
-          })
-          .onSubmit((enterKey) => {
-          })
-          .onEditChanged((isEditing) => {
-          })
-        Image($r('app.media.search'))
-          .objectFit(ImageFit.Contain)
-          .width(Constants.TEXTINPUT_IMAGE_WIDTH)
-          .height(Constants.TEXTINPUT_IMAGE_HEIGHT)
-          .position({ x: Constants.TEXTINPUT_IMAGE_MARGIN_LEFT, y: Constants.TEXTINPUT_IMAGE_MARGIN_TOP })
-      }
-    }
-  }
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+import Constants from '../utils/constant';
+
+@Component
+export struct textInput {
+  @Prop placeholder: string; // Prompt text when no input
+  @Link applicationItem: any; // application info array
+  @Link oldApplicationItem: any; // Original application information array
+  @Link searchResult: boolean; // search results
+
+  build() {
+    Column() {
+      Flex({ alignContent: FlexAlign.Start }) {
+        TextInput({ placeholder: this.placeholder })
+          .backgroundColor($r('app.color.default_background_color'))
+          .padding({ left: Constants.TEXTINPUT_PADDING_LEFT })
+          .type(InputType.Normal)
+          .border({ width: Constants.TEXTINPUT_BORDER_WIDTH, color: $r("app.color.label_color_20"), radius: Constants.TEXTINPUT_BORDER_RADIUS })
+          .placeholderColor(Color.Grey)
+          .placeholderFont({ size: Constants.TEXTINPUT_PLACEHOLDER_Font_SIZE, weight: FontWeight.Normal, family: "sans-serif", style: FontStyle.Normal })
+          .caretColor($r('app.color.secondary_font_color'))
+          .height(Constants.TEXTINPUT_HEIGHT)
+          .onChange((value: string) => {
+            if (value === '' || value === null) {
+              this.applicationItem = this.oldApplicationItem;
+            } else {
+              this.applicationItem = this.oldApplicationItem.filter((item) => {
+                  return item.labelId.indexOf(value) > -1;
+              })
+            }
+            if (this.applicationItem.length) {
+              this.searchResult = true;
+            } else {
+              this.searchResult = false;
+            }
+          })
+          .onSubmit((enterKey) => {
+          })
+          .onEditChanged((isEditing) => {
+          })
+        Image($r('app.media.search'))
+          .objectFit(ImageFit.Contain)
+          .width(Constants.TEXTINPUT_IMAGE_WIDTH)
+          .height(Constants.TEXTINPUT_IMAGE_HEIGHT)
+          .position({ x: Constants.TEXTINPUT_IMAGE_MARGIN_LEFT, y: Constants.TEXTINPUT_IMAGE_MARGIN_TOP })
+      }
+    }
+  }
 }
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/model/bundle.ets b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/model/bundle.ets
index d5f38e35e9918ee78175da6496c42bc6731bfd81..048e97f51ce1ccadc37656c5e60aa23be24127e3 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/model/bundle.ets
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/model/bundle.ets
@@ -1,38 +1,38 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-export const BundleFlag = {
-  GET_BUNDLE_DEFAULT : 0x00000000,
-  GET_BUNDLE_WITH_ABILITIES : 0x00000001,
-  GET_ABILITY_INFO_WITH_PERMISSION : 0x00000002,
-  GET_ABILITY_INFO_WITH_APPLICATION : 0x00000004,
-  GET_APPLICATION_INFO_WITH_PERMISSION : 0x00000008,
-  GET_BUNDLE_WITH_REQUESTED_PERMISSION : 0x00000010,
-  GET_ALL_APPLICATION_INFO : 0xFFFF0000,
-  /**
-      * @since 8
-      */
-  GET_ABILITY_INFO_WITH_METADATA : 0x00000020,
-  /**
-      * @since 8
-      */
-  GET_APPLICATION_INFO_WITH_METADATA : 0x00000040,
-  /**
-      * @since 8
-      */
-  GET_ABILITY_INFO_SYSTEMAPP_ONLY : 0x00000080
-}
-
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+export const BundleFlag = {
+  GET_BUNDLE_DEFAULT : 0x00000000,
+  GET_BUNDLE_WITH_ABILITIES : 0x00000001,
+  GET_ABILITY_INFO_WITH_PERMISSION : 0x00000002,
+  GET_ABILITY_INFO_WITH_APPLICATION : 0x00000004,
+  GET_APPLICATION_INFO_WITH_PERMISSION : 0x00000008,
+  GET_BUNDLE_WITH_REQUESTED_PERMISSION : 0x00000010,
+  GET_ALL_APPLICATION_INFO : 0xFFFF0000,
+  /**
+      * @since 8
+      */
+  GET_ABILITY_INFO_WITH_METADATA : 0x00000020,
+  /**
+      * @since 8
+      */
+  GET_APPLICATION_INFO_WITH_METADATA : 0x00000040,
+  /**
+      * @since 8
+      */
+  GET_ABILITY_INFO_SYSTEMAPP_ONLY : 0x00000080
+}
+
 export const USER_ID: number = 100
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/model/permissionGroup.ets b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/model/permissionGroup.ets
index d389c6b59f9cc339205b910b8fc957995fc4ae3f..a7175818a3d2bc690120268536997d6df0136a3a 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/model/permissionGroup.ets
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/model/permissionGroup.ets
@@ -1,512 +1,512 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-export const permissionGroups: any[] = [
-    {
-        "permissionName": "ohos.permission.LOCATION_IN_BACKGROUND",
-        "groupName": "LOCATION",
-        "label": "后台定位权限",
-        "description": "允许应用在后台运行时获取位置信息。",
-        "groupId": 0
-    },
-    {
-        "permissionName": "ohos.permission.LOCATION",
-        "groupName": "LOCATION",
-        "label": "前台定位权限",
-        "description": "允许应用在前台运行时获取位置信息。",
-        "groupId": 0
-    },
-    {
-        "permissionName": "ohos.permission.CAMERA",
-        "groupName": "CAMERA",
-        "label": "拍摄照片和录制视频",
-        "description": "允许应用拍摄照片和视频。",
-        "groupId": 1
-    },
-    {
-        "permissionName": "ohos.permission.MICROPHONE",
-        "groupName": "MICROPHONE",
-        "label": "录制音频",
-        "description": "允许应用打开或关闭录音通路。",
-        "groupId": 2
-    },
-    {
-        "permissionName": "ohos.permission.ANSWER_CALL",
-        "groupName": "PHONE",
-        "label": "接听电话",
-        "description": "允许应用接听电话。",
-        "groupId": 3
-    },
-    {
-        "permissionName": "ohos.permission.MANAGE_VOICEMAIL",
-        "groupName": "PHONE",
-        "label": "语音信箱",
-        "description": "允许应用管理语音信箱。",
-        "groupId": 3
-    },
-    {
-        "permissionName": "ohos.permission.READ_CELL_MESSAGES",
-        "groupName": "SMS",
-        "label": "读取小区广播",
-        "description": "允许应用读取设备接收的小区广播信息。",
-        "groupId": 4
-    },
-    {
-        "permissionName": "ohos.permission.READ_MESSAGES",
-        "groupName": "SMS",
-        "label": "读取短彩信",
-        "description": "允许应用读取设备接收的短彩信信息。",
-        "groupId": 4
-    },
-    {
-        "permissionName": "ohos.permission.RECEIVE_MMS",
-        "groupName": "SMS",
-        "label": "接收彩信",
-        "description": "允许应用接收彩信。",
-        "groupId": 4
-    },
-    {
-        "permissionName": "ohos.permission.RECEIVE_SMS",
-        "groupName": "SMS",
-        "label": "接收短信",
-        "description": "允许应用接收短信。",
-        "groupId": 4
-    },
-    {
-        "permissionName": "ohos.permission.RECEIVE_WAP_MESSAGES",
-        "groupName": "SMS",
-        "label": "接收WAP消息",
-        "description": "允许应用接收和处理WAP消息。",
-        "groupId": 4
-    },
-    {
-        "permissionName": "ohos.permission.SEND_MESSAGES",
-        "groupName": "SMS",
-        "label": "发送短彩信",
-        "description": "允许应用发送短彩信",
-        "groupId": 4
-    },
-    {
-        "permissionName": "ohos.permission.READ_CONTACTS",
-        "groupName": "CONTACTS",
-        "label": "读取通讯录",
-        "description": "允许应用读取设备上存储的联系人信息。",
-        "groupId": 5
-    },
-    {
-        "permissionName": "ohos.permission.WRITE_CONTACTS",
-        "groupName": "CONTACTS",
-        "label": "新建/修改/删除通讯录",
-        "description": "允许应用新建/修改/删除设备上存储的联系人信息。",
-        "groupId": 5
-    },
-    {
-        "permissionName": "ohos.permission.READ_CALL_LOG",
-        "groupName": "CALL_LOG",
-        "label": "读取通话记录",
-        "description": "允许应用读取设备上的通话记录信息。",
-        "groupId": 6
-    },
-    {
-        "permissionName": "ohos.permission.WRITE_CALL_LOG",
-        "groupName": "CALL_LOG",
-        "label": "新建/修改/删除通话记录",
-        "description": "允许新建/修改/删除设备上的通话记录信息。",
-        "groupId": 6
-    },
-    {
-        "permissionName": "ohos.permission.MEDIA_LOCATION",
-        "groupName": "MEDIA",
-        "label": "允许应用访问拍摄位置",
-        "description": "应用访问用户媒体文件中的拍摄位置信息如经纬度信息。",
-        "groupId": 7
-    },
-    {
-        "permissionName": "ohos.permission.READ_MEDIA",
-        "groupName": "MEDIA",
-        "label": "允许应用读取媒体文件",
-        "description": "允许应用访问户媒体文件，如视频、音频、图片等。",
-        "groupId": 7
-    },
-    {
-        "permissionName": "ohos.permission.WRITE_MEDIA",
-        "groupName": "MEDIA",
-        "label": "允许应用读写媒体文件",
-        "description": "允许应用读写户媒体文件，如视频、音频、图片等。",
-        "groupId": 7
-    },
-    {
-        "permissionName": "ohos.permission.READ_CALENDAR",
-        "groupName": "CALENDAR",
-        "label": "读取日历",
-        "description": "允许应用读取日历。",
-        "groupId": 8
-    },
-    {
-        "permissionName": "ohos.permission.WRITE_CALENDAR",
-        "groupName": "CALENDAR",
-        "label": "新建/修改/删除日历",
-        "description": "允许应用新建/修改/删除日历。",
-        "groupId": 8
-    },
-    {
-        "permissionName": "ohos.permission.ACTIVITY_MOTION",
-        "groupName": "SPORT",
-        "label": "读取用户的运动状态",
-        "description": "允许应用程序读取用户的运动状态。",
-        "groupId": 9
-    },
-    {
-        "permissionName": "ohos.permission.READ_HEALTH_DATA",
-        "groupName": "HEALTH",
-        "label": "读取用户的健康数据",
-        "description": "允许应用程序读取用户的健康数据。",
-        "groupId": 10
-    },
-    {
-        "permissionName": "ohos.permission.DISTRIBUTED_DATASYNC",
-        "groupName": "OTHER",
-        "icon": $r("app.media.ic_multi_device_vector"),
-        "text": "使用多设备协同？",
-        "label": "多设备协同",
-        "description": "发现并访问其他设备。",
-        "groupId": 11
-    }
-]
-
-export const groups: any[] = [
-    {
-        "name": "LOCATION",
-        "groupName": "位置信息",
-        "icon": $r('app.media.ic_public_gps'),
-        "description": "",
-	      "label": "访问位置信息？",
-        "permissions": [
-            "ohos.permission.LOCATION_IN_BACKGROUND",
-            "ohos.permission.LOCATION"
-        ],
-        "isShow":true
-    },
-    {
-        "name": "CAMERA",
-        "groupName": "相机",
-        "icon": $r('app.media.ic_public_camera'),
-	      "label": "使用相机？",
-        "description": "",
-        "permissions": [
-            "ohos.permission.CAMERA"
-        ],
-        "isShow":true
-    },
-    {
-        "name": "MICROPHONE",
-        "groupName": "麦克风",
-        "icon": $r('app.media.ic_public_voice'),
-	      "label": "使用麦克风？",
-        "description": "",
-        "permissions": [
-            "ohos.permission.MICROPHONE"
-        ],
-        "isShow":true
-    },
-    {
-        "name": "PHONE",
-        "groupName": "电话",
-        "icon": $r('app.media.ic_public_phone'),
-	      "label": "使用拨打电话？",
-        "description": "",
-        "permissions": [
-            "ohos.permission.ANSWER_CALL",
-            "ohos.permission.MANAGE_VOICEMAIL"
-        ],
-        "isShow":false
-    },
-    {
-        "name": "SMS",
-        "groupName": "信息",
-        "icon": $r('app.media.ic_public_message'),
-        "label": "访问信息？",
-	      "description": "",
-        "permissions": [
-            "ohos.permission.READ_CELL_MESSAGES",
-            "ohos.permission.READ_MESSAGES",
-            "ohos.permission.RECEIVE_MMS",
-            "ohos.permission.RECEIVE_SMS",
-            "ohos.permission.RECEIVE_WAP_MESSAGES",
-            "ohos.permission.SEND_MESSAGES"
-        ],
-        "isShow":false
-    },
-    {
-        "name": "CONTACTS",
-        "groupName": "通讯录",
-        "icon": $r('app.media.ic_public_contacts_group'),
-        "label": "访问通讯录？",
-	      "description": "",
-        "permissions": [
-            "ohos.permission.READ_CONTACTS",
-            "ohos.permission.WRITE_CONTACTS"
-        ],
-        "isShow":false
-    },
-    {
-        "name": "CALL_LOG",
-        "groupName": "通话记录",
-        "icon": $r('app.media.ic_call_logs'),
-	      "label": "访问通话记录？",
-	      "description": "",
-        "permissions": [
-            "ohos.permission.READ_CALL_LOG",
-            "ohos.permission.WRITE_CALL_LOG"
-        ],
-        "isShow":false
-    },
-    {
-        "name": "MEDIA",
-        "groupName": "媒体和文件",
-        "icon": $r('app.media.ic_public_folder'),
-        "description": "",
-	      "label": "访问媒体和文件？",
-        "permissions": [
-            "ohos.permission.MEDIA_LOCATION",
-            "ohos.permission.READ_MEDIA",
-            "ohos.permission.WRITE_MEDIA"
-        ],
-        "isShow":true
-    },
-    {
-        "name": "CALENDAR",
-        "groupName": "日历",
-        "icon": $r('app.media.ic_public_calendar'),
-        "label": "访问日历？",
-	      "description": "",
-        "permissions": [
-            "ohos.permission.READ_CALENDAR",
-            "ohos.permission.WRITE_CALENDAR"
-        ],
-        "isShow":true
-    },
-    {
-        "name": "SPORT",
-        "groupName": "健身运动",
-        "icon": $r('app.media.ic_sport'),
-	      "label": "访问健身运动？",
-        "description": "",
-        "permissions": [
-            "ohos.permission.ACTIVITY_MOTION"
-        ],
-        "isShow":true
-    },
-    {
-        "name": "HEALTH",
-        "groupName": "身体传感器",
-        "icon": $r('app.media.ic_ssensor'),
-	      "label": "使用身体传感器？",
-        "description": "",
-        "permissions": [
-            "ohos.permission.READ_HEALTH_DATA"
-        ],
-        "isShow":true
-    },
-    {
-        "name": "OTHER",
-        "groupName": "其他权限",
-        "icon": $r('app.media.ic_more'),
-        "description": "",
-        "permissions": [
-            "ohos.permission.DISTRIBUTED_DATASYNC"
-        ],
-        "isShow":false
-    }
-];
-
-export const permissionGroupPermissions: object = {
-    "LOCATION": [
-        "ohos.permission.LOCATION_IN_BACKGROUND",
-        "ohos.permission.LOCATION"
-    ],
-    "CAMERA": [
-        "ohos.permission.CAMERA"
-    ],
-    "MICROPHONE": [
-        "ohos.permission.MICROPHONE"
-    ],
-    "PHONE": [
-        "ohos.permission.ANSWER_CALL",
-        "ohos.permission.MANAGE_VOICEMAIL"
-    ],
-    "SMS": [
-        "ohos.permission.READ_CELL_MESSAGES",
-        "ohos.permission.READ_MESSAGES",
-        "ohos.permission.RECEIVE_MMS",
-        "ohos.permission.RECEIVE_SMS",
-        "ohos.permission.RECEIVE_WAP_MESSAGES",
-        "ohos.permission.SEND_MESSAGES"
-    ],
-    "CONTACTS": [
-        "ohos.permission.READ_CONTACTS",
-        "ohos.permission.WRITE_CONTACTS"
-    ],
-    "CALL_LOG": [
-        "ohos.permission.READ_CALL_LOG",
-        "ohos.permission.WRITE_CALL_LOG"
-    ],
-    "MEDIA": [
-        "ohos.permission.MEDIA_LOCATION",
-        "ohos.permission.READ_MEDIA",
-        "ohos.permission.WRITE_MEDIA"
-    ],
-    "CALENDAR": [
-        "ohos.permission.READ_CALENDAR",
-        "ohos.permission.WRITE_CALENDAR"
-    ],
-    "SPORT": [
-        "ohos.permission.ACTIVITY_MOTION"
-    ],
-    "HEALTH": [
-        "ohos.permission.READ_HEALTH_DATA"
-    ],
-    "OTHER": [
-        "ohos.permission.DISTRIBUTED_DATASYNC"
-    ]
-};
-
-
-export const userGrantPermissions: string[] = [
-    "ohos.permission.LOCATION_IN_BACKGROUND",
-    "ohos.permission.LOCATION",
-    "ohos.permission.CAMERA",
-    "ohos.permission.MICROPHONE",
-    "ohos.permission.ANSWER_CALL",
-    "ohos.permission.MANAGE_VOICEMAIL",
-    "ohos.permission.READ_CELL_MESSAGES",
-    "ohos.permission.READ_MESSAGES",
-    "ohos.permission.RECEIVE_MMS",
-    "ohos.permission.RECEIVE_SMS",
-    "ohos.permission.RECEIVE_WAP_MESSAGES",
-    "ohos.permission.SEND_MESSAGES",
-    "ohos.permission.READ_CONTACTS",
-    "ohos.permission.WRITE_CONTACTS",
-    "ohos.permission.READ_CALL_LOG",
-    "ohos.permission.WRITE_CALL_LOG",
-    "ohos.permission.MEDIA_LOCATION",
-    "ohos.permission.READ_MEDIA",
-    "ohos.permission.WRITE_MEDIA",
-    "ohos.permission.READ_CALENDAR",
-    "ohos.permission.WRITE_CALENDAR",
-    "ohos.permission.ACTIVITY_MOTION",
-    "ohos.permission.READ_HEALTH_DATA",
-    "ohos.permission.DISTRIBUTED_DATASYNC"
-];
-
-export const permissionDescriptions: object = {
-    "位置信息": "允许应用在后台运行时获取位置信息。" ,
-    "相机": "允许应用拍摄照片和视频。" ,
-    "麦克风": "允许应用打开或关闭录音通路。" ,
-    "电话": "允许应用接听电话。" ,
-    "信息": "允许应用发送短彩信。" ,
-    "通讯录": "允许应用新建/修改/删除设备上存储的联系人信息。" ,
-    "通话记录": "允许新建/修改/删除设备上的通话记录信息。" ,
-    "媒体和文件": "允许应用访问户媒体文件，如视频、音频、图片等。" ,
-    "日历": "允许应用新建/修改/删除日历。" ,
-    "健身运动": "允许应用程序读取用户的运动状态。" ,
-    "身体传感器": "允许应用程序读取用户的健康数据。" ,
-    "其他权限": "允许应用与远程设备交换用户数据（如图片、音乐、视频、及应用数据等）。"
-};
-
-export const permissionPermissionGroup: object = {
-    "ohos.permission.LOCATION_IN_BACKGROUND": "LOCATION",
-    "ohos.permission.LOCATION": "LOCATION",
-    "ohos.permission.CAMERA": "CAMERA",
-    "ohos.permission.MICROPHONE": "MICROPHONE",
-    "ohos.permission.ANSWER_CALL": "PHONE",
-    "ohos.permission.MANAGE_VOICEMAIL": "PHONE",
-    "ohos.permission.READ_CELL_MESSAGES": "SMS",
-    "ohos.permission.READ_MESSAGES": "SMS",
-    "ohos.permission.RECEIVE_MMS": "SMS",
-    "ohos.permission.RECEIVE_SMS": "SMS",
-    "ohos.permission.RECEIVE_WAP_MESSAGES": "SMS",
-    "ohos.permission.SEND_MESSAGES": "SMS",
-    "ohos.permission.READ_CONTACTS": "CONTACTS",
-    "ohos.permission.WRITE_CONTACTS": "CONTACTS",
-    "ohos.permission.READ_CALL_LOG": "CALL_LOG",
-    "ohos.permission.WRITE_CALL_LOG": "CALL_LOG",
-    "ohos.permission.MEDIA_LOCATION": "MEDIA",
-    "ohos.permission.READ_MEDIA": "MEDIA",
-    "ohos.permission.WRITE_MEDIA": "MEDIA",
-    "ohos.permission.READ_CALENDAR": "CALENDAR",
-    "ohos.permission.WRITE_CALENDAR": "CALENDAR",
-    "ohos.permission.ACTIVITY_MOTION": "SPORT",
-    "ohos.permission.READ_HEALTH_DATA": "HEALTH",
-    "ohos.permission.DISTRIBUTED_DATASYNC": "OTHER"
-};
-
-export const permissionGroupIds: object = {
-    "ohos.permission.LOCATION_IN_BACKGROUND": "0",
-    "ohos.permission.LOCATION": "0",
-    "ohos.permission.CAMERA": "1",
-    "ohos.permission.MICROPHONE": "2",
-    "ohos.permission.ANSWER_CALL": "3",
-    "ohos.permission.MANAGE_VOICEMAIL": "3",
-    "ohos.permission.READ_CELL_MESSAGES": "4",
-    "ohos.permission.READ_MESSAGES": "4",
-    "ohos.permission.RECEIVE_MMS": "4",
-    "ohos.permission.RECEIVE_SMS": "4",
-    "ohos.permission.RECEIVE_WAP_MESSAGES": "4",
-    "ohos.permission.SEND_MESSAGES": "4",
-    "ohos.permission.READ_CONTACTS": "5",
-    "ohos.permission.WRITE_CONTACTS": "5",
-    "ohos.permission.READ_CALL_LOG": "6",
-    "ohos.permission.WRITE_CALL_LOG": "6",
-    "ohos.permission.MEDIA_LOCATION": "7",
-    "ohos.permission.READ_MEDIA": "7",
-    "ohos.permission.WRITE_MEDIA": "7",
-    "ohos.permission.READ_CALENDAR": "8",
-    "ohos.permission.WRITE_CALENDAR": "8",
-    "ohos.permission.ACTIVITY_MOTION": "9",
-    "ohos.permission.READ_HEALTH_DATA": "10",
-    "ohos.permission.DISTRIBUTED_DATASYNC": "11"
-};
-
-export const orderGroup: string[] = [
-    "位置信息",
-    "相机",
-    "麦克风",
-    "电话",
-    "信息",
-    "通讯录",
-    "通话记录",
-    "媒体和文件",
-    "日历",
-    "健身运动",
-    "身体传感器",
-    "其他权限"
-];
-
-export const otherPermissionsLabel: object = {
-    "ohos.permission.DISTRIBUTED_DATASYNC": "多设备协同"
-};
-
-export const noNeedDisplayApp: string[] = [
-    "com.ohos.launcher"
-]
-
-export const showSubpermissionsGrop: string[] = [
-    "电话",
-    "日历",
-    "信息",
-    "通讯录",
-    "通话记录"
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+export const permissionGroups: any[] = [
+    {
+        "permissionName": "ohos.permission.LOCATION_IN_BACKGROUND",
+        "groupName": "LOCATION",
+        "label": "后台定位权限",
+        "description": "允许应用在后台运行时获取位置信息。",
+        "groupId": 0
+    },
+    {
+        "permissionName": "ohos.permission.LOCATION",
+        "groupName": "LOCATION",
+        "label": "前台定位权限",
+        "description": "允许应用在前台运行时获取位置信息。",
+        "groupId": 0
+    },
+    {
+        "permissionName": "ohos.permission.CAMERA",
+        "groupName": "CAMERA",
+        "label": "拍摄照片和录制视频",
+        "description": "允许应用拍摄照片和视频。",
+        "groupId": 1
+    },
+    {
+        "permissionName": "ohos.permission.MICROPHONE",
+        "groupName": "MICROPHONE",
+        "label": "录制音频",
+        "description": "允许应用打开或关闭录音通路。",
+        "groupId": 2
+    },
+    {
+        "permissionName": "ohos.permission.ANSWER_CALL",
+        "groupName": "PHONE",
+        "label": "接听电话",
+        "description": "允许应用接听电话。",
+        "groupId": 3
+    },
+    {
+        "permissionName": "ohos.permission.MANAGE_VOICEMAIL",
+        "groupName": "PHONE",
+        "label": "语音信箱",
+        "description": "允许应用管理语音信箱。",
+        "groupId": 3
+    },
+    {
+        "permissionName": "ohos.permission.READ_CELL_MESSAGES",
+        "groupName": "SMS",
+        "label": "读取小区广播",
+        "description": "允许应用读取设备接收的小区广播信息。",
+        "groupId": 4
+    },
+    {
+        "permissionName": "ohos.permission.READ_MESSAGES",
+        "groupName": "SMS",
+        "label": "读取短彩信",
+        "description": "允许应用读取设备接收的短彩信信息。",
+        "groupId": 4
+    },
+    {
+        "permissionName": "ohos.permission.RECEIVE_MMS",
+        "groupName": "SMS",
+        "label": "接收彩信",
+        "description": "允许应用接收彩信。",
+        "groupId": 4
+    },
+    {
+        "permissionName": "ohos.permission.RECEIVE_SMS",
+        "groupName": "SMS",
+        "label": "接收短信",
+        "description": "允许应用接收短信。",
+        "groupId": 4
+    },
+    {
+        "permissionName": "ohos.permission.RECEIVE_WAP_MESSAGES",
+        "groupName": "SMS",
+        "label": "接收WAP消息",
+        "description": "允许应用接收和处理WAP消息。",
+        "groupId": 4
+    },
+    {
+        "permissionName": "ohos.permission.SEND_MESSAGES",
+        "groupName": "SMS",
+        "label": "发送短彩信",
+        "description": "允许应用发送短彩信",
+        "groupId": 4
+    },
+    {
+        "permissionName": "ohos.permission.READ_CONTACTS",
+        "groupName": "CONTACTS",
+        "label": "读取通讯录",
+        "description": "允许应用读取设备上存储的联系人信息。",
+        "groupId": 5
+    },
+    {
+        "permissionName": "ohos.permission.WRITE_CONTACTS",
+        "groupName": "CONTACTS",
+        "label": "新建/修改/删除通讯录",
+        "description": "允许应用新建/修改/删除设备上存储的联系人信息。",
+        "groupId": 5
+    },
+    {
+        "permissionName": "ohos.permission.READ_CALL_LOG",
+        "groupName": "CALL_LOG",
+        "label": "读取通话记录",
+        "description": "允许应用读取设备上的通话记录信息。",
+        "groupId": 6
+    },
+    {
+        "permissionName": "ohos.permission.WRITE_CALL_LOG",
+        "groupName": "CALL_LOG",
+        "label": "新建/修改/删除通话记录",
+        "description": "允许新建/修改/删除设备上的通话记录信息。",
+        "groupId": 6
+    },
+    {
+        "permissionName": "ohos.permission.MEDIA_LOCATION",
+        "groupName": "MEDIA",
+        "label": "允许应用访问拍摄位置",
+        "description": "应用访问用户媒体文件中的拍摄位置信息如经纬度信息。",
+        "groupId": 7
+    },
+    {
+        "permissionName": "ohos.permission.READ_MEDIA",
+        "groupName": "MEDIA",
+        "label": "允许应用读取媒体文件",
+        "description": "允许应用访问户媒体文件，如视频、音频、图片等。",
+        "groupId": 7
+    },
+    {
+        "permissionName": "ohos.permission.WRITE_MEDIA",
+        "groupName": "MEDIA",
+        "label": "允许应用读写媒体文件",
+        "description": "允许应用读写户媒体文件，如视频、音频、图片等。",
+        "groupId": 7
+    },
+    {
+        "permissionName": "ohos.permission.READ_CALENDAR",
+        "groupName": "CALENDAR",
+        "label": "读取日历",
+        "description": "允许应用读取日历。",
+        "groupId": 8
+    },
+    {
+        "permissionName": "ohos.permission.WRITE_CALENDAR",
+        "groupName": "CALENDAR",
+        "label": "新建/修改/删除日历",
+        "description": "允许应用新建/修改/删除日历。",
+        "groupId": 8
+    },
+    {
+        "permissionName": "ohos.permission.ACTIVITY_MOTION",
+        "groupName": "SPORT",
+        "label": "读取用户的运动状态",
+        "description": "允许应用程序读取用户的运动状态。",
+        "groupId": 9
+    },
+    {
+        "permissionName": "ohos.permission.READ_HEALTH_DATA",
+        "groupName": "HEALTH",
+        "label": "读取用户的健康数据",
+        "description": "允许应用程序读取用户的健康数据。",
+        "groupId": 10
+    },
+    {
+        "permissionName": "ohos.permission.DISTRIBUTED_DATASYNC",
+        "groupName": "OTHER",
+        "icon": $r("app.media.ic_multi_device_vector"),
+        "text": "使用多设备协同？",
+        "label": "多设备协同",
+        "description": "发现并访问其他设备。",
+        "groupId": 11
+    }
+]
+
+export const groups: any[] = [
+    {
+        "name": "LOCATION",
+        "groupName": "位置信息",
+        "icon": $r('app.media.ic_public_gps'),
+        "description": "",
+	      "label": "访问位置信息？",
+        "permissions": [
+            "ohos.permission.LOCATION_IN_BACKGROUND",
+            "ohos.permission.LOCATION"
+        ],
+        "isShow":true
+    },
+    {
+        "name": "CAMERA",
+        "groupName": "相机",
+        "icon": $r('app.media.ic_public_camera'),
+	      "label": "使用相机？",
+        "description": "",
+        "permissions": [
+            "ohos.permission.CAMERA"
+        ],
+        "isShow":true
+    },
+    {
+        "name": "MICROPHONE",
+        "groupName": "麦克风",
+        "icon": $r('app.media.ic_public_voice'),
+	      "label": "使用麦克风？",
+        "description": "",
+        "permissions": [
+            "ohos.permission.MICROPHONE"
+        ],
+        "isShow":true
+    },
+    {
+        "name": "PHONE",
+        "groupName": "电话",
+        "icon": $r('app.media.ic_public_phone'),
+	      "label": "使用拨打电话？",
+        "description": "",
+        "permissions": [
+            "ohos.permission.ANSWER_CALL",
+            "ohos.permission.MANAGE_VOICEMAIL"
+        ],
+        "isShow":false
+    },
+    {
+        "name": "SMS",
+        "groupName": "信息",
+        "icon": $r('app.media.ic_public_message'),
+        "label": "访问信息？",
+	      "description": "",
+        "permissions": [
+            "ohos.permission.READ_CELL_MESSAGES",
+            "ohos.permission.READ_MESSAGES",
+            "ohos.permission.RECEIVE_MMS",
+            "ohos.permission.RECEIVE_SMS",
+            "ohos.permission.RECEIVE_WAP_MESSAGES",
+            "ohos.permission.SEND_MESSAGES"
+        ],
+        "isShow":false
+    },
+    {
+        "name": "CONTACTS",
+        "groupName": "通讯录",
+        "icon": $r('app.media.ic_public_contacts_group'),
+        "label": "访问通讯录？",
+	      "description": "",
+        "permissions": [
+            "ohos.permission.READ_CONTACTS",
+            "ohos.permission.WRITE_CONTACTS"
+        ],
+        "isShow":false
+    },
+    {
+        "name": "CALL_LOG",
+        "groupName": "通话记录",
+        "icon": $r('app.media.ic_call_logs'),
+	      "label": "访问通话记录？",
+	      "description": "",
+        "permissions": [
+            "ohos.permission.READ_CALL_LOG",
+            "ohos.permission.WRITE_CALL_LOG"
+        ],
+        "isShow":false
+    },
+    {
+        "name": "MEDIA",
+        "groupName": "媒体和文件",
+        "icon": $r('app.media.ic_public_folder'),
+        "description": "",
+	      "label": "访问媒体和文件？",
+        "permissions": [
+            "ohos.permission.MEDIA_LOCATION",
+            "ohos.permission.READ_MEDIA",
+            "ohos.permission.WRITE_MEDIA"
+        ],
+        "isShow":true
+    },
+    {
+        "name": "CALENDAR",
+        "groupName": "日历",
+        "icon": $r('app.media.ic_public_calendar'),
+        "label": "访问日历？",
+	      "description": "",
+        "permissions": [
+            "ohos.permission.READ_CALENDAR",
+            "ohos.permission.WRITE_CALENDAR"
+        ],
+        "isShow":true
+    },
+    {
+        "name": "SPORT",
+        "groupName": "健身运动",
+        "icon": $r('app.media.ic_sport'),
+	      "label": "访问健身运动？",
+        "description": "",
+        "permissions": [
+            "ohos.permission.ACTIVITY_MOTION"
+        ],
+        "isShow":true
+    },
+    {
+        "name": "HEALTH",
+        "groupName": "身体传感器",
+        "icon": $r('app.media.ic_ssensor'),
+	      "label": "使用身体传感器？",
+        "description": "",
+        "permissions": [
+            "ohos.permission.READ_HEALTH_DATA"
+        ],
+        "isShow":true
+    },
+    {
+        "name": "OTHER",
+        "groupName": "其他权限",
+        "icon": $r('app.media.ic_more'),
+        "description": "",
+        "permissions": [
+            "ohos.permission.DISTRIBUTED_DATASYNC"
+        ],
+        "isShow":false
+    }
+];
+
+export const permissionGroupPermissions: object = {
+    "LOCATION": [
+        "ohos.permission.LOCATION_IN_BACKGROUND",
+        "ohos.permission.LOCATION"
+    ],
+    "CAMERA": [
+        "ohos.permission.CAMERA"
+    ],
+    "MICROPHONE": [
+        "ohos.permission.MICROPHONE"
+    ],
+    "PHONE": [
+        "ohos.permission.ANSWER_CALL",
+        "ohos.permission.MANAGE_VOICEMAIL"
+    ],
+    "SMS": [
+        "ohos.permission.READ_CELL_MESSAGES",
+        "ohos.permission.READ_MESSAGES",
+        "ohos.permission.RECEIVE_MMS",
+        "ohos.permission.RECEIVE_SMS",
+        "ohos.permission.RECEIVE_WAP_MESSAGES",
+        "ohos.permission.SEND_MESSAGES"
+    ],
+    "CONTACTS": [
+        "ohos.permission.READ_CONTACTS",
+        "ohos.permission.WRITE_CONTACTS"
+    ],
+    "CALL_LOG": [
+        "ohos.permission.READ_CALL_LOG",
+        "ohos.permission.WRITE_CALL_LOG"
+    ],
+    "MEDIA": [
+        "ohos.permission.MEDIA_LOCATION",
+        "ohos.permission.READ_MEDIA",
+        "ohos.permission.WRITE_MEDIA"
+    ],
+    "CALENDAR": [
+        "ohos.permission.READ_CALENDAR",
+        "ohos.permission.WRITE_CALENDAR"
+    ],
+    "SPORT": [
+        "ohos.permission.ACTIVITY_MOTION"
+    ],
+    "HEALTH": [
+        "ohos.permission.READ_HEALTH_DATA"
+    ],
+    "OTHER": [
+        "ohos.permission.DISTRIBUTED_DATASYNC"
+    ]
+};
+
+
+export const userGrantPermissions: string[] = [
+    "ohos.permission.LOCATION_IN_BACKGROUND",
+    "ohos.permission.LOCATION",
+    "ohos.permission.CAMERA",
+    "ohos.permission.MICROPHONE",
+    "ohos.permission.ANSWER_CALL",
+    "ohos.permission.MANAGE_VOICEMAIL",
+    "ohos.permission.READ_CELL_MESSAGES",
+    "ohos.permission.READ_MESSAGES",
+    "ohos.permission.RECEIVE_MMS",
+    "ohos.permission.RECEIVE_SMS",
+    "ohos.permission.RECEIVE_WAP_MESSAGES",
+    "ohos.permission.SEND_MESSAGES",
+    "ohos.permission.READ_CONTACTS",
+    "ohos.permission.WRITE_CONTACTS",
+    "ohos.permission.READ_CALL_LOG",
+    "ohos.permission.WRITE_CALL_LOG",
+    "ohos.permission.MEDIA_LOCATION",
+    "ohos.permission.READ_MEDIA",
+    "ohos.permission.WRITE_MEDIA",
+    "ohos.permission.READ_CALENDAR",
+    "ohos.permission.WRITE_CALENDAR",
+    "ohos.permission.ACTIVITY_MOTION",
+    "ohos.permission.READ_HEALTH_DATA",
+    "ohos.permission.DISTRIBUTED_DATASYNC"
+];
+
+export const permissionDescriptions: object = {
+    "位置信息": "允许应用在后台运行时获取位置信息。" ,
+    "相机": "允许应用拍摄照片和视频。" ,
+    "麦克风": "允许应用打开或关闭录音通路。" ,
+    "电话": "允许应用接听电话。" ,
+    "信息": "允许应用发送短彩信。" ,
+    "通讯录": "允许应用新建/修改/删除设备上存储的联系人信息。" ,
+    "通话记录": "允许新建/修改/删除设备上的通话记录信息。" ,
+    "媒体和文件": "允许应用访问户媒体文件，如视频、音频、图片等。" ,
+    "日历": "允许应用新建/修改/删除日历。" ,
+    "健身运动": "允许应用程序读取用户的运动状态。" ,
+    "身体传感器": "允许应用程序读取用户的健康数据。" ,
+    "其他权限": "允许应用与远程设备交换用户数据（如图片、音乐、视频、及应用数据等）。"
+};
+
+export const permissionPermissionGroup: object = {
+    "ohos.permission.LOCATION_IN_BACKGROUND": "LOCATION",
+    "ohos.permission.LOCATION": "LOCATION",
+    "ohos.permission.CAMERA": "CAMERA",
+    "ohos.permission.MICROPHONE": "MICROPHONE",
+    "ohos.permission.ANSWER_CALL": "PHONE",
+    "ohos.permission.MANAGE_VOICEMAIL": "PHONE",
+    "ohos.permission.READ_CELL_MESSAGES": "SMS",
+    "ohos.permission.READ_MESSAGES": "SMS",
+    "ohos.permission.RECEIVE_MMS": "SMS",
+    "ohos.permission.RECEIVE_SMS": "SMS",
+    "ohos.permission.RECEIVE_WAP_MESSAGES": "SMS",
+    "ohos.permission.SEND_MESSAGES": "SMS",
+    "ohos.permission.READ_CONTACTS": "CONTACTS",
+    "ohos.permission.WRITE_CONTACTS": "CONTACTS",
+    "ohos.permission.READ_CALL_LOG": "CALL_LOG",
+    "ohos.permission.WRITE_CALL_LOG": "CALL_LOG",
+    "ohos.permission.MEDIA_LOCATION": "MEDIA",
+    "ohos.permission.READ_MEDIA": "MEDIA",
+    "ohos.permission.WRITE_MEDIA": "MEDIA",
+    "ohos.permission.READ_CALENDAR": "CALENDAR",
+    "ohos.permission.WRITE_CALENDAR": "CALENDAR",
+    "ohos.permission.ACTIVITY_MOTION": "SPORT",
+    "ohos.permission.READ_HEALTH_DATA": "HEALTH",
+    "ohos.permission.DISTRIBUTED_DATASYNC": "OTHER"
+};
+
+export const permissionGroupIds: object = {
+    "ohos.permission.LOCATION_IN_BACKGROUND": "0",
+    "ohos.permission.LOCATION": "0",
+    "ohos.permission.CAMERA": "1",
+    "ohos.permission.MICROPHONE": "2",
+    "ohos.permission.ANSWER_CALL": "3",
+    "ohos.permission.MANAGE_VOICEMAIL": "3",
+    "ohos.permission.READ_CELL_MESSAGES": "4",
+    "ohos.permission.READ_MESSAGES": "4",
+    "ohos.permission.RECEIVE_MMS": "4",
+    "ohos.permission.RECEIVE_SMS": "4",
+    "ohos.permission.RECEIVE_WAP_MESSAGES": "4",
+    "ohos.permission.SEND_MESSAGES": "4",
+    "ohos.permission.READ_CONTACTS": "5",
+    "ohos.permission.WRITE_CONTACTS": "5",
+    "ohos.permission.READ_CALL_LOG": "6",
+    "ohos.permission.WRITE_CALL_LOG": "6",
+    "ohos.permission.MEDIA_LOCATION": "7",
+    "ohos.permission.READ_MEDIA": "7",
+    "ohos.permission.WRITE_MEDIA": "7",
+    "ohos.permission.READ_CALENDAR": "8",
+    "ohos.permission.WRITE_CALENDAR": "8",
+    "ohos.permission.ACTIVITY_MOTION": "9",
+    "ohos.permission.READ_HEALTH_DATA": "10",
+    "ohos.permission.DISTRIBUTED_DATASYNC": "11"
+};
+
+export const orderGroup: string[] = [
+    "位置信息",
+    "相机",
+    "麦克风",
+    "电话",
+    "信息",
+    "通讯录",
+    "通话记录",
+    "媒体和文件",
+    "日历",
+    "健身运动",
+    "身体传感器",
+    "其他权限"
+];
+
+export const otherPermissionsLabel: object = {
+    "ohos.permission.DISTRIBUTED_DATASYNC": "多设备协同"
+};
+
+export const noNeedDisplayApp: string[] = [
+    "com.ohos.launcher"
+]
+
+export const showSubpermissionsGrop: string[] = [
+    "电话",
+    "日历",
+    "信息",
+    "通讯录",
+    "通话记录"
 ];
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/utils/constant.ets b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/utils/constant.ets
index 1bfa23125625a0a3ff173eceef2f590ae786bbd1..3b964169b40d258d591524383dfe47ef2a17185e 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/utils/constant.ets
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/utils/constant.ets
@@ -1,349 +1,349 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-export default class Constants {
-    // alphabetIndexer
-    static ALPHABETINDEXER_SELECTEDFONT_SIZE = 12;
-    static ALPHABETINDEXER_POPUPFONT_SIZE = 30;
-    static ALPHABETINDEXER_ITEMSIZE = 16;
-    static ALPHABETINDEXER_HEIGHT = 448;
-    static ALPHABETINDEXER_WIDTH = 36;
-
-    // backBar
-    static BACKBAR_HEIGHT = 56;
-    static BACKBAR_MINHEIGHT = 56;
-
-    // image of backBar
-    static BACKBAR_IMAGE_HEIGHT = 24;
-    static BACKBAR_IMAGE_WIDTH = 24;
-    static BACKBAR_IMAGE_MARGIN_TOP = 17;
-    static BACKBAR_IMAGE_MARGIN_LEFT = 12;
-    static BACKBAR_IMAGE_MARGIN_RIGHT = 15;
-
-    // text of backBar
-    static BACKBAR_TEXT_FONT_SIZE = 20;
-    static BACKBAR_TEXT_FLEX_GROW = 1;
-    static BACKBAR_TEXT_MARGIN_TOP = 17;
-
-    // dialog
-    static DIALOG_BORDER_RADIUS = 24;
-    static DIALOG_HEIGHT = 70;
-    static DIALOG_WIDTH = 336;
-
-    // text of dialog
-    static DIALOG_TEXT_FONT_SIZE = 20;
-    static DIALOG_TEXT_MARGIN_TOP = 25;
-
-    // search textInput
-    static TEXTINPUT_PADDING_LEFT = 36;
-    static TEXTINPUT_BORDER_RADIUS = 20;
-    static TEXTINPUT_BORDER_WIDTH = 1.5;
-    static TEXTINPUT_PLACEHOLDER_Font_SIZE = 16;
-    static TEXTINPUT_HEIGHT = 40;
-    static TEXTINPUT_IMAGE_WIDTH = 16;
-    static TEXTINPUT_IMAGE_HEIGHT = 16;
-    static TEXTINPUT_IMAGE_MARGIN_LEFT = 12;
-    static TEXTINPUT_IMAGE_MARGIN_TOP = 12;
-
-    // grid useSizeType
-    static GRID_MARGIN = '0vp';
-    static GUTTER = 0;
-    static LEFT_XS_SPAN = 0;
-    static LEFT_XS_OFFSET = 0;
-    static LEFT_SM_SPAN = 0;
-    static LEFT_SM_OFFSET = 0;
-    static LEFT_MD_SPAN = 0;
-    static LEFT_MD_OFFSET = 0;
-    static LEFT_LG_SPAN = 2;
-    static LEFT_LG_OFFSET = 0;
-    static MIDDLE_XS_SPAN = 2;
-    static MIDDLE_XS_OFFSET = 0;
-    static MIDDLE_SM_SPAN = 4;
-    static MIDDLE_SM_OFFSET = 0;
-    static MIDDLE_MD_SPAN = 8;
-    static MIDDLE_MD_OFFSET = 0;
-    static MIDDLE_LG_SPAN = 8;
-    static MIDDLE_LG_OFFSET = 2;
-    static RIGHT_XS_SPAN = 0;
-    static RIGHT_XS_OFFSET = 2;
-    static RIGHT_SM_SPAN = 0;
-    static RIGHT_SM_OFFSET = 4;
-    static RIGHT_MD_SPAN = 0;
-    static RIGHT_MD_OFFSET = 8;
-    static RIGHT_LG_SPAN = 2;
-    static RIGHT_LG_OFFSET = 10;
-
-    // 100% width,height
-    static FULL_WIDTH = '100%';
-    static FULL_HEIGHT = '100%';
-
-    // public property style
-    static PERMISSION = 1;
-    static APPLICATION = 0;
-    static LAYOUT_WEIGHT = 1;
-    static FLEX_GROW = 1;
-    static TEXT_DECORATION_HEIGHT = 1;
-    static TEXT_MIDDLE_FONT_SIZE = 16;
-    static TEXT_SMAL_FONT_SIZE = 14;
-    static TEXT_SMALLER_FONT_SIZE = 12;
-    static TEXT_LINE_HEIGHT = 22;
-    static TEXT_SMALL_LINE_HEIGHT = 19;
-    static CONSTRAINTSIZE_MINHEIGHT = 48;
-    static LISTITEM_ROW_HEIGHT = 48;
-    static LISTITEM_PADDING_LEFT = 24;
-    static LIST_PADDING_LEFT = 12
-    static LISTITEM_PADDING_RIGHT = 24;
-    static LISTITEM_PADDING_LEFT_RECORD = 32;
-    static LISTITEM_MARGIN_BOTTOM = 12;
-    static LISTITEM_MARGIN_BOTTOM_PERMISSION = 14;
-    static LISTITEM_MARGIN_BOTTOM_APPLICATION = 10;
-    static LISTITEM_HEIGHT_PERMISSION = 64;
-    static LISTITEM_HEIGHT_APPLICATION = 72;
-    static IMAGE_HEIGHT = 24;
-    static IMAGE_WIDTH = 12;
-    static IMAGE_HEIGHT_RECORD = 12;
-    static IMAGE_WIDTH_RECORD = 24;
-    static IMAGE_HEIGHT_RECORD_APPLICATION = 16;
-    static IMAGE_WIDTH_RECORD_APPLICATION = 16;
-    static BORDER_RADIUS = 24;
-    static TITLE_MARGIN_BOTTOM = 16;
-    static SUBTITLE_MIN_HEIGHT = 48;
-    static SUBTITLE_LINE_HEIGHT = 24;
-    static SUBTITLE_PADDING_TOP = 16;
-    static SUBTITLE_PADDING_BOTTOM = 8;
-    static TAB_HEIGHT = 56;
-    static TAB_DECORATION_HEIGHT = 2;
-    static TAB_DECORATION_POSITION_Y = 46;
-    static DEFAULT_PADDING_START = 12;
-    static DEFAULT_PADDING_END = 12;
-
-    // application-secondary, authority-secondary
-    static FLEX_MARGIN_TOP = 8;
-    static FLEX_MARGIN_BOTTOM = 8;
-    static LIST_PADDING_TOP = 4;
-    static LIST_PADDING_BOTTOM = 4;
-    static LIST_MARGIN_BOTTOM = 12;
-    static ROW_MARGIN_TOP = 9;
-    static SECONDARY_TEXT_MARGIN_TOP = 19.5;
-    static SECONDARY_TEXT_MARGIN_LEFT = 24;
-    static SECONDARY_LIST_PADDING_LEFT = 12;
-    static SECONDARY_LIST_PADDING_RIGHT = 12;
-
-    // application-tertiary
-    static TERTIARY_IMAGE_WIDTH = 64;
-    static TERTIARY_IMAGE_HEIGHT = 64;
-    static TERTIARY_IMAGE_MARGIN_LEFT = 12;
-    static TERTIARY_IMAGE_MARGIN_RIGHT = 12;
-    static TERTIARY_LABEL_MARGIN_BOTTOM = 2;
-    static TERTIARY_MARGIN_LEFT = 12;
-    static TERTIARY_TEXT_MARGIN_LEFT = 24;
-    static TERTIARY_HALF_WIDTH = '50%';
-    static TERTIARY_ROW_MARGIN_TOP = 24;
-    static TERTIARY_PERMISSION_ROW_MARGIN_TOP = 12;
-    static TERTIARY_RADIO_IMAGE_WIDTH = 24;
-    static TERTIARY_RADIO_IMAGE_HEIGHT = 24;
-    static TERTIARY_RADIO_IMAGE_MARGIN_TOP = 4;
-    static TERTIARY_LISTITEM_PADDING_LEFT = 24;
-    static TERTIARY_LISTITEM_PADDING_RIGHT = 24;
-    static TERTIARY_LISTITEM_MARGIN_TOP = 1;
-    static TERTIARY_LIST_PADDING_LEFT = 12;
-    static TERTIARY_LIST_PADDING_RIGHT = 12;
-    static TERTIARY_LIST_PADDING_TOP = 4;
-    static TERTIARY_LIST_PADDING_BOTTOM = 4;
-
-    // authority-tertiary
-    static AUTHORITY_IMAGE_WIDTH = 40;
-    static AUTHORITY_IMAGE_HEIGHT = 40;
-    static AUTHORITY_IMAGE_MARGIN_RIGHT = 16;
-    static AUTHORITY_TOGGLE_WIDTH = 36;
-    static AUTHORITY_TOGGLE_HEIGHT = 20;
-    static AUTHORITY_ROW_HEIGHT = 72;
-    static AUTHORITY_CONSTRAINTSIZE_MINHEIGHT = 72;
-    static AUTHORITY_LISTITEM_PADDING_LEFT = 12;
-    static AUTHORITY_LISTITEM_PADDING_RIGHT = 12;
-    static AUTHORITY_TEXTINPUT_PADDING_LEFT = 12;
-    static AUTHORITY_TEXTINPUT_PADDING_RIGHT = 24;
-    static AUTHORITY_TEXT_MARGIN_TOP = 24;
-    static AUTHORITY_TEXT_MARGIN_LEFT = 0;
-    static AUTHORITY_ROW_MARGIN_TOP = 24;
-    static NORECORD_IMAGE_WIDTH = 120;
-    static NORECORD_IMAGE_HEIGHT = 120;
-    static NORECORD_IMAGE_MARGIN_LEFT = 40;
-    static SEARCHNORESULT_IMAGE_WIDTH = 200;
-    static SEARCHNORESULT_IMAGE_HEIGHT = 200;
-    static AUTHORITY_COLUMN_HEIGHT = '95%';
-    static AUTHORITY_ALPHABETINDEX_WIDTH = 24;
-    static AUTHORITY_ALPHABETINDEX_PADDING_TOP = 16;
-    static AUTHORITY_TEXT_DECORATION_WIDTH = '86%';
-    static AUTHORITY_TEXT_DECORATION_MARGIN_LEFT = 53;
-
-    // authority-management
-    static MANAGEMENT_IMAGE_WIDTH = 24;
-    static MANAGEMENT_IMAGE_HEIGHT = 24;
-    static MANAGEMENT_IMAGE_MARGIN_RIGHT = 16;
-    static MANAGEMENT_IMAGE_MARGIN_RIGHT_RECORD = 24;
-    static MANAGEMENT_IMAGE_MARGIN_LEFT = 8;
-    static MANAGEMENT_ROW_HEIGHT = 56;
-    static MANAGEMENT_TEXT_DECORATION_WIDTH = '95%';
-    static MANAGEMENT_TEXT_DECORATION_MARGIN_LEFT = 40;
-    static MANAGEMENT_LODING_IMAGE_WIDTH = 48;
-    static MANAGEMENT_LODING_IMAGE_HEIGHT = 48;
-    static MANAGEMENT_LODING_ROW_HEIGHT = '90%';
-    static MANAGEMENT_ROW_PADDING_LEFT = 12;
-    static MANAGEMENT_ROW_PADDING_RIGHT = 12;
-    static MANAGEMENT_ROW_PADDING_TOP = 8;
-    static MANAGEMENT_ROW_MARGIN_TOP = 12;
-    static MANAGEMENT_TRANSPARENCY = 0.8;
-    static APPLICATION_IMAGE_WIDTH = 40;
-    static APPLICATION_IMAGE_HEIGHT = 40;
-    static APPLICATION_IMAGE_MARGIN_RIGHT = 16;
-    static APPLICATION_TEXT_MARGIN_RIGHT = 4;
-    static APPLICATION_LIST_PADDING_LEFT = 12;
-    static APPLICATION_LIST_PADDING_RIGHT = 12;
-    static APPLICATION_LIST_MARGIN_BOTTOM = 50;
-    static APPLICATION_LISTITEM_PADDING_LEFT = 12;
-    static APPLICATION_LISTITEM_PADDING_RIGHT = 12;
-    static APPLICATION_TEXTINPUT_PADDING_LEFT = 12;
-    static APPLICATION_TEXTINPUT_PADDING_TOP = 8;
-    static APPLICATION_TEXTINPUT_PADDING_RIGHT = 24;
-    static APPLICATION_COLUMN_HEIGHT = '93%';
-    static APPLICATION_ALPHABETINDEX_MARGIN_TOP = 12;
-    static APPLICATION_ALPHABETINDEX_WIDTH = 24;
-    static APPLICATION_TEXT_DECORATION_WIDTH = '90%';
-    static APPLICATION_TEXT_DECORATION_MARGIN_LEFT = 56;
-    static LOADING_WIDTH = 100;
-
-    // slice
-    static SLICE_START = 0;
-    static SLICE_END = -1;
-    static SLICE_START_INDEX = 0;
-    static SLICE_END_INDEX = 1;
-
-    //group number
-    static FIXED_GROUP = 1;
-    static CHANGE_GROUP = 2;
-    static OTHER_GROUP = 3;
-
-    // tabBar
-    static BAR_WIDTH = 285;
-
-    // setTimeout
-    static DELAY_TIME = 1000;
-    static DELAY_TIME_MAX = 2000;
-
-    // radio
-    static RADIO_ALLOW_NAME = '允许';
-    static RADIO_ALLOW_INDEX = 0;
-    static RADIO_ALLOW_GROUP_NAME = 'radio';
-    static RADIO_BAN_NAME = '禁止';
-    static RADIO_BAN_INDEX = 1;
-    static RADIO_BAN_GROUP_NAME = 'radio';
-
-    //shape
-    static SHAPE_DIA = 24;
-    static SHAPE_BAN_DIA = 23;
-    static SHAPE_BIG_DIA = 48;
-    static SHAPE_OFFSET_X = -24;
-    static SHAPE_BAN_OFFSET = .5;
-    static SHAPE_ALLOW_DIA = 16;
-    static SHAPE_ALLOW_OFFSET = 4;
-    static SHAPE_ZINDEX = 10;
-
-    // utils
-    static CHAR_CODE = 0;
-    static UNI_MAX = 40869;
-    static UNI_MIN = 19968;
-
-    static PARMETER_BUNDLE_FLAG = 16;
-    static USERID = 100;
-
-    static PERMISSION_INDEX = 0;
-
-    static PERMISSION_NUM = 0;
-
-    static PERMISSION_FLAG = 2;
-    static API_VERSION_SUPPORT_STAGE = 9;
-
-    static PRE_AUTHORIZATION_NOT_MODIFIED = 4;
-
-    static BUNDLE_NAME = 'com.ohos.permissionmanager'
-
-    static START_SUBSCRIPT = 0
-    static END_SUBSCRIPT = 500
-
-    static RECORD_PADDING_BOTTOM = '20%'
-
-
-
-
-    ////////////////////////////////////////////
-    // icon of dialog
-    static DIALOG_ICON_WIDTH = 24;
-    static DIALOG_ICON_HEIGHT = 24;
-    static DIALOG_ICON_MARGIN_TOP = 23;
-
-    // label text of dialog
-    static DIALOG_LABEL_FONT_SIZE = 10;
-    static DIALOG_LABEL_MARGIN_TOP = 2;
-    static DIALOG_LABEL_LINE_HEIGHT = 14;
-
-    // request text of dialog
-    static DIALOG_REQ_FONT_SIZE = 16;
-    static DIALOG_REQ_MARGIN_TOP = 16;
-    static DIALOG_REQ_MARGIN_LEFT = 24;
-    static DIALOG_REQ_LINE_HEIGHT = 22;
-
-    // description text of dialog
-    static DIALOG_DESP_FONT_SIZE = 14;
-    static DIALOG_DESP_MARGIN_TOP = 2;
-    static DIALOG_DESP_MARGIN_LEFT = 24;
-    static DIALOG_DESP_MARGIN_RIGHT = 24;
-    static DIALOG_DESP_MARGIN_BOTTOM = 8;
-    static DIALOG_DESP_LINE_HEIGHT = 19;
-
-    static BUTTON_FONT_SIZE = 16;
-    static BUTTON_DIVIDER_FONT_SIZE = 24;
-    static BUTTON_MARGIN_TOP = 8;
-    static BUTTON_MARGIN_BOTTOM = 16;
-    static BUTTON_MARGIN_LEFT = 16;
-    static BUTTON_MARGIN_RIGHT = 16;
-    static BUTTON_HEIGHT = 40;
-    static BUTTON_WIDTH = 177;
-
-    static DIALOG_PRIVACY_BORDER_RADIUS = 32;
-    static DIALOG_PRIVACY_WIDTH = 395;
-    static DIALOG_PADDING_BOTTOM = 16;
-
-    // initial check status
-    static INIT_NEED_TO_WAIT = 0
-    static INIT_NEED_TO_VERIFY = 1
-    static INIT_NEED_TO_TERMINATED = 2
-    static INIT_NEED_TO_REFRESH = 3
-
-    static RESULT_SUCCESS = 1
-    static RESULT_FAILURE = 0
-    static RESULT_CODE = 0
-
-    //
-    static SETTING_OPER = -1
-    static PASS_OPER = 0
-    static DYNAMIC_OPER = 1
-    static INVALID_OPER = 2
-
-    //
-    static INITIAL_INDEX = 10
-    static ACCESS_TOKEN = 'ohos.security.accesstoken.tokencallback'
-
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+export default class Constants {
+    // alphabetIndexer
+    static ALPHABETINDEXER_SELECTEDFONT_SIZE = 12;
+    static ALPHABETINDEXER_POPUPFONT_SIZE = 30;
+    static ALPHABETINDEXER_ITEMSIZE = 16;
+    static ALPHABETINDEXER_HEIGHT = 448;
+    static ALPHABETINDEXER_WIDTH = 36;
+
+    // backBar
+    static BACKBAR_HEIGHT = 56;
+    static BACKBAR_MINHEIGHT = 56;
+
+    // image of backBar
+    static BACKBAR_IMAGE_HEIGHT = 24;
+    static BACKBAR_IMAGE_WIDTH = 24;
+    static BACKBAR_IMAGE_MARGIN_TOP = 17;
+    static BACKBAR_IMAGE_MARGIN_LEFT = 12;
+    static BACKBAR_IMAGE_MARGIN_RIGHT = 15;
+
+    // text of backBar
+    static BACKBAR_TEXT_FONT_SIZE = 20;
+    static BACKBAR_TEXT_FLEX_GROW = 1;
+    static BACKBAR_TEXT_MARGIN_TOP = 17;
+
+    // dialog
+    static DIALOG_BORDER_RADIUS = 24;
+    static DIALOG_HEIGHT = 70;
+    static DIALOG_WIDTH = 336;
+
+    // text of dialog
+    static DIALOG_TEXT_FONT_SIZE = 20;
+    static DIALOG_TEXT_MARGIN_TOP = 25;
+
+    // search textInput
+    static TEXTINPUT_PADDING_LEFT = 36;
+    static TEXTINPUT_BORDER_RADIUS = 20;
+    static TEXTINPUT_BORDER_WIDTH = 1.5;
+    static TEXTINPUT_PLACEHOLDER_Font_SIZE = 16;
+    static TEXTINPUT_HEIGHT = 40;
+    static TEXTINPUT_IMAGE_WIDTH = 16;
+    static TEXTINPUT_IMAGE_HEIGHT = 16;
+    static TEXTINPUT_IMAGE_MARGIN_LEFT = 12;
+    static TEXTINPUT_IMAGE_MARGIN_TOP = 12;
+
+    // grid useSizeType
+    static GRID_MARGIN = '0vp';
+    static GUTTER = 0;
+    static LEFT_XS_SPAN = 0;
+    static LEFT_XS_OFFSET = 0;
+    static LEFT_SM_SPAN = 0;
+    static LEFT_SM_OFFSET = 0;
+    static LEFT_MD_SPAN = 0;
+    static LEFT_MD_OFFSET = 0;
+    static LEFT_LG_SPAN = 2;
+    static LEFT_LG_OFFSET = 0;
+    static MIDDLE_XS_SPAN = 2;
+    static MIDDLE_XS_OFFSET = 0;
+    static MIDDLE_SM_SPAN = 4;
+    static MIDDLE_SM_OFFSET = 0;
+    static MIDDLE_MD_SPAN = 8;
+    static MIDDLE_MD_OFFSET = 0;
+    static MIDDLE_LG_SPAN = 8;
+    static MIDDLE_LG_OFFSET = 2;
+    static RIGHT_XS_SPAN = 0;
+    static RIGHT_XS_OFFSET = 2;
+    static RIGHT_SM_SPAN = 0;
+    static RIGHT_SM_OFFSET = 4;
+    static RIGHT_MD_SPAN = 0;
+    static RIGHT_MD_OFFSET = 8;
+    static RIGHT_LG_SPAN = 2;
+    static RIGHT_LG_OFFSET = 10;
+
+    // 100% width,height
+    static FULL_WIDTH = '100%';
+    static FULL_HEIGHT = '100%';
+
+    // public property style
+    static PERMISSION = 1;
+    static APPLICATION = 0;
+    static LAYOUT_WEIGHT = 1;
+    static FLEX_GROW = 1;
+    static TEXT_DECORATION_HEIGHT = 1;
+    static TEXT_MIDDLE_FONT_SIZE = 16;
+    static TEXT_SMAL_FONT_SIZE = 14;
+    static TEXT_SMALLER_FONT_SIZE = 12;
+    static TEXT_LINE_HEIGHT = 22;
+    static TEXT_SMALL_LINE_HEIGHT = 19;
+    static CONSTRAINTSIZE_MINHEIGHT = 48;
+    static LISTITEM_ROW_HEIGHT = 48;
+    static LISTITEM_PADDING_LEFT = 24;
+    static LIST_PADDING_LEFT = 12
+    static LISTITEM_PADDING_RIGHT = 24;
+    static LISTITEM_PADDING_LEFT_RECORD = 32;
+    static LISTITEM_MARGIN_BOTTOM = 12;
+    static LISTITEM_MARGIN_BOTTOM_PERMISSION = 14;
+    static LISTITEM_MARGIN_BOTTOM_APPLICATION = 10;
+    static LISTITEM_HEIGHT_PERMISSION = 64;
+    static LISTITEM_HEIGHT_APPLICATION = 72;
+    static IMAGE_HEIGHT = 24;
+    static IMAGE_WIDTH = 12;
+    static IMAGE_HEIGHT_RECORD = 12;
+    static IMAGE_WIDTH_RECORD = 24;
+    static IMAGE_HEIGHT_RECORD_APPLICATION = 16;
+    static IMAGE_WIDTH_RECORD_APPLICATION = 16;
+    static BORDER_RADIUS = 24;
+    static TITLE_MARGIN_BOTTOM = 16;
+    static SUBTITLE_MIN_HEIGHT = 48;
+    static SUBTITLE_LINE_HEIGHT = 24;
+    static SUBTITLE_PADDING_TOP = 16;
+    static SUBTITLE_PADDING_BOTTOM = 8;
+    static TAB_HEIGHT = 56;
+    static TAB_DECORATION_HEIGHT = 2;
+    static TAB_DECORATION_POSITION_Y = 46;
+    static DEFAULT_PADDING_START = 12;
+    static DEFAULT_PADDING_END = 12;
+
+    // application-secondary, authority-secondary
+    static FLEX_MARGIN_TOP = 8;
+    static FLEX_MARGIN_BOTTOM = 8;
+    static LIST_PADDING_TOP = 4;
+    static LIST_PADDING_BOTTOM = 4;
+    static LIST_MARGIN_BOTTOM = 12;
+    static ROW_MARGIN_TOP = 9;
+    static SECONDARY_TEXT_MARGIN_TOP = 19.5;
+    static SECONDARY_TEXT_MARGIN_LEFT = 24;
+    static SECONDARY_LIST_PADDING_LEFT = 12;
+    static SECONDARY_LIST_PADDING_RIGHT = 12;
+
+    // application-tertiary
+    static TERTIARY_IMAGE_WIDTH = 64;
+    static TERTIARY_IMAGE_HEIGHT = 64;
+    static TERTIARY_IMAGE_MARGIN_LEFT = 12;
+    static TERTIARY_IMAGE_MARGIN_RIGHT = 12;
+    static TERTIARY_LABEL_MARGIN_BOTTOM = 2;
+    static TERTIARY_MARGIN_LEFT = 12;
+    static TERTIARY_TEXT_MARGIN_LEFT = 24;
+    static TERTIARY_HALF_WIDTH = '50%';
+    static TERTIARY_ROW_MARGIN_TOP = 24;
+    static TERTIARY_PERMISSION_ROW_MARGIN_TOP = 12;
+    static TERTIARY_RADIO_IMAGE_WIDTH = 24;
+    static TERTIARY_RADIO_IMAGE_HEIGHT = 24;
+    static TERTIARY_RADIO_IMAGE_MARGIN_TOP = 4;
+    static TERTIARY_LISTITEM_PADDING_LEFT = 24;
+    static TERTIARY_LISTITEM_PADDING_RIGHT = 24;
+    static TERTIARY_LISTITEM_MARGIN_TOP = 1;
+    static TERTIARY_LIST_PADDING_LEFT = 12;
+    static TERTIARY_LIST_PADDING_RIGHT = 12;
+    static TERTIARY_LIST_PADDING_TOP = 4;
+    static TERTIARY_LIST_PADDING_BOTTOM = 4;
+
+    // authority-tertiary
+    static AUTHORITY_IMAGE_WIDTH = 40;
+    static AUTHORITY_IMAGE_HEIGHT = 40;
+    static AUTHORITY_IMAGE_MARGIN_RIGHT = 16;
+    static AUTHORITY_TOGGLE_WIDTH = 36;
+    static AUTHORITY_TOGGLE_HEIGHT = 20;
+    static AUTHORITY_ROW_HEIGHT = 72;
+    static AUTHORITY_CONSTRAINTSIZE_MINHEIGHT = 72;
+    static AUTHORITY_LISTITEM_PADDING_LEFT = 12;
+    static AUTHORITY_LISTITEM_PADDING_RIGHT = 12;
+    static AUTHORITY_TEXTINPUT_PADDING_LEFT = 12;
+    static AUTHORITY_TEXTINPUT_PADDING_RIGHT = 24;
+    static AUTHORITY_TEXT_MARGIN_TOP = 24;
+    static AUTHORITY_TEXT_MARGIN_LEFT = 0;
+    static AUTHORITY_ROW_MARGIN_TOP = 24;
+    static NORECORD_IMAGE_WIDTH = 120;
+    static NORECORD_IMAGE_HEIGHT = 120;
+    static NORECORD_IMAGE_MARGIN_LEFT = 40;
+    static SEARCHNORESULT_IMAGE_WIDTH = 200;
+    static SEARCHNORESULT_IMAGE_HEIGHT = 200;
+    static AUTHORITY_COLUMN_HEIGHT = '95%';
+    static AUTHORITY_ALPHABETINDEX_WIDTH = 24;
+    static AUTHORITY_ALPHABETINDEX_PADDING_TOP = 16;
+    static AUTHORITY_TEXT_DECORATION_WIDTH = '86%';
+    static AUTHORITY_TEXT_DECORATION_MARGIN_LEFT = 53;
+
+    // authority-management
+    static MANAGEMENT_IMAGE_WIDTH = 24;
+    static MANAGEMENT_IMAGE_HEIGHT = 24;
+    static MANAGEMENT_IMAGE_MARGIN_RIGHT = 16;
+    static MANAGEMENT_IMAGE_MARGIN_RIGHT_RECORD = 24;
+    static MANAGEMENT_IMAGE_MARGIN_LEFT = 8;
+    static MANAGEMENT_ROW_HEIGHT = 56;
+    static MANAGEMENT_TEXT_DECORATION_WIDTH = '95%';
+    static MANAGEMENT_TEXT_DECORATION_MARGIN_LEFT = 40;
+    static MANAGEMENT_LODING_IMAGE_WIDTH = 48;
+    static MANAGEMENT_LODING_IMAGE_HEIGHT = 48;
+    static MANAGEMENT_LODING_ROW_HEIGHT = '90%';
+    static MANAGEMENT_ROW_PADDING_LEFT = 12;
+    static MANAGEMENT_ROW_PADDING_RIGHT = 12;
+    static MANAGEMENT_ROW_PADDING_TOP = 8;
+    static MANAGEMENT_ROW_MARGIN_TOP = 12;
+    static MANAGEMENT_TRANSPARENCY = 0.8;
+    static APPLICATION_IMAGE_WIDTH = 40;
+    static APPLICATION_IMAGE_HEIGHT = 40;
+    static APPLICATION_IMAGE_MARGIN_RIGHT = 16;
+    static APPLICATION_TEXT_MARGIN_RIGHT = 4;
+    static APPLICATION_LIST_PADDING_LEFT = 12;
+    static APPLICATION_LIST_PADDING_RIGHT = 12;
+    static APPLICATION_LIST_MARGIN_BOTTOM = 50;
+    static APPLICATION_LISTITEM_PADDING_LEFT = 12;
+    static APPLICATION_LISTITEM_PADDING_RIGHT = 12;
+    static APPLICATION_TEXTINPUT_PADDING_LEFT = 12;
+    static APPLICATION_TEXTINPUT_PADDING_TOP = 8;
+    static APPLICATION_TEXTINPUT_PADDING_RIGHT = 24;
+    static APPLICATION_COLUMN_HEIGHT = '93%';
+    static APPLICATION_ALPHABETINDEX_MARGIN_TOP = 12;
+    static APPLICATION_ALPHABETINDEX_WIDTH = 24;
+    static APPLICATION_TEXT_DECORATION_WIDTH = '90%';
+    static APPLICATION_TEXT_DECORATION_MARGIN_LEFT = 56;
+    static LOADING_WIDTH = 100;
+
+    // slice
+    static SLICE_START = 0;
+    static SLICE_END = -1;
+    static SLICE_START_INDEX = 0;
+    static SLICE_END_INDEX = 1;
+
+    //group number
+    static FIXED_GROUP = 1;
+    static CHANGE_GROUP = 2;
+    static OTHER_GROUP = 3;
+
+    // tabBar
+    static BAR_WIDTH = 285;
+
+    // setTimeout
+    static DELAY_TIME = 1000;
+    static DELAY_TIME_MAX = 2000;
+
+    // radio
+    static RADIO_ALLOW_NAME = '允许';
+    static RADIO_ALLOW_INDEX = 0;
+    static RADIO_ALLOW_GROUP_NAME = 'radio';
+    static RADIO_BAN_NAME = '禁止';
+    static RADIO_BAN_INDEX = 1;
+    static RADIO_BAN_GROUP_NAME = 'radio';
+
+    //shape
+    static SHAPE_DIA = 24;
+    static SHAPE_BAN_DIA = 23;
+    static SHAPE_BIG_DIA = 48;
+    static SHAPE_OFFSET_X = -24;
+    static SHAPE_BAN_OFFSET = .5;
+    static SHAPE_ALLOW_DIA = 16;
+    static SHAPE_ALLOW_OFFSET = 4;
+    static SHAPE_ZINDEX = 10;
+
+    // utils
+    static CHAR_CODE = 0;
+    static UNI_MAX = 40869;
+    static UNI_MIN = 19968;
+
+    static PARMETER_BUNDLE_FLAG = 16;
+    static USERID = 100;
+
+    static PERMISSION_INDEX = 0;
+
+    static PERMISSION_NUM = 0;
+
+    static PERMISSION_FLAG = 2;
+    static API_VERSION_SUPPORT_STAGE = 9;
+
+    static PRE_AUTHORIZATION_NOT_MODIFIED = 4;
+
+    static BUNDLE_NAME = 'com.ohos.permissionmanager'
+
+    static START_SUBSCRIPT = 0
+    static END_SUBSCRIPT = 500
+
+    static RECORD_PADDING_BOTTOM = '20%'
+
+
+
+
+    ////////////////////////////////////////////
+    // icon of dialog
+    static DIALOG_ICON_WIDTH = 24;
+    static DIALOG_ICON_HEIGHT = 24;
+    static DIALOG_ICON_MARGIN_TOP = 23;
+
+    // label text of dialog
+    static DIALOG_LABEL_FONT_SIZE = 10;
+    static DIALOG_LABEL_MARGIN_TOP = 2;
+    static DIALOG_LABEL_LINE_HEIGHT = 14;
+
+    // request text of dialog
+    static DIALOG_REQ_FONT_SIZE = 16;
+    static DIALOG_REQ_MARGIN_TOP = 16;
+    static DIALOG_REQ_MARGIN_LEFT = 24;
+    static DIALOG_REQ_LINE_HEIGHT = 22;
+
+    // description text of dialog
+    static DIALOG_DESP_FONT_SIZE = 14;
+    static DIALOG_DESP_MARGIN_TOP = 2;
+    static DIALOG_DESP_MARGIN_LEFT = 24;
+    static DIALOG_DESP_MARGIN_RIGHT = 24;
+    static DIALOG_DESP_MARGIN_BOTTOM = 8;
+    static DIALOG_DESP_LINE_HEIGHT = 19;
+
+    static BUTTON_FONT_SIZE = 16;
+    static BUTTON_DIVIDER_FONT_SIZE = 24;
+    static BUTTON_MARGIN_TOP = 8;
+    static BUTTON_MARGIN_BOTTOM = 16;
+    static BUTTON_MARGIN_LEFT = 16;
+    static BUTTON_MARGIN_RIGHT = 16;
+    static BUTTON_HEIGHT = 40;
+    static BUTTON_WIDTH = 177;
+
+    static DIALOG_PRIVACY_BORDER_RADIUS = 32;
+    static DIALOG_PRIVACY_WIDTH = 395;
+    static DIALOG_PADDING_BOTTOM = 16;
+
+    // initial check status
+    static INIT_NEED_TO_WAIT = 0
+    static INIT_NEED_TO_VERIFY = 1
+    static INIT_NEED_TO_TERMINATED = 2
+    static INIT_NEED_TO_REFRESH = 3
+
+    static RESULT_SUCCESS = 1
+    static RESULT_FAILURE = 0
+    static RESULT_CODE = 0
+
+    //
+    static SETTING_OPER = -1
+    static PASS_OPER = 0
+    static DYNAMIC_OPER = 1
+    static INVALID_OPER = 2
+
+    //
+    static INITIAL_INDEX = 10
+    static ACCESS_TOKEN = 'ohos.security.accesstoken.tokencallback'
+
 }
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/utils/utils.ets b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/utils/utils.ets
index 8caae47c6938b5a419bd398e9e574e9ac2cda4b0..db27a00106a40dae1a100c9a9190fff94e4d91bf 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/utils/utils.ets
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/common/utils/utils.ets
@@ -1,427 +1,427 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-import Resmgr from '@ohos.resourceManager';
-import abilityAccessCtrl from '@ohos.abilityAccessCtrl';
-
-import { permissionGroups, groups } from "../model/permissionGroup";
-import Constants from '../utils/constant';
-
-/**
- * Get app name resource
- * @param {Number} labelId app name id
- * @param {String} bundleName Package names
- */
-export function getAppLabel(labelId, bundleName) {
-  return new Promise((resolve) => {
-    Resmgr.getResourceManager(globalThis.context, bundleName).then(item => {
-      item.getString(labelId, (error, value) => {
-        resolve(value);
-      })
-    }).catch(error => {
-      console.error('Resmgr.getResourceManager failed. Cause: ' + JSON.stringify(error));
-    })
-  })
-}
-
-/**
- * Get app icon resources
- * @param {Number} iconId app icon id
- * @param {String} bundleName Package names
- */
-export function getAppIcon(iconId, bundleName) {
-  return new Promise((resolve) => {
-    Resmgr.getResourceManager(globalThis.context, bundleName).then(item => {
-      item.getMediaBase64(iconId, (error, value) => {
-        resolve(value);
-      })
-    }).catch(error => {
-      console.error('Resmgr.getResourceManager failed. Cause: ' + JSON.stringify(error));
-    })
-  })
-}
-
-/**
- * verify permission
- * @param {Number} accessTokenId
- * @param {String} permission permission name
- */
-export function verifyAccessToken(accessTokenId, permission) {
-  return new Promise((resolve) => {
-    abilityAccessCtrl.createAtManager().verifyAccessToken(accessTokenId, permission).then((res) => {
-      return resolve(res);
-    })
-    .catch((error) => {
-      console.error('verifyAccessToken failed. Cause: ' + JSON.stringify(error));
-    })
-  })
-}
-
-/**
-* Let arkui detect changes in array index assignments。
-*/
-export function changeIndexValue(stateList, changeItem){
-  // copy array
-  let result = stateList.slice(0);
-  for (let i = 0 ; i < changeItem.length; i++) {
-    let item = changeItem[i];
-    if (!Array.isArray(item)) {
-      throw new Error("error");
-    }
-    let index = item[0];
-    let value = item[1];
-    if (index == undefined || value == undefined) {
-      throw new Error("error");
-    }
-    if (index < 0 || index > stateList.length - 1) {
-      continue;
-    }
-    let start = result.slice(0, index);
-    start = start.concat([value]);
-    result = start.concat(result.slice(index + 1));
-  }
-  return result;
-}
-
-// List of Chinese Pinyin Initials
-let strChineseFirstPY = "YDYQSXMWZSSXJBYMGCCZQPSSQBYCDSCDQLDYLYBSSJGYZZJJFKCCLZDHWDWZJLJPFYYNWJJTMYHZWZHFLZPPQHGSC" +
-"YYYNJQYXXGJHHSDSJNKKTMOMLCRXYPSNQSECCQZGGLLYJLMYZZSECYKYYHQWJSSGGYXYZYJWWKDJHYCHMYXJTLXJYQBYXZLDWRDJRWYSRLDZJPCBZ" +
-"JJBRCFTLECZSTZFXXZHTRQHYBDLYCZSSYMMRFMYQZPWWJJYFCRWFDFZQPYDDWYXKYJAWJFFXYPSFTZYHHYZYSWCJYXSCLCXXWZZXNBGNNXBXLZSZS" +
-"BSGPYSYZDHMDZBQBZCWDZZYYTZHBTSYYBZGNTNXQYWQSKBPHHLXGYBFMJEBJHHGQTJCYSXSTKZHLYCKGLYSMZXYALMELDCCXGZYRJXSDLTYZCQKCN" +
-"NJWHJTZZCQLJSTSTBNXBTYXCEQXGKWJYFLZQLYHYXSPSFXLMPBYSXXXYDJCZYLLLSJXFHJXPJBTFFYABYXBHZZBJYZLWLCZGGBTSSMDTJZXPTHYQT" +
-"GLJSCQFZKJZJQNLZWLSLHDZBWJNCJZYZSQQYCQYRZCJJWYBRTWPYFTWEXCSKDZCTBZHYZZYYJXZCFFZZMJYXXSDZZOTTBZLQWFCKSZSXFYRLNYJMB" +
-"DTHJXSQQCCSBXYYTSYFBXDZTGBCNSLCYZZPSAZYZZSCJCSHZQYDXLBPJLLMQXTYDZXSQJTZPXLCGLQTZWJBHCTSYJSFXYEJJTLBGXSXJMYJQQPFZA" +
-"SYJNTYDJXKJCDJSZCBARTDCLYJQMWNQNCLLLKBYBZZSYHQQLTWLCCXTXLLZNTYLNEWYZYXCZXXGRKRMTCNDNJTSYYSSDQDGHSDBJGHRWRQLYBGLXH" +
-"LGTGXBQJDZPYJSJYJCTMRNYMGRZJCZGJMZMGXMPRYXKJNYMSGMZJYMKMFXMLDTGFBHCJHKYLPFMDXLQJJSMTQGZSJLQDLDGJYCALCMZCSDJLLNXDJ" +
-"FFFFJCZFMZFFPFKHKGDPSXKTACJDHHZDDCRRCFQYJKQCCWJDXHWJLYLLZGCFCQDSMLZPBJJPLSBCJGGDCKKDEZSQCCKJGCGKDJTJDLZYCXKLQSCGJ" +
-"CLTFPCQCZGWPJDQYZJJBYJHSJDZWGFSJGZKQCCZLLPSPKJGQJHZZLJPLGJGJJTHJJYJZCZMLZLYQBGJWMLJKXZDZNJQSYZMLJLLJKYWXMKJLHSKJG" +
-"BMCLYYMKXJQLBMLLKMDXXKWYXYSLMLPSJQQJQXYXFJTJDXMXXLLCXQBSYJBGWYMBGGBCYXPJYGPEPFGDJGBHBNSQJYZJKJKHXQFGQZKFHYGKHDKLL" +
-"SDJQXPQYKYBNQSXQNSZSWHBSXWHXWBZZXDMNSJBSBKBBZKLYLXGWXDRWYQZMYWSJQLCJXXJXKJEQXSCYETLZHLYYYSDZPAQYZCMTLSHTZCFYZYXYL" +
-"JSDCJQAGYSLCQLYYYSHMRQQKLDXZSCSSSYDYCJYSFSJBFRSSZQSBXXPXJYSDRCKGJLGDKZJZBDKTCSYQPYHSTCLDJDHMXMCGXYZHJDDTMHLTXZXYL" +
-"YMOHYJCLTYFBQQXPFBDFHHTKSQHZYYWCNXXCRWHOWGYJLEGWDQCWGFJYCSNTMYTOLBYGWQWESJPWNMLRYDZSZTXYQPZGCWXHNGPYXSHMYQJXZTDPP" +
-"BFYHZHTJYFDZWKGKZBLDNTSXHQEEGZZYLZMMZYJZGXZXKHKSTXNXXWYLYAPSTHXDWHZYMPXAGKYDXBHNHXKDPJNMYHYLPMGOCSLNZHKXXLPZZLBML" +
-"SFBHHGYGYYGGBHSCYAQTYWLXTZQCEZYDQDQMMHTKLLSZHLSJZWFYHQSWSCWLQAZYNYTLSXTHAZNKZZSZZLAXXZWWCTGQQTDDYZTCCHYQZFLXPSLZY" +
-"GPZSZNGLNDQTBDLXGTCTAJDKYWNSYZLJHHZZCWNYYZYWMHYCHHYXHJKZWSXHZYXLYSKQYSPSLYZWMYPPKBYGLKZHTYXAXQSYSHXASMCHKDSCRSWJP" +
-"WXSGZJLWWSCHSJHSQNHCSEGNDAQTBAALZZMSSTDQJCJKTSCJAXPLGGXHHGXXZCXPDMMHLDGTYBYSJMXHMRCPXXJZCKZXSHMLQXXTTHXWZFKHCCZDY" +
-"TCJYXQHLXDHYPJQXYLSYYDZOZJNYXQEZYSQYAYXWYPDGXDDXSPPYZNDLTWRHXYDXZZJHTCXMCZLHPYYYYMHZLLHNXMYLLLMDCPPXHMXDKYCYRDLTX" +
-"JCHHZZXZLCCLYLNZSHZJZZLNNRLWHYQSNJHXYNTTTKYJPYCHHYEGKCTTWLGQRLGGTGTYGYHPYHYLQYQGCWYQKPYYYTTTTLHYHLLTYTTSPLKYZXGZW" +
-"GPYDSSZZDQXSKCQNMJJZZBXYQMJRTFFBTKHZKBXLJJKDXJTLBWFZPPTKQTZTGPDGNTPJYFALQMKGXBDCLZFHZCLLLLADPMXDJHLCCLGYHDZFGYDDG" +
-"CYYFGYDXKSSEBDHYKDKDKHNAXXYBPBYYHXZQGAFFQYJXDMLJCSQZLLPCHBSXGJYNDYBYQSPZWJLZKSDDTACTBXZDYZYPJZQSJNKKTKNJDJGYYPGTL" +
-"FYQKASDNTCYHBLWDZHBBYDWJRYGKZYHEYYFJMSDTYFZJJHGCXPLXHLDWXXJKYTCYKSSSMTWCTTQZLPBSZDZWZXGZAGYKTYWXLHLSPBCLLOQMMZSSL" +
-"CMBJCSZZKYDCZJGQQDSMCYTZQQLWZQZXSSFPTTFQMDDZDSHDTDWFHTDYZJYQJQKYPBDJYYXTLJHDRQXXXHAYDHRJLKLYTWHLLRLLRCXYLBWSRSZZS" +
-"YMKZZHHKYHXKSMDSYDYCJPBZBSQLFCXXXNXKXWYWSDZYQOGGQMMYHCDZTTFJYYBGSTTTYBYKJDHKYXBELHTYPJQNFXFDYKZHQKZBYJTZBXHFDXKDA" +
-"SWTAWAJLDYJSFHBLDNNTNQJTJNCHXFJSRFWHZFMDRYJYJWZPDJKZYJYMPCYZNYNXFBYTFYFWYGDBNZZZDNYTXZEMMQBSQEHXFZMBMFLZZSRXYMJGS" +
-"XWZJSPRYDJSJGXHJJGLJJYNZZJXHGXKYMLPYYYCXYTWQZSWHWLYRJLPXSLSXMFSWWKLCTNXNYNPSJSZHDZEPTXMYYWXYYSYWLXJQZQXZDCLEEELMC" +
-"PJPCLWBXSQHFWWTFFJTNQJHJQDXHWLBYZNFJLALKYYJLDXHHYCSTYYWNRJYXYWTRMDRQHWQCMFJDYZMHMYYXJWMYZQZXTLMRSPWWCHAQBXYGZYPXY" +
-"YRRCLMPYMGKSJSZYSRMYJSNXTPLNBAPPYPYLXYYZKYNLDZYJZCZNNLMZHHARQMPGWQTZMXXMLLHGDZXYHXKYXYCJMFFYYHJFSBSSQLXXNDYCANNMT" +
-"CJCYPRRNYTYQNYYMBMSXNDLYLYSLJRLXYSXQMLLYZLZJJJKYZZCSFBZXXMSTBJGNXYZHLXNMCWSCYZYFZLXBRNNNYLBNRTGZQYSATSWRYHYJZMZDH" +
-"ZGZDWYBSSCSKXSYHYTXXGCQGXZZSHYXJSCRHMKKBXCZJYJYMKQHZJFNBHMQHYSNJNZYBKNQMCLGQHWLZNZSWXKHLJHYYBQLBFCDSXDLDSPFZPSKJY" +
-"ZWZXZDDXJSMMEGJSCSSMGCLXXKYYYLNYPWWWGYDKZJGGGZGGSYCKNJWNJPCXBJJTQTJWDSSPJXZXNZXUMELPXFSXTLLXCLJXJJLJZXCTPSWXLYDHL" +
-"YQRWHSYCSQYYBYAYWJJJQFWQCQQCJQGXALDBZZYJGKGXPLTZYFXJLTPADKYQHPMATLCPDCKBMTXYBHKLENXDLEEGQDYMSAWHZMLJTWYGXLYQZLJEE" +
-"YYBQQFFNLYXRDSCTGJGXYYNKLLYQKCCTLHJLQMKKZGCYYGLLLJDZGYDHZWXPYSJBZKDZGYZZHYWYFQYTYZSZYEZZLYMHJJHTSMQWYZLKYYWZCSRKQ" +
-"YTLTDXWCTYJKLWSQZWBDCQYNCJSRSZJLKCDCDTLZZZACQQZZDDXYPLXZBQJYLZLLLQDDZQJYJYJZYXNYYYNYJXKXDAZWYRDLJYYYRJLXLLDYXJCYW" +
-"YWNQCCLDDNYYYNYCKCZHXXCCLGZQJGKWPPCQQJYSBZZXYJSQPXJPZBSBDSFNSFPZXHDWZTDWPPTFLZZBZDMYYPQJRSDZSQZSQXBDGCPZSWDWCSQZG" +
-"MDHZXMWWFYBPDGPHTMJTHZSMMBGZMBZJCFZWFZBBZMQCFMBDMCJXLGPNJBBXGYHYYJGPTZGZMQBQTCGYXJXLWZKYDPDYMGCFTPFXYZTZXDZXTGKMT" +
-"YBBCLBJASKYTSSQYYMSZXFJEWLXLLSZBQJJJAKLYLXLYCCTSXMCWFKKKBSXLLLLJYXTYLTJYYTDPJHNHNNKBYQNFQYYZBYYESSESSGDYHFHWTCJBS" +
-"DZZTFDMXHCNJZYMQWSRYJDZJQPDQBBSTJGGFBKJBXTGQHNGWJXJGDLLTHZHHYYYYYYSXWTYYYCCBDBPYPZYCCZYJPZYWCBDLFWZCWJDXXHYHLHWZZ" +
-"XJTCZLCDPXUJCZZZLYXJJTXPHFXWPYWXZPTDZZBDZCYHJHMLXBQXSBYLRDTGJRRCTTTHYTCZWMXFYTWWZCWJWXJYWCSKYBZSCCTZQNHXNWXXKHKFH" +
-"TSWOCCJYBCMPZZYKBNNZPBZHHZDLSYDDYTYFJPXYNGFXBYQXCBHXCPSXTYZDMKYSNXSXLHKMZXLYHDHKWHXXSSKQYHHCJYXGLHZXCSNHEKDTGZXQY" +
-"PKDHEXTYKCNYMYYYPKQYYYKXZLTHJQTBYQHXBMYHSQCKWWYLLHCYYLNNEQXQWMCFBDCCMLJGGXDQKTLXKGNQCDGZJWYJJLYHHQTTTNWCHMXCXWHWS" +
-"ZJYDJCCDBQCDGDNYXZTHCQRXCBHZTQCBXWGQWYYBXHMBYMYQTYEXMQKYAQYRGYZSLFYKKQHYSSQYSHJGJCNXKZYCXSBXYXHYYLSTYCXQTHYSMGSCP" +
-"MMGCCCCCMTZTASMGQZJHKLOSQYLSWTMXSYQKDZLJQQYPLSYCZTCQQPBBQJZCLPKHQZYYXXDTDDTSJCXFFLLCHQXMJLWCJCXTSPYCXNDTJSHJWXDQQ" +
-"JSKXYAMYLSJHMLALYKXCYYDMNMDQMXMCZNNCYBZKKYFLMCHCMLHXRCJJHSYLNMTJZGZGYWJXSRXCWJGJQHQZDQJDCJJZKJKGDZQGJJYJYLXZXXCDQ" +
-"HHHEYTMHLFSBDJSYYSHFYSTCZQLPBDRFRZTZYKYWHSZYQKWDQZRKMSYNBCRXQBJYFAZPZZEDZCJYWBCJWHYJBQSZYWRYSZPTDKZPFPBNZTKLQYHBB" +
-"ZPNPPTYZZYBQNYDCPJMMCYCQMCYFZZDCMNLFPBPLNGQJTBTTNJZPZBBZNJKLJQYLNBZQHKSJZNGGQSZZKYXSHPZSNBCGZKDDZQANZHJKDRTLZLSWJ" +
-"LJZLYWTJNDJZJHXYAYNCBGTZCSSQMNJPJYTYSWXZFKWJQTKHTZPLBHSNJZSYZBWZZZZLSYLSBJHDWWQPSLMMFBJDWAQYZTCJTBNNWZXQXCDSLQGDS" +
-"DPDZHJTQQPSWLYYJZLGYXYZLCTCBJTKTYCZJTQKBSJLGMGZDMCSGPYNJZYQYYKNXRPWSZXMTNCSZZYXYBYHYZAXYWQCJTLLCKJJTJHGDXDXYQYZZB" +
-"YWDLWQCGLZGJGQRQZCZSSBCRPCSKYDZNXJSQGXSSJMYDNSTZTPBDLTKZWXQWQTZEXNQCZGWEZKSSBYBRTSSSLCCGBPSZQSZLCCGLLLZXHZQTHCZMQ" +
-"GYZQZNMCOCSZJMMZSQPJYGQLJYJPPLDXRGZYXCCSXHSHGTZNLZWZKJCXTCFCJXLBMQBCZZWPQDNHXLJCTHYZLGYLNLSZZPCXDSCQQHJQKSXZPBAJY" +
-"EMSMJTZDXLCJYRYYNWJBNGZZTMJXLTBSLYRZPYLSSCNXPHLLHYLLQQZQLXYMRSYCXZLMMCZLTZSDWTJJLLNZGGQXPFSKYGYGHBFZPDKMWGHCXMSGD" +
-"XJMCJZDYCABXJDLNBCDQYGSKYDQTXDJJYXMSZQAZDZFSLQXYJSJZYLBTXXWXQQZBJZUFBBLYLWDSLJHXJYZJWTDJCZFQZQZZDZSXZZQLZCDZFJHYS" +
-"PYMPQZMLPPLFFXJJNZZYLSJEYQZFPFZKSYWJJJHRDJZZXTXXGLGHYDXCSKYSWMMZCWYBAZBJKSHFHJCXMHFQHYXXYZFTSJYZFXYXPZLCHMZMBXHZZ" +
-"SXYFYMNCWDABAZLXKTCSHHXKXJJZJSTHYGXSXYYHHHJWXKZXSSBZZWHHHCWTZZZPJXSNXQQJGZYZYWLLCWXZFXXYXYHXMKYYSWSQMNLNAYCYSPMJK" +
-"HWCQHYLAJJMZXHMMCNZHBHXCLXTJPLTXYJHDYYLTTXFSZHYXXSJBJYAYRSMXYPLCKDUYHLXRLNLLSTYZYYQYGYHHSCCSMZCTZQXKYQFPYYRPFFLKQ" +
-"UNTSZLLZMWWTCQQYZWTLLMLMPWMBZSSTZRBPDDTLQJJBXZCSRZQQYGWCSXFWZLXCCRSZDZMCYGGDZQSGTJSWLJMYMMZYHFBJDGYXCCPSHXNZCSBSJ" +
-"YJGJMPPWAFFYFNXHYZXZYLREMZGZCYZSSZDLLJCSQFNXZKPTXZGXJJGFMYYYSNBTYLBNLHPFZDCYFBMGQRRSSSZXYSGTZRNYDZZCDGPJAFJFZKNZB" +
-"LCZSZPSGCYCJSZLMLRSZBZZLDLSLLYSXSQZQLYXZLSKKBRXBRBZCYCXZZZEEYFGKLZLYYHGZSGZLFJHGTGWKRAAJYZKZQTSSHJJXDCYZUYJLZYRZD" +
-"QQHGJZXSSZBYKJPBFRTJXLLFQWJHYLQTYMBLPZDXTZYGBDHZZRBGXHWNJTJXLKSCFSMWLSDQYSJTXKZSCFWJLBXFTZLLJZLLQBLSQMQQCGCZFPBPH" +
-"ZCZJLPYYGGDTGWDCFCZQYYYQYSSCLXZSKLZZZGFFCQNWGLHQYZJJCZLQZZYJPJZZBPDCCMHJGXDQDGDLZQMFGPSYTSDYFWWDJZJYSXYYCZCYHZWPB" +
-"YKXRYLYBHKJKSFXTZJMMCKHLLTNYYMSYXYZPYJQYCSYCWMTJJKQYRHLLQXPSGTLYYCLJSCPXJYZFNMLRGJJTYZBXYZMSJYJHHFZQMSYXRSZCWTLRT" +
-"QZSSTKXGQKGSPTGCZNJSJCQCXHMXGGZTQYDJKZDLBZSXJLHYQGGGTHQSZPYHJHHGYYGKGGCWJZZYLCZLXQSFTGZSLLLMLJSKCTBLLZZSZMMNYTPZS" +
-"XQHJCJYQXYZXZQZCPSHKZZYSXCDFGMWQRLLQXRFZTLYSTCTMJCXJJXHJNXTNRZTZFQYHQGLLGCXSZSJDJLJCYDSJTLNYXHSZXCGJZYQPYLFHDJSBP" +
-"CCZHJJJQZJQDYBSSLLCMYTTMQTBHJQNNYGKYRQYQMZGCJKPDCGMYZHQLLSLLCLMHOLZGDYYFZSLJCQZLYLZQJESHNYLLJXGJXLYSYYYXNBZLJSSZC" +
-"QQCJYLLZLTJYLLZLLBNYLGQCHXYYXOXCXQKYJXXXYKLXSXXYQXCYKQXQCSGYXXYQXYGYTQOHXHXPYXXXULCYEYCHZZCBWQBBWJQZSCSZSSLZYLKDE" +
-"SJZWMYMCYTSDSXXSCJPQQSQYLYYZYCMDJDZYWCBTJSYDJKCYDDJLBDJJSODZYSYXQQYXDHHGQQYQHDYXWGMMMAJDYBBBPPBCMUUPLJZSMTXERXJMH" +
-"QNUTPJDCBSSMSSSTKJTSSMMTRCPLZSZMLQDSDMJMQPNQDXCFYNBFSDQXYXHYAYKQYDDLQYYYSSZBYDSLNTFQTZQPZMCHDHCZCWFDXTMYQSPHQYYXS" +
-"RGJCWTJTZZQMGWJJTJHTQJBBHWZPXXHYQFXXQYWYYHYSCDYDHHQMNMTMWCPBSZPPZZGLMZFOLLCFWHMMSJZTTDHZZYFFYTZZGZYSKYJXQYJZQBHMB" +
-"ZZLYGHGFMSHPZFZSNCLPBQSNJXZSLXXFPMTYJYGBXLLDLXPZJYZJYHHZCYWHJYLSJEXFSZZYWXKZJLUYDTMLYMQJPWXYHXSKTQJEZRPXXZHHMHWQP" +
-"WQLYJJQJJZSZCPHJLCHHNXJLQWZJHBMZYXBDHHYPZLHLHLGFWLCHYYTLHJXCJMSCPXSTKPNHQXSRTYXXTESYJCTLSSLSTDLLLWWYHDHRJZSFGXTSY" +
-"CZYNYHTDHWJSLHTZDQDJZXXQHGYLTZPHCSQFCLNJTCLZPFSTPDYNYLGMJLLYCQHYSSHCHYLHQYQTMZYPBYWRFQYKQSYSLZDQJMPXYYSSRHZJNYWTQ" +
-"DFZBWWTWWRXCWHGYHXMKMYYYQMSMZHNGCEPMLQQMTCWCTMMPXJPJJHFXYYZSXZHTYBMSTSYJTTQQQYYLHYNPYQZLCYZHZWSMYLKFJXLWGXYPJYTYS" +
-"YXYMZCKTTWLKSMZSYLMPWLZWXWQZSSAQSYXYRHSSNTSRAPXCPWCMGDXHXZDZYFJHGZTTSBJHGYZSZYSMYCLLLXBTYXHBBZJKSSDMALXHYCFYGMQYP" +
-"JYCQXJLLLJGSLZGQLYCJCCZOTYXMTMTTLLWTGPXYMZMKLPSZZZXHKQYSXCTYJZYHXSHYXZKXLZWPSQPYHJWPJPWXQQYLXSDHMRSLZZYZWTTCYXYSZ" +
-"ZSHBSCCSTPLWSSCJCHNLCGCHSSPHYLHFHHXJSXYLLNYLSZDHZXYLSXLWZYKCLDYAXZCMDDYSPJTQJZLNWQPSSSWCTSTSZLBLNXSMNYYMJQBQHRZWT" +
-"YYDCHQLXKPZWBGQYBKFCMZWPZLLYYLSZYDWHXPSBCMLJBSCGBHXLQHYRLJXYSWXWXZSLDFHLSLYNJLZYFLYJYCDRJLFSYZFSLLCQYQFGJYHYXZLYL" +
-"MSTDJCYHBZLLNWLXXYGYYHSMGDHXXHHLZZJZXCZZZCYQZFNGWPYLCPKPYYPMCLQKDGXZGGWQBDXZZKZFBXXLZXJTPJPTTBYTSZZDWSLCHZHSLTYXH" +
-"QLHYXXXYYZYSWTXZKHLXZXZPYHGCHKCFSYHUTJRLXFJXPTZTWHPLYXFCRHXSHXKYXXYHZQDXQWULHYHMJTBFLKHTXCWHJFWJCFPQRYQXCYYYQYGRP" +
-"YWSGSUNGWCHKZDXYFLXXHJJBYZWTSXXNCYJJYMSWZJQRMHXZWFQSYLZJZGBHYNSLBGTTCSYBYXXWXYHXYYXNSQYXMQYWRGYQLXBBZLJSYLPSYTJZY" +
-"HYZAWLRORJMKSCZJXXXYXCHDYXRYXXJDTSQFXLYLTSFFYXLMTYJMJUYYYXLTZCSXQZQHZXLYYXZHDNBRXXXJCTYHLBRLMBRLLAXKYLLLJLYXXLYCR" +
-"YLCJTGJCMTLZLLCYZZPZPCYAWHJJFYBDYYZSMPCKZDQYQPBPCJPDCYZMDPBCYYDYCNNPLMTMLRMFMMGWYZBSJGYGSMZQQQZTXMKQWGXLLPJGZBQCD" +
-"JJJFPKJKCXBLJMSWMDTQJXLDLPPBXCWRCQFBFQJCZAHZGMYKPHYYHZYKNDKZMBPJYXPXYHLFPNYYGXJDBKXNXHJMZJXSTRSTLDXSKZYSYBZXJLXYS" +
-"LBZYSLHXJPFXPQNBYLLJQKYGZMCYZZYMCCSLCLHZFWFWYXZMWSXTYNXJHPYYMCYSPMHYSMYDYSHQYZCHMJJMZCAAGCFJBBHPLYZYLXXSDJGXDHKXX" +
-"TXXNBHRMLYJSLTXMRHNLXQJXYZLLYSWQGDLBJHDCGJYQYCMHWFMJYBMBYJYJWYMDPWHXQLDYGPDFXXBCGJSPCKRSSYZJMSLBZZJFLJJJLGXZGYXYX" +
-"LSZQYXBEXYXHGCXBPLDYHWETTWWCJMBTXCHXYQXLLXFLYXLLJLSSFWDPZSMYJCLMWYTCZPCHQEKCQBWLCQYDPLQPPQZQFJQDJHYMMCXTXDRMJWRHX" +
-"CJZYLQXDYYNHYYHRSLSRSYWWZJYMTLTLLGTQCJZYABTCKZCJYCCQLJZQXALMZYHYWLWDXZXQDLLQSHGPJFJLJHJABCQZDJGTKHSSTCYJLPSWZLXZX" +
-"RWGLDLZRLZXTGSLLLLZLYXXWGDZYGBDPHZPBRLWSXQBPFDWOFMWHLYPCBJCCLDMBZPBZZLCYQXLDOMZBLZWPDWYYGDSTTHCSQSCCRSSSYSLFYBFNT" +
-"YJSZDFNDPDHDZZMBBLSLCMYFFGTJJQWFTMTPJWFNLBZCMMJTGBDZLQLPYFHYYMJYLSDCHDZJWJCCTLJCLDTLJJCPDDSQDSSZYBNDBJLGGJZXSXNLY" +
-"CYBJXQYCBYLZCFZPPGKCXZDZFZTJJFJSJXZBNZYJQTTYJYHTYCZHYMDJXTTMPXSPLZCDWSLSHXYPZGTFMLCJTYCBPMGDKWYCYZCDSZZYHFLYCTYGW" +
-"HKJYYLSJCXGYWJCBLLCSNDDBTZBSCLYZCZZSSQDLLMQYYHFSLQLLXFTYHABXGWNYWYYPLLSDLDLLBJCYXJZMLHLJDXYYQYTDLLLBUGBFDFBBQJZZM" +
-"DPJHGCLGMJJPGAEHHBWCQXAXHHHZCHXYPHJAXHLPHJPGPZJQCQZGJJZZUZDMQYYBZZPHYHYBWHAZYJHYKFGDPFQSDLZMLJXKXGALXZDAGLMDGXMWZ" +
-"QYXXDXXPFDMMSSYMPFMDMMKXKSYZYSHDZKXSYSMMZZZMSYDNZZCZXFPLSTMZDNMXCKJMZTYYMZMZZMSXHHDCZJEMXXKLJSTLWLSQLYJZLLZJSSDPP" +
-"MHNLZJCZYHMXXHGZCJMDHXTKGRMXFWMCGMWKDTKSXQMMMFZZYDKMSCLCMPCGMHSPXQPZDSSLCXKYXTWLWJYAHZJGZQMCSNXYYMMPMLKJXMHLMLQMX" +
-"CTKZMJQYSZJSYSZHSYJZJCDAJZYBSDQJZGWZQQXFKDMSDJLFWEHKZQKJPEYPZYSZCDWYJFFMZZYLTTDZZEFMZLBNPPLPLPEPSZALLTYLKCKQZKGEN" +
-"QLWAGYXYDPXLHSXQQWQCQXQCLHYXXMLYCCWLYMQYSKGCHLCJNSZKPYZKCQZQLJPDMDZHLASXLBYDWQLWDNBQCRYDDZTJYBKBWSZDXDTNPJDTCTQDF" +
-"XQQMGNXECLTTBKPWSLCTYQLPWYZZKLPYGZCQQPLLKCCYLPQMZCZQCLJSLQZDJXLDDHPZQDLJJXZQDXYZQKZLJCYQDYJPPYPQYKJYRMPCBYMCXKLLZ" +
-"LLFQPYLLLMBSGLCYSSLRSYSQTMXYXZQZFDZUYSYZTFFMZZSMZQHZSSCCMLYXWTPZGXZJGZGSJSGKDDHTQGGZLLBJDZLCBCHYXYZHZFYWXYZYMSDBZ" +
-"ZYJGTSMTFXQYXQSTDGSLNXDLRYZZLRYYLXQHTXSRTZNGZXBNQQZFMYKMZJBZYMKBPNLYZPBLMCNQYZZZSJZHJCTZKHYZZJRDYZHNPXGLFZTLKGJTC" +
-"TSSYLLGZRZBBQZZKLPKLCZYSSUYXBJFPNJZZXCDWXZYJXZZDJJKGGRSRJKMSMZJLSJYWQSKYHQJSXPJZZZLSNSHRNYPZTWCHKLPSRZLZXYJQXQKYS" +
-"JYCZTLQZYBBYBWZPQDWWYZCYTJCJXCKCWDKKZXSGKDZXWWYYJQYYTCYTDLLXWKCZKKLCCLZCQQDZLQLCSFQCHQHSFSMQZZLNBJJZBSJHTSZDYSJQJ" +
-"PDLZCDCWJKJZZLPYCGMZWDJJBSJQZSYZYHHXJPBJYDSSXDZNCGLQMBTSFSBPDZDLZNFGFJGFSMPXJQLMBLGQCYYXBQKDJJQYRFKZTJDHCZKLBSDZC" +
-"FJTPLLJGXHYXZCSSZZXSTJYGKGCKGYOQXJPLZPBPGTGYJZGHZQZZLBJLSQFZGKQQJZGYCZBZQTLDXRJXBSXXPZXHYZYCLWDXJJHXMFDZPFZHQHQMQ" +
-"GKSLYHTYCGFRZGNQXCLPDLBZCSCZQLLJBLHBZCYPZZPPDYMZZSGYHCKCPZJGSLJLNSCDSLDLXBMSTLDDFJMKDJDHZLZXLSZQPQPGJLLYBDSZGQLBZ" +
-"LSLKYYHZTTNTJYQTZZPSZQZTLLJTYYLLQLLQYZQLBDZLSLYYZYMDFSZSNHLXZNCZQZPBWSKRFBSYZMTHBLGJPMCZZLSTLXSHTCSYZLZBLFEQHLXFL" +
-"CJLYLJQCBZLZJHHSSTBRMHXZHJZCLXFNBGXGTQJCZTMSFZKJMSSNXLJKBHSJXNTNLZDNTLMSJXGZJYJCZXYJYJWRWWQNZTNFJSZPZSHZJFYRDJSFS" +
-"ZJZBJFZQZZHZLXFYSBZQLZSGYFTZDCSZXZJBQMSZKJRHYJZCKMJKHCHGTXKXQGLXPXFXTRTYLXJXHDTSJXHJZJXZWZLCQSBTXWXGXTXXHXFTSDKFJ" +
-"HZYJFJXRZSDLLLTQSQQZQWZXSYQTWGWBZCGZLLYZBCLMQQTZHZXZXLJFRMYZFLXYSQXXJKXRMQDZDMMYYBSQBHGZMWFWXGMXLZPYYTGZYCCDXYZXY" +
-"WGSYJYZNBHPZJSQSYXSXRTFYZGRHZTXSZZTHCBFCLSYXZLZQMZLMPLMXZJXSFLBYZMYQHXJSXRXSQZZZSSLYFRCZJRCRXHHZXQYDYHXSJJHZCXZBT" +
-"YNSYSXJBQLPXZQPYMLXZKYXLXCJLCYSXXZZLXDLLLJJYHZXGYJWKJRWYHCPSGNRZLFZWFZZNSXGXFLZSXZZZBFCSYJDBRJKRDHHGXJLJJTGXJXXST" +
-"JTJXLYXQFCSGSWMSBCTLQZZWLZZKXJMLTMJYHSDDBXGZHDLBMYJFRZFSGCLYJBPMLYSMSXLSZJQQHJZFXGFQFQBPXZGYYQXGZTCQWYLTLGWSGWHRL" +
-"FSFGZJMGMGBGTJFSYZZGZYZAFLSSPMLPFLCWBJZCLJJMZLPJJLYMQDMYYYFBGYGYZMLYZDXQYXRQQQHSYYYQXYLJTYXFSFSLLGNQCYHYCWFHCCCFX" +
-"PYLYPLLZYXXXXXKQHHXSHJZCFZSCZJXCPZWHHHHHAPYLQALPQAFYHXDYLUKMZQGGGDDESRNNZLTZGCHYPPYSQJJHCLLJTOLNJPZLJLHYMHEYDYDSQ" +
-"YCDDHGZUNDZCLZYZLLZNTNYZGSLHSLPJJBDGWXPCDUTJCKLKCLWKLLCASSTKZZDNQNTTLYYZSSYSSZZRYLJQKCQDHHCRXRZYDGRGCWCGZQFFFPPJF" +
-"ZYNAKRGYWYQPQXXFKJTSZZXSWZDDFBBXTBGTZKZNPZZPZXZPJSZBMQHKCYXYLDKLJNYPKYGHGDZJXXEAHPNZKZTZCMXCXMMJXNKSZQNMNLWBWWXJK" +
-"YHCPSTMCSQTZJYXTPCTPDTNNPGLLLZSJLSPBLPLQHDTNJNLYYRSZFFJFQWDPHZDWMRZCCLODAXNSSNYZRESTYJWJYJDBCFXNMWTTBYLWSTSZGYBLJ" +
-"PXGLBOCLHPCBJLTMXZLJYLZXCLTPNCLCKXTPZJSWCYXSFYSZDKNTLBYJCYJLLSTGQCBXRYZXBXKLYLHZLQZLNZCXWJZLJZJNCJHXMNZZGJZZXTZJX" +
-"YCYYCXXJYYXJJXSSSJSTSSTTPPGQTCSXWZDCSYFPTFBFHFBBLZJCLZZDBXGCXLQPXKFZFLSYLTUWBMQJHSZBMDDBCYSCCLDXYCDDQLYJJWMQLLCSG" +
-"LJJSYFPYYCCYLTJANTJJPWYCMMGQYYSXDXQMZHSZXPFTWWZQSWQRFKJLZJQQYFBRXJHHFWJJZYQAZMYFRHCYYBYQWLPEXCCZSTYRLTTDMQLYKMBBG" +
-"MYYJPRKZNPBSXYXBHYZDJDNGHPMFSGMWFZMFQMMBCMZZCJJLCNUXYQLMLRYGQZCYXZLWJGCJCGGMCJNFYZZJHYCPRRCMTZQZXHFQGTJXCCJEAQCRJ" +
-"YHPLQLSZDJRBCQHQDYRHYLYXJSYMHZYDWLDFRYHBPYDTSSCNWBXGLPZMLZZTQSSCPJMXXYCSJYTYCGHYCJWYRXXLFEMWJNMKLLSWTXHYYYNCMMCWJ" +
-"DQDJZGLLJWJRKHPZGGFLCCSCZMCBLTBHBQJXQDSPDJZZGKGLFQYWBZYZJLTSTDHQHCTCBCHFLQMPWDSHYYTQWCNZZJTLBYMBPDYYYXSQKXWYYFLXX" +
-"NCWCXYPMAELYKKJMZZZBRXYYQJFLJPFHHHYTZZXSGQQMHSPGDZQWBWPJHZJDYSCQWZKTXXSQLZYYMYSDZGRXCKKUJLWPYSYSCSYZLRMLQSYLJXBCX" +
-"TLWDQZPCYCYKPPPNSXFYZJJRCEMHSZMSXLXGLRWGCSTLRSXBZGBZGZTCPLUJLSLYLYMTXMTZPALZXPXJTJWTCYYZLBLXBZLQMYLXPGHDSLSSDMXMB" +
-"DZZSXWHAMLCZCPJMCNHJYSNSYGCHSKQMZZQDLLKABLWJXSFMOCDXJRRLYQZKJMYBYQLYHETFJZFRFKSRYXFJTWDSXXSYSQJYSLYXWJHSNLXYYXHBH" +
-"AWHHJZXWMYLJCSSLKYDZTXBZSYFDXGXZJKHSXXYBSSXDPYNZWRPTQZCZENYGCXQFJYKJBZMLJCMQQXUOXSLYXXLYLLJDZBTYMHPFSTTQQWLHOKYBL" +
-"ZZALZXQLHZWRRQHLSTMYPYXJJXMQSJFNBXYXYJXXYQYLTHYLQYFMLKLJTMLLHSZWKZHLJMLHLJKLJSTLQXYLMBHHLNLZXQJHXCFXXLHYHJJGBYZZK" +
-"BXSCQDJQDSUJZYYHZHHMGSXCSYMXFEBCQWWRBPYYJQTYZCYQYQQZYHMWFFHGZFRJFCDPXNTQYZPDYKHJLFRZXPPXZDBBGZQSTLGDGYLCQMLCHHMFY" +
-"WLZYXKJLYPQHSYWMQQGQZMLZJNSQXJQSYJYCBEHSXFSZPXZWFLLBCYYJDYTDTHWZSFJMQQYJLMQXXLLDTTKHHYBFPWTYYSQQWNQWLGWDEBZWCMYGC" +
-"ULKJXTMXMYJSXHYBRWFYMWFRXYQMXYSZTZZTFYKMLDHQDXWYYNLCRYJBLPSXCXYWLSPRRJWXHQYPHTYDNXHHMMYWYTZCSQMTSSCCDALWZTCPQPYJL" +
-"LQZYJSWXMZZMMYLMXCLMXCZMXMZSQTZPPQQBLPGXQZHFLJJHYTJSRXWZXSCCDLXTYJDCQJXSLQYCLZXLZZXMXQRJMHRHZJBHMFLJLMLCLQNLDXZLL" +
-"LPYPSYJYSXCQQDCMQJZZXHNPNXZMEKMXHYKYQLXSXTXJYYHWDCWDZHQYYBGYBCYSCFGPSJNZDYZZJZXRZRQJJYMCANYRJTLDPPYZBSTJKXXZYPFDW" +
-"FGZZRPYMTNGXZQBYXNBUFNQKRJQZMJEGRZGYCLKXZDSKKNSXKCLJSPJYYZLQQJYBZSSQLLLKJXTBKTYLCCDDBLSPPFYLGYDTZJYQGGKQTTFZXBDKT" +
-"YYHYBBFYTYYBCLPDYTGDHRYRNJSPTCSNYJQHKLLLZSLYDXXWBCJQSPXBPJZJCJDZFFXXBRMLAZHCSNDLBJDSZBLPRZTSWSBXBCLLXXLZDJZSJPYLY" +
-"XXYFTFFFBHJJXGBYXJPMMMPSSJZJMTLYZJXSWXTYLEDQPJMYGQZJGDJLQJWJQLLSJGJGYGMSCLJJXDTYGJQJQJCJZCJGDZZSXQGSJGGCXHQXSNQLZ" +
-"ZBXHSGZXCXYLJXYXYYDFQQJHJFXDHCTXJYRXYSQTJXYEFYYSSYYJXNCYZXFXMSYSZXYYSCHSHXZZZGZZZGFJDLTYLNPZGYJYZYYQZPBXQBDZTZCZY" +
-"XXYHHSQXSHDHGQHJHGYWSZTMZMLHYXGEBTYLZKQWYTJZRCLEKYSTDBCYKQQSAYXCJXWWGSBHJYZYDHCSJKQCXSWXFLTYNYZPZCCZJQTZWJQDZZZQZ" +
-"LJJXLSBHPYXXPSXSHHEZTXFPTLQYZZXHYTXNCFZYYHXGNXMYWXTZSJPTHHGYMXMXQZXTSBCZYJYXXTYYZYPCQLMMSZMJZZLLZXGXZAAJZYXJMZXWD" +
-"XZSXZDZXLEYJJZQBHZWZZZQTZPSXZTDSXJJJZNYAZPHXYYSRNQDTHZHYYKYJHDZXZLSWCLYBZYECWCYCRYLCXNHZYDZYDYJDFRJJHTRSQTXYXJRJH" +
-"OJYNXELXSFSFJZGHPZSXZSZDZCQZBYYKLSGSJHCZSHDGQGXYZGXCHXZJWYQWGYHKSSEQZZNDZFKWYSSTCLZSTSYMCDHJXXYWEYXCZAYDMPXMDSXYB" +
-"SQMJMZJMTZQLPJYQZCGQHXJHHLXXHLHDLDJQCLDWBSXFZZYYSCHTYTYYBHECXHYKGJPXHHYZJFXHWHBDZFYZBCAPNPGNYDMSXHMMMMAMYNBYJTMPX" +
-"YYMCTHJBZYFCGTYHWPHFTWZZEZSBZEGPFMTSKFTYCMHFLLHGPZJXZJGZJYXZSBBQSCZZLZCCSTPGXMJSFTCCZJZDJXCYBZLFCJSYZFGSZLYBCWZZB" +
-"YZDZYPSWYJZXZBDSYUXLZZBZFYGCZXBZHZFTPBGZGEJBSTGKDMFHYZZJHZLLZZGJQZLSFDJSSCBZGPDLFZFZSZYZYZSYGCXSNXXCHCZXTZZLJFZGQ" +
-"SQYXZJQDCCZTQCDXZJYQJQCHXZTDLGSCXZSYQJQTZWLQDQZTQCHQQJZYEZZZPBWKDJFCJPZTYPQYQTTYNLMBDKTJZPQZQZZFPZSBNJLGYJDXJDZZK" +
-"ZGQKXDLPZJTCJDQBXDJQJSTCKNXBXZMSLYJCQMTJQWWCJQNJNLLLHJCWQTBZQYDZCZPZZDZYDDCYZZZCCJTTJFZDPRRTZTJDCQTQZDTJNPLZBCLLC" +
-"TZSXKJZQZPZLBZRBTJDCXFCZDBCCJJLTQQPLDCGZDBBZJCQDCJWYNLLZYZCCDWLLXWZLXRXNTQQCZXKQLSGDFQTDDGLRLAJJTKUYMKQLLTZYTDYYC" +
-"ZGJWYXDXFRSKSTQTENQMRKQZHHQKDLDAZFKYPBGGPZREBZZYKZZSPEGJXGYKQZZZSLYSYYYZWFQZYLZZLZHWCHKYPQGNPGBLPLRRJYXCCSYYHSFZF" +
-"YBZYYTGZXYLXCZWXXZJZBLFFLGSKHYJZEYJHLPLLLLCZGXDRZELRHGKLZZYHZLYQSZZJZQLJZFLNBHGWLCZCFJYSPYXZLZLXGCCPZBLLCYBBBBUBB" +
-"CBPCRNNZCZYRBFSRLDCGQYYQXYGMQZWTZYTYJXYFWTEHZZJYWLCCNTZYJJZDEDPZDZTSYQJHDYMBJNYJZLXTSSTPHNDJXXBYXQTZQDDTJTDYYTGWS" +
-"CSZQFLSHLGLBCZPHDLYZJYCKWTYTYLBNYTSDSYCCTYSZYYEBHEXHQDTWNYGYCLXTSZYSTQMYGZAZCCSZZDSLZCLZRQXYYELJSBYMXSXZTEMBBLLYY" +
-"LLYTDQYSHYMRQWKFKBFXNXSBYCHXBWJYHTQBPBSBWDZYLKGZSKYHXQZJXHXJXGNLJKZLYYCDXLFYFGHLJGJYBXQLYBXQPQGZTZPLNCYPXDJYQYDYM" +
-"RBESJYYHKXXSTMXRCZZYWXYQYBMCLLYZHQYZWQXDBXBZWZMSLPDMYSKFMZKLZCYQYCZLQXFZZYDQZPZYGYJYZMZXDZFYFYTTQTZHGSPCZMLCCYTZX" +
-"JCYTJMKSLPZHYSNZLLYTPZCTZZCKTXDHXXTQCYFKSMQCCYYAZHTJPCYLZLYJBJXTPNYLJYYNRXSYLMMNXJSMYBCSYSYLZYLXJJQYLDZLPQBFZZBLF" +
-"NDXQKCZFYWHGQMRDSXYCYTXNQQJZYYPFZXDYZFPRXEJDGYQBXRCNFYYQPGHYJDYZXGRHTKYLNWDZNTSMPKLBTHBPYSZBZTJZSZZJTYYXZPHSSZZBZ" +
-"CZPTQFZMYFLYPYBBJQXZMXXDJMTSYSKKBJZXHJCKLPSMKYJZCXTMLJYXRZZQSLXXQPYZXMKYXXXJCLJPRMYYGADYSKQLSNDHYZKQXZYZTCGHZTLML" +
-"WZYBWSYCTBHJHJFCWZTXWYTKZLXQSHLYJZJXTMPLPYCGLTBZZTLZJCYJGDTCLKLPLLQPJMZPAPXYZLKKTKDZCZZBNZDYDYQZJYJGMCTXLTGXSZLML" +
-"HBGLKFWNWZHDXUHLFMKYSLGXDTWWFRJEJZTZHYDXYKSHWFZCQSHKTMQQHTZHYMJDJSKHXZJZBZZXYMPAGQMSTPXLSKLZYNWRTSQLSZBPSPSGZWYHT" +
-"LKSSSWHZZLYYTNXJGMJSZSUFWNLSOZTXGXLSAMMLBWLDSZYLAKQCQCTMYCFJBSLXCLZZCLXXKSBZQCLHJPSQPLSXXCKSLNHPSFQQYTXYJZLQLDXZQ" +
-"JZDYYDJNZPTUZDSKJFSLJHYLZSQZLBTXYDGTQFDBYAZXDZHZJNHHQBYKNXJJQCZMLLJZKSPLDYCLBBLXKLELXJLBQYCXJXGCNLCQPLZLZYJTZLJGY" +
-"ZDZPLTQCSXFDMNYCXGBTJDCZNBGBQYQJWGKFHTNPYQZQGBKPBBYZMTJDYTBLSQMPSXTBNPDXKLEMYYCJYNZCTLDYKZZXDDXHQSHDGMZSJYCCTAYRZ" +
-"LPYLTLKXSLZCGGEXCLFXLKJRTLQJAQZNCMBYDKKCXGLCZJZXJHPTDJJMZQYKQSECQZDSHHADMLZFMMZBGNTJNNLGBYJBRBTMLBYJDZXLCJLPLDLPC" +
-"QDHLXZLYCBLCXZZJADJLNZMMSSSMYBHBSQKBHRSXXJMXSDZNZPXLGBRHWGGFCXGMSKLLTSJYYCQLTSKYWYYHYWXBXQYWPYWYKQLSQPTNTKHQCWDQK" +
-"TWPXXHCPTHTWUMSSYHBWCRWXHJMKMZNGWTMLKFGHKJYLSYYCXWHYECLQHKQHTTQKHFZLDXQWYZYYDESBPKYRZPJFYYZJCEQDZZDLATZBBFJLLCXDL" +
-"MJSSXEGYGSJQXCWBXSSZPDYZCXDNYXPPZYDLYJCZPLTXLSXYZYRXCYYYDYLWWNZSAHJSYQYHGYWWAXTJZDAXYSRLTDPSSYYFNEJDXYZHLXLLLZQZS" +
-"JNYQYQQXYJGHZGZCYJCHZLYCDSHWSHJZYJXCLLNXZJJYYXNFXMWFPYLCYLLABWDDHWDXJMCXZTZPMLQZHSFHZYNZTLLDYWLSLXHYMMYLMBWWKYXYA" +
-"DTXYLLDJPYBPWUXJMWMLLSAFDLLYFLBHHHBQQLTZJCQJLDJTFFKMMMBYTHYGDCQRDDWRQJXNBYSNWZDBYYTBJHPYBYTTJXAAHGQDQTMYSTQXKBTZP" +
-"KJLZRBEQQSSMJJBDJOTGTBXPGBKTLHQXJJJCTHXQDWJLWRFWQGWSHCKRYSWGFTGYGBXSDWDWRFHWYTJJXXXJYZYSLPYYYPAYXHYDQKXSHXYXGSKQH" +
-"YWFDDDPPLCJLQQEEWXKSYYKDYPLTJTHKJLTCYYHHJTTPLTZZCDLTHQKZXQYSTEEYWYYZYXXYYSTTJKLLPZMCYHQGXYHSRMBXPLLNQYDQHXSXXWGDQ" +
-"BSHYLLPJJJTHYJKYPPTHYYKTYEZYENMDSHLCRPQFDGFXZPSFTLJXXJBSWYYSKSFLXLPPLBBBLBSFXFYZBSJSSYLPBBFFFFSSCJDSTZSXZRYYSYFFS" +
-"YZYZBJTBCTSBSDHRTJJBYTCXYJEYLXCBNEBJDSYXYKGSJZBXBYTFZWGENYHHTHZHHXFWGCSTBGXKLSXYWMTMBYXJSTZSCDYQRCYTWXZFHMYMCXLZN" +
-"SDJTTTXRYCFYJSBSDYERXJLJXBBDEYNJGHXGCKGSCYMBLXJMSZNSKGXFBNBPTHFJAAFXYXFPXMYPQDTZCXZZPXRSYWZDLYBBKTYQPQJPZYPZJZNJP" +
-"ZJLZZFYSBTTSLMPTZRTDXQSJEHBZYLZDHLJSQMLHTXTJECXSLZZSPKTLZKQQYFSYGYWPCPQFHQHYTQXZKRSGTTSQCZLPTXCDYYZXSQZSLXLZMYCPC" +
-"QBZYXHBSXLZDLTCDXTYLZJYYZPZYZLTXJSJXHLPMYTXCQRBLZSSFJZZTNJYTXMYJHLHPPLCYXQJQQKZZSCPZKSWALQSBLCCZJSXGWWWYGYKTJBBZT" +
-"DKHXHKGTGPBKQYSLPXPJCKBMLLXDZSTBKLGGQKQLSBKKTFXRMDKBFTPZFRTBBRFERQGXYJPZSSTLBZTPSZQZSJDHLJQLZBPMSMMSXLQQNHKNBLRDD" +
-"NXXDHDDJCYYGYLXGZLXSYGMQQGKHBPMXYXLYTQWLWGCPBMQXCYZYDRJBHTDJYHQSHTMJSBYPLWHLZFFNYPMHXXHPLTBQPFBJWQDBYGPNZTPFZJGSD" +
-"DTQSHZEAWZZYLLTYYBWJKXXGHLFKXDJTMSZSQYNZGGSWQSPHTLSSKMCLZXYSZQZXNCJDQGZDLFNYKLJCJLLZLMZZNHYDSSHTHZZLZZBBHQZWWYCRZ" +
-"HLYQQJBEYFXXXWHSRXWQHWPSLMSSKZTTYGYQQWRSLALHMJTQJSMXQBJJZJXZYZKXBYQXBJXSHZTSFJLXMXZXFGHKZSZGGYLCLSARJYHSLLLMZXELG" +
-"LXYDJYTLFBHBPNLYZFBBHPTGJKWETZHKJJXZXXGLLJLSTGSHJJYQLQZFKCGNNDJSSZFDBCTWWSEQFHQJBSAQTGYPQLBXBMMYWXGSLZHGLZGQYFLZB" +
-"YFZJFRYSFMBYZHQGFWZSYFYJJPHZBYYZFFWODGRLMFTWLBZGYCQXCDJYGZYYYYTYTYDWEGAZYHXJLZYYHLRMGRXXZCLHNELJJTJTPWJYBJJBXJJTJ" +
-"TEEKHWSLJPLPSFYZPQQBDLQJJTYYQLYZKDKSQJYYQZLDQTGJQYZJSUCMRYQTHTEJMFCTYHYPKMHYZWJDQFHYYXWSHCTXRLJHQXHCCYYYJLTKTTYTM" +
-"XGTCJTZAYYOCZLYLBSZYWJYTSJYHBYSHFJLYGJXXTMZYYLTXXYPZLXYJZYZYYPNHMYMDYYLBLHLSYYQQLLNJJYMSOYQBZGDLYXYLCQYXTSZEGXHZG" +
-"LHWBLJHEYXTWQMAKBPQCGYSHHEGQCMWYYWLJYJHYYZLLJJYLHZYHMGSLJLJXCJJYCLYCJPCPZJZJMMYLCQLNQLJQJSXYJMLSZLJQLYCMMHCFMMFPQ" +
-"QMFYLQMCFFQMMMMHMZNFHHJGTTHHKHSLNCHHYQDXTMMQDCYZYXYQMYQYLTDCYYYZAZZCYMZYDLZFFFMMYCQZWZZMABTBYZTDMNZZGGDFTYPCGQYTT" +
-"SSFFWFDTZQSSYSTWXJHXYTSXXYLBYQHWWKXHZXWZNNZZJZJJQJCCCHYYXBZXZCYZTLLCQXYNJYCYYCYNZZQYYYEWYCZDCJYCCHYJLBTZYYCQWMPWP" +
-"YMLGKDLDLGKQQBGYCHJXY";
-// 375 polyphonic words are included here
-let oMultiDiff = { "19969": "DZ", "19975": "WM", "19988": "QJ", "20048": "YL", "20056": "SC", "20060": "NM",
-  "20094": "QG", "20127": "QJ", "20167": "QC", "20193": "YG", "20250": "KH", "20256": "ZC", "20282": "SC",
-  "20285": "QJG", "20291": "TD", "20314": "YD", "20340": "NE", "20375": "TD", "20389": "YJ", "20391": "CZ",
-  "20415": "PB", "20446": "YS", "20447": "SQ", "20504": "TC", "20608": "KG", "20854": "QJ", "20857": "ZC",
-  "20911": "PF",  "20985": "AW", "21032": "PB", "21048": "XQ", "21049": "SC", "21089": "YS", "21119": "JC",
-  "21242": "SB", "21273": "SC", "21305": "YP", "21306": "QO", "21330": "ZC", "21333": "SDC", "21345": "QK",
-  "21378": "CA", "21397": "SC", "21414": "XS", "21442": "SC", "21477": "JG", "21480": "TD", "21484": "ZS",
-  "21494": "YX", "21505": "YX", "21512": "HG", "21523": "XH", "21537": "PB", "21542": "PF", "21549": "KH",
-  "21571": "E", "21574": "DA", "21588": "TD", "21589": "O", "21618": "ZC", "21621": "KHA", "21632": "ZJ",
-  "21654": "KG", "21679": "LKG", "21683": "KH", "21710": "A", "21719": "YH", "21734": "WOE", "21769": "A",
-  "21780": "WN", "21804": "XH", "21834": "A", "21899": "ZD", "21903": "RN", "21908": "WO", "21939": "ZC",
-  "21956": "SA", "21964": "YA", "21970": "TD", "22003": "A", "22031": "JG", "22040": "XS", "22060": "ZC",
-  "22066": "ZC", "22079": "MH", "22129": "XJ", "22179": "XA", "22237": "NJ", "22244": "TD", "22280": "JQ",
-  "22300": "YH", "22313": "XW", "22331": "YQ", "22343": "YJ", "22351": "PH", "22395": "DC", "22412": "TD",
-  "22484": "PB", "22500": "PB", "22534": "ZD", "22549": "DH", "22561": "PB", "22612": "TD", "22771": "KQ",
-  "22831": "HB", "22841": "JG", "22855": "QJ", "22865": "XQ", "23013": "ML", "23081": "WM", "23487": "SX",
-  "23558": "QJ", "23561": "YW", "23586": "YW", "23614": "YW", "23615": "SN", "23631": "PB", "23646": "ZS",
-  "23663": "ZT", "23673": "YG", "23762": "TD", "23769": "ZS", "23780": "QJ", "23884": "QK", "24055": "XH",
-  "24113": "DC", "24162": "ZC", "24191": "GA", "24273": "QJ", "24324": "NL", "24377": "TD", "24378": "QJ",
-  "24439": "PF", "24554": "ZS", "24683": "TD", "24694": "WE", "24733": "LK", "24925": "TN", "25094": "ZG",
-  "25100": "XQ", "25103": "XH", "25153": "PB", "25170": "PB", "25179": "KG", "25203": "PB", "25240": "ZS",
-  "25282": "FB", "25303": "NA", "25324": "KG", "25341": "ZY", "25373": "WZ", "25375": "XJ", "25384": "A",
-  "25457": "A", "25528": "SD", "25530": "SC", "25552": "TD", "25774": "ZC", "25874": "ZC", "26044": "YW",
-  "26080": "WM", "26292": "PB", "26333": "PB", "26355": "ZY", "26366": "CZ", "26397": "ZC", "26399": "QJ",
-  "26415": "ZS", "26451": "SB", "26526": "ZC", "26552": "JG", "26561": "TD", "26588": "JG", "26597": "CZ",
-  "26629": "ZS", "26638": "YL", "26646": "XQ", "26653": "KG", "26657": "XJ", "26727": "HG", "26894": "ZC",
-  "26937": "ZS", "26946": "ZC", "26999": "KJ", "27099": "KJ", "27449": "YQ", "27481": "XS", "27542": "ZS",
-  "27663": "ZS", "27748": "TS", "27784": "SC", "27788": "ZD", "27795": "TD", "27812": "O", "27850": "PB",
-  "27852": "MB", "27895": "SL", "27898": "PL", "27973": "QJ", "27981": "KH", "27986": "HX", "27994": "XJ",
-  "28044": "YC", "28065": "WG", "28177": "SM", "28267": "QJ", "28291": "KH", "28337": "ZQ", "28463": "TL",
-  "28548": "DC", "28601": "TD", "28689": "PB", "28805": "JG", "28820": "QG", "28846": "PB", "28952": "TD",
-  "28975": "ZC", "29100": "A", "29325": "QJ", "29575": "SL", "29602": "FB", "30010": "TD", "30044": "CX",
-  "30058": "PF", "30091": "YSP", "30111": "YN", "30229": "XJ", "30427": "SC", "30465": "SX", "30631": "YQ",
-  "30655": "QJ", "30684": "QJG", "30707": "SD", "30729": "XH", "30796": "LG", "30917": "PB", "31074": "NM",
-  "31085": "JZ", "31109": "SC", "31181": "ZC", "31192": "MLB", "31293": "JQ", "31400": "YX", "31584": "YJ",
-  "31896": "ZN", "31909": "ZY", "31995": "XJ", "32321": "PF", "32327": "ZY", "32418": "HG", "32420": "XQ",
-  "32421": "HG", "32438": "LG", "32473": "GJ", "32488": "TD", "32521": "QJ", "32527": "PB", "32562": "ZSQ",
-  "32564": "JZ", "32735": "ZD", "32793": "PB", "33071": "PF", "33098": "XL", "33100": "YA", "33152": "PB",
-  "33261": "CX", "33324": "BP", "33333": "TD", "33406": "YA", "33426": "WM", "33432": "PB", "33445": "JG",
-  "33486": "ZN", "33493": "TS", "33507": "QJ", "33540": "QJ", "33544": "ZC", "33564": "XQ", "33617": "YT",
-  "33632": "QJ", "33636": "XH", "33637": "YX", "33694": "WG", "33705": "PF", "33728": "YW", "33882": "SR",
-  "34067": "WM", "34074": "YW", "34121": "QJ", "34255": "ZC", "34259": "XL", "34425": "JH", "34430": "XH",
-  "34485": "KH", "34503": "YS", "34532": "HG", "34552": "XS", "34558": "YE", "34593": "ZL", "34660": "YQ",
-  "34892": "XH", "34928": "SC", "34999": "QJ", "35048": "PB", "35059": "SC", "35098": "ZC", "35203": "TQ",
-  "35265": "JX", "35299": "JX", "35782": "SZ", "35828": "YS", "35830": "E", "35843": "TD", "35895": "YG",
-  "35977": "MH", "36158": "JG", "36228": "QJ", "36426": "XQ", "36466": "DC", "36710": "JC", "36711": "ZYG",
-  "36767": "PB", "36866": "SK", "36951": "YW", "37034": "YX", "37063": "XH", "37218": "ZC", "37325": "ZC",
-  "38063": "PB", "38079": "TD", "38085": "QY", "38107": "DC", "38116": "TD", "38123": "YD", "38224": "HG",
-  "38241": "XTC", "38271": "ZC", "38415": "YE", "38426": "KH", "38461": "YD", "38463": "AE", "38466": "PB",
-  "38477": "XJ", "38518": "YT", "38551": "WK", "38585": "ZC", "38704": "XS", "38739": "LJ", "38761": "GJ",
-  "38808": "SQ", "39048": "JG", "39049": "XJ", "39052": "HG", "39076": "CZ", "39271": "XT", "39534": "TD",
-  "39552": "TD", "39584": "PB", "39647": "SB", "39730": "LG", "39748": "TPB", "40109": "ZQ", "40479": "ND",
-  "40516": "HG", "40536": "HG", "40583": "QJ", "40765": "YQ", "40784": "QJ", "40840": "YK", "40863": "QJG" };
-
-// Program that returns the first letter array of Chinese characters
-export function makePy(str) {
-  if (typeof(str) != "string")
-    throw new Error("函数makePy需要字符串类型参数!");
-  var arrResult = [];
-  // Convert string to array
-  for (var i = 0, len = str.length; i < len; i++) {
-    var ch = str.charAt(i);
-    arrResult.push(checkCh(ch));
-  }
-  return mkRslt(arrResult);
-}
-
-// Check processing Chinese characters
-function checkCh(ch) {
-  var uni = ch.charCodeAt(Constants.CHAR_CODE);
-  // If it is not within the scope of Chinese character processing, return the original character, and you can also call your own processing function
-  if (uni > Constants.UNI_MAX || uni < Constants.UNI_MIN)
-  return ch; //dealWithOthers(ch);
-  // Check whether it is a polyphonic word, it is processed as a polyphonic word, if not, just find the corresponding first letter in the strChineseFirstPY string.
-  return (oMultiDiff[uni] ? oMultiDiff[uni] : (strChineseFirstPY.charAt(uni - Constants.UNI_MIN)));
-}
-
-// Process the characters and return an array of letters
-function mkRslt(arr) {
-  var arrRslt = [""];
-  for (var i = 0, len = arr.length; i < len; i++) {
-    var str = arr[i];
-    var strlen = str.length;
-    if (strlen == 1) {
-      for (var k = 0; k < arrRslt.length; k++) {
-        arrRslt[k] += str;
-      }
-    } else {
-      var tmpArr = arrRslt.slice(0);
-      arrRslt = [];
-      for (k = 0; k < strlen; k++) {
-        // Copy an identical arrRslt
-        var tmp = tmpArr.slice(0);
-        // Add the current character str[k] to the end of each element
-        for (var j = 0; j < tmp.length; j++) {
-          tmp[j] += str.charAt(k);
-        }
-        // Concatenate the copied and modified array to arrRslt
-        arrRslt = arrRslt.concat(tmp);
-      }
-    }
-  }
-  return arrRslt;
-}
-
-/**
- * Get the corresponding permission group id according to the permission
- * @param {String} permission app name id
- * @return {Number} groupId
- */
-export function getPermissionGroup(permission: string) {
-  for (var i = 0; i < permissionGroups.length; i++) {
-    if (permissionGroups[i].permissionName == permission) {
-      if(permissionGroups[i].groupName == 'OTHER') {
-        return {
-          "name": permissionGroups[i].groupName,
-          "groupName": permissionGroups[i].label,
-          "label": permissionGroups[i].text,
-          "icon": permissionGroups[i].icon,
-          "description": '',
-          "permissions": [
-            permissionGroups[i].permissionName
-          ]
-        }
-      }else {
-        return groups[permissionGroups[i].groupId]
-      }
-    }
-  }
-}
-
-const TAG = 'PermissionManager_Log';
-
-export class Log {
-  static info(log) {
-    console.info(`Info: ${TAG}  ${log}`)
-  }
-
-  static error(log) {
-    console.error(`Error: ${TAG}  ${log}`)
-  }
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+import Resmgr from '@ohos.resourceManager';
+import abilityAccessCtrl from '@ohos.abilityAccessCtrl';
+
+import { permissionGroups, groups } from "../model/permissionGroup";
+import Constants from '../utils/constant';
+
+/**
+ * Get app name resource
+ * @param {Number} labelId app name id
+ * @param {String} bundleName Package names
+ */
+export function getAppLabel(labelId, bundleName) {
+  return new Promise((resolve) => {
+    Resmgr.getResourceManager(globalThis.context, bundleName).then(item => {
+      item.getString(labelId, (error, value) => {
+        resolve(value);
+      })
+    }).catch(error => {
+      console.error('Resmgr.getResourceManager failed. Cause: ' + JSON.stringify(error));
+    })
+  })
+}
+
+/**
+ * Get app icon resources
+ * @param {Number} iconId app icon id
+ * @param {String} bundleName Package names
+ */
+export function getAppIcon(iconId, bundleName) {
+  return new Promise((resolve) => {
+    Resmgr.getResourceManager(globalThis.context, bundleName).then(item => {
+      item.getMediaBase64(iconId, (error, value) => {
+        resolve(value);
+      })
+    }).catch(error => {
+      console.error('Resmgr.getResourceManager failed. Cause: ' + JSON.stringify(error));
+    })
+  })
+}
+
+/**
+ * verify permission
+ * @param {Number} accessTokenId
+ * @param {String} permission permission name
+ */
+export function verifyAccessToken(accessTokenId, permission) {
+  return new Promise((resolve) => {
+    abilityAccessCtrl.createAtManager().verifyAccessToken(accessTokenId, permission).then((res) => {
+      return resolve(res);
+    })
+    .catch((error) => {
+      console.error('verifyAccessToken failed. Cause: ' + JSON.stringify(error));
+    })
+  })
+}
+
+/**
+* Let arkui detect changes in array index assignments。
+*/
+export function changeIndexValue(stateList, changeItem){
+  // copy array
+  let result = stateList.slice(0);
+  for (let i = 0 ; i < changeItem.length; i++) {
+    let item = changeItem[i];
+    if (!Array.isArray(item)) {
+      throw new Error("error");
+    }
+    let index = item[0];
+    let value = item[1];
+    if (index == undefined || value == undefined) {
+      throw new Error("error");
+    }
+    if (index < 0 || index > stateList.length - 1) {
+      continue;
+    }
+    let start = result.slice(0, index);
+    start = start.concat([value]);
+    result = start.concat(result.slice(index + 1));
+  }
+  return result;
+}
+
+// List of Chinese Pinyin Initials
+let strChineseFirstPY = "YDYQSXMWZSSXJBYMGCCZQPSSQBYCDSCDQLDYLYBSSJGYZZJJFKCCLZDHWDWZJLJPFYYNWJJTMYHZWZHFLZPPQHGSC" +
+"YYYNJQYXXGJHHSDSJNKKTMOMLCRXYPSNQSECCQZGGLLYJLMYZZSECYKYYHQWJSSGGYXYZYJWWKDJHYCHMYXJTLXJYQBYXZLDWRDJRWYSRLDZJPCBZ" +
+"JJBRCFTLECZSTZFXXZHTRQHYBDLYCZSSYMMRFMYQZPWWJJYFCRWFDFZQPYDDWYXKYJAWJFFXYPSFTZYHHYZYSWCJYXSCLCXXWZZXNBGNNXBXLZSZS" +
+"BSGPYSYZDHMDZBQBZCWDZZYYTZHBTSYYBZGNTNXQYWQSKBPHHLXGYBFMJEBJHHGQTJCYSXSTKZHLYCKGLYSMZXYALMELDCCXGZYRJXSDLTYZCQKCN" +
+"NJWHJTZZCQLJSTSTBNXBTYXCEQXGKWJYFLZQLYHYXSPSFXLMPBYSXXXYDJCZYLLLSJXFHJXPJBTFFYABYXBHZZBJYZLWLCZGGBTSSMDTJZXPTHYQT" +
+"GLJSCQFZKJZJQNLZWLSLHDZBWJNCJZYZSQQYCQYRZCJJWYBRTWPYFTWEXCSKDZCTBZHYZZYYJXZCFFZZMJYXXSDZZOTTBZLQWFCKSZSXFYRLNYJMB" +
+"DTHJXSQQCCSBXYYTSYFBXDZTGBCNSLCYZZPSAZYZZSCJCSHZQYDXLBPJLLMQXTYDZXSQJTZPXLCGLQTZWJBHCTSYJSFXYEJJTLBGXSXJMYJQQPFZA" +
+"SYJNTYDJXKJCDJSZCBARTDCLYJQMWNQNCLLLKBYBZZSYHQQLTWLCCXTXLLZNTYLNEWYZYXCZXXGRKRMTCNDNJTSYYSSDQDGHSDBJGHRWRQLYBGLXH" +
+"LGTGXBQJDZPYJSJYJCTMRNYMGRZJCZGJMZMGXMPRYXKJNYMSGMZJYMKMFXMLDTGFBHCJHKYLPFMDXLQJJSMTQGZSJLQDLDGJYCALCMZCSDJLLNXDJ" +
+"FFFFJCZFMZFFPFKHKGDPSXKTACJDHHZDDCRRCFQYJKQCCWJDXHWJLYLLZGCFCQDSMLZPBJJPLSBCJGGDCKKDEZSQCCKJGCGKDJTJDLZYCXKLQSCGJ" +
+"CLTFPCQCZGWPJDQYZJJBYJHSJDZWGFSJGZKQCCZLLPSPKJGQJHZZLJPLGJGJJTHJJYJZCZMLZLYQBGJWMLJKXZDZNJQSYZMLJLLJKYWXMKJLHSKJG" +
+"BMCLYYMKXJQLBMLLKMDXXKWYXYSLMLPSJQQJQXYXFJTJDXMXXLLCXQBSYJBGWYMBGGBCYXPJYGPEPFGDJGBHBNSQJYZJKJKHXQFGQZKFHYGKHDKLL" +
+"SDJQXPQYKYBNQSXQNSZSWHBSXWHXWBZZXDMNSJBSBKBBZKLYLXGWXDRWYQZMYWSJQLCJXXJXKJEQXSCYETLZHLYYYSDZPAQYZCMTLSHTZCFYZYXYL" +
+"JSDCJQAGYSLCQLYYYSHMRQQKLDXZSCSSSYDYCJYSFSJBFRSSZQSBXXPXJYSDRCKGJLGDKZJZBDKTCSYQPYHSTCLDJDHMXMCGXYZHJDDTMHLTXZXYL" +
+"YMOHYJCLTYFBQQXPFBDFHHTKSQHZYYWCNXXCRWHOWGYJLEGWDQCWGFJYCSNTMYTOLBYGWQWESJPWNMLRYDZSZTXYQPZGCWXHNGPYXSHMYQJXZTDPP" +
+"BFYHZHTJYFDZWKGKZBLDNTSXHQEEGZZYLZMMZYJZGXZXKHKSTXNXXWYLYAPSTHXDWHZYMPXAGKYDXBHNHXKDPJNMYHYLPMGOCSLNZHKXXLPZZLBML" +
+"SFBHHGYGYYGGBHSCYAQTYWLXTZQCEZYDQDQMMHTKLLSZHLSJZWFYHQSWSCWLQAZYNYTLSXTHAZNKZZSZZLAXXZWWCTGQQTDDYZTCCHYQZFLXPSLZY" +
+"GPZSZNGLNDQTBDLXGTCTAJDKYWNSYZLJHHZZCWNYYZYWMHYCHHYXHJKZWSXHZYXLYSKQYSPSLYZWMYPPKBYGLKZHTYXAXQSYSHXASMCHKDSCRSWJP" +
+"WXSGZJLWWSCHSJHSQNHCSEGNDAQTBAALZZMSSTDQJCJKTSCJAXPLGGXHHGXXZCXPDMMHLDGTYBYSJMXHMRCPXXJZCKZXSHMLQXXTTHXWZFKHCCZDY" +
+"TCJYXQHLXDHYPJQXYLSYYDZOZJNYXQEZYSQYAYXWYPDGXDDXSPPYZNDLTWRHXYDXZZJHTCXMCZLHPYYYYMHZLLHNXMYLLLMDCPPXHMXDKYCYRDLTX" +
+"JCHHZZXZLCCLYLNZSHZJZZLNNRLWHYQSNJHXYNTTTKYJPYCHHYEGKCTTWLGQRLGGTGTYGYHPYHYLQYQGCWYQKPYYYTTTTLHYHLLTYTTSPLKYZXGZW" +
+"GPYDSSZZDQXSKCQNMJJZZBXYQMJRTFFBTKHZKBXLJJKDXJTLBWFZPPTKQTZTGPDGNTPJYFALQMKGXBDCLZFHZCLLLLADPMXDJHLCCLGYHDZFGYDDG" +
+"CYYFGYDXKSSEBDHYKDKDKHNAXXYBPBYYHXZQGAFFQYJXDMLJCSQZLLPCHBSXGJYNDYBYQSPZWJLZKSDDTACTBXZDYZYPJZQSJNKKTKNJDJGYYPGTL" +
+"FYQKASDNTCYHBLWDZHBBYDWJRYGKZYHEYYFJMSDTYFZJJHGCXPLXHLDWXXJKYTCYKSSSMTWCTTQZLPBSZDZWZXGZAGYKTYWXLHLSPBCLLOQMMZSSL" +
+"CMBJCSZZKYDCZJGQQDSMCYTZQQLWZQZXSSFPTTFQMDDZDSHDTDWFHTDYZJYQJQKYPBDJYYXTLJHDRQXXXHAYDHRJLKLYTWHLLRLLRCXYLBWSRSZZS" +
+"YMKZZHHKYHXKSMDSYDYCJPBZBSQLFCXXXNXKXWYWSDZYQOGGQMMYHCDZTTFJYYBGSTTTYBYKJDHKYXBELHTYPJQNFXFDYKZHQKZBYJTZBXHFDXKDA" +
+"SWTAWAJLDYJSFHBLDNNTNQJTJNCHXFJSRFWHZFMDRYJYJWZPDJKZYJYMPCYZNYNXFBYTFYFWYGDBNZZZDNYTXZEMMQBSQEHXFZMBMFLZZSRXYMJGS" +
+"XWZJSPRYDJSJGXHJJGLJJYNZZJXHGXKYMLPYYYCXYTWQZSWHWLYRJLPXSLSXMFSWWKLCTNXNYNPSJSZHDZEPTXMYYWXYYSYWLXJQZQXZDCLEEELMC" +
+"PJPCLWBXSQHFWWTFFJTNQJHJQDXHWLBYZNFJLALKYYJLDXHHYCSTYYWNRJYXYWTRMDRQHWQCMFJDYZMHMYYXJWMYZQZXTLMRSPWWCHAQBXYGZYPXY" +
+"YRRCLMPYMGKSJSZYSRMYJSNXTPLNBAPPYPYLXYYZKYNLDZYJZCZNNLMZHHARQMPGWQTZMXXMLLHGDZXYHXKYXYCJMFFYYHJFSBSSQLXXNDYCANNMT" +
+"CJCYPRRNYTYQNYYMBMSXNDLYLYSLJRLXYSXQMLLYZLZJJJKYZZCSFBZXXMSTBJGNXYZHLXNMCWSCYZYFZLXBRNNNYLBNRTGZQYSATSWRYHYJZMZDH" +
+"ZGZDWYBSSCSKXSYHYTXXGCQGXZZSHYXJSCRHMKKBXCZJYJYMKQHZJFNBHMQHYSNJNZYBKNQMCLGQHWLZNZSWXKHLJHYYBQLBFCDSXDLDSPFZPSKJY" +
+"ZWZXZDDXJSMMEGJSCSSMGCLXXKYYYLNYPWWWGYDKZJGGGZGGSYCKNJWNJPCXBJJTQTJWDSSPJXZXNZXUMELPXFSXTLLXCLJXJJLJZXCTPSWXLYDHL" +
+"YQRWHSYCSQYYBYAYWJJJQFWQCQQCJQGXALDBZZYJGKGXPLTZYFXJLTPADKYQHPMATLCPDCKBMTXYBHKLENXDLEEGQDYMSAWHZMLJTWYGXLYQZLJEE" +
+"YYBQQFFNLYXRDSCTGJGXYYNKLLYQKCCTLHJLQMKKZGCYYGLLLJDZGYDHZWXPYSJBZKDZGYZZHYWYFQYTYZSZYEZZLYMHJJHTSMQWYZLKYYWZCSRKQ" +
+"YTLTDXWCTYJKLWSQZWBDCQYNCJSRSZJLKCDCDTLZZZACQQZZDDXYPLXZBQJYLZLLLQDDZQJYJYJZYXNYYYNYJXKXDAZWYRDLJYYYRJLXLLDYXJCYW" +
+"YWNQCCLDDNYYYNYCKCZHXXCCLGZQJGKWPPCQQJYSBZZXYJSQPXJPZBSBDSFNSFPZXHDWZTDWPPTFLZZBZDMYYPQJRSDZSQZSQXBDGCPZSWDWCSQZG" +
+"MDHZXMWWFYBPDGPHTMJTHZSMMBGZMBZJCFZWFZBBZMQCFMBDMCJXLGPNJBBXGYHYYJGPTZGZMQBQTCGYXJXLWZKYDPDYMGCFTPFXYZTZXDZXTGKMT" +
+"YBBCLBJASKYTSSQYYMSZXFJEWLXLLSZBQJJJAKLYLXLYCCTSXMCWFKKKBSXLLLLJYXTYLTJYYTDPJHNHNNKBYQNFQYYZBYYESSESSGDYHFHWTCJBS" +
+"DZZTFDMXHCNJZYMQWSRYJDZJQPDQBBSTJGGFBKJBXTGQHNGWJXJGDLLTHZHHYYYYYYSXWTYYYCCBDBPYPZYCCZYJPZYWCBDLFWZCWJDXXHYHLHWZZ" +
+"XJTCZLCDPXUJCZZZLYXJJTXPHFXWPYWXZPTDZZBDZCYHJHMLXBQXSBYLRDTGJRRCTTTHYTCZWMXFYTWWZCWJWXJYWCSKYBZSCCTZQNHXNWXXKHKFH" +
+"TSWOCCJYBCMPZZYKBNNZPBZHHZDLSYDDYTYFJPXYNGFXBYQXCBHXCPSXTYZDMKYSNXSXLHKMZXLYHDHKWHXXSSKQYHHCJYXGLHZXCSNHEKDTGZXQY" +
+"PKDHEXTYKCNYMYYYPKQYYYKXZLTHJQTBYQHXBMYHSQCKWWYLLHCYYLNNEQXQWMCFBDCCMLJGGXDQKTLXKGNQCDGZJWYJJLYHHQTTTNWCHMXCXWHWS" +
+"ZJYDJCCDBQCDGDNYXZTHCQRXCBHZTQCBXWGQWYYBXHMBYMYQTYEXMQKYAQYRGYZSLFYKKQHYSSQYSHJGJCNXKZYCXSBXYXHYYLSTYCXQTHYSMGSCP" +
+"MMGCCCCCMTZTASMGQZJHKLOSQYLSWTMXSYQKDZLJQQYPLSYCZTCQQPBBQJZCLPKHQZYYXXDTDDTSJCXFFLLCHQXMJLWCJCXTSPYCXNDTJSHJWXDQQ" +
+"JSKXYAMYLSJHMLALYKXCYYDMNMDQMXMCZNNCYBZKKYFLMCHCMLHXRCJJHSYLNMTJZGZGYWJXSRXCWJGJQHQZDQJDCJJZKJKGDZQGJJYJYLXZXXCDQ" +
+"HHHEYTMHLFSBDJSYYSHFYSTCZQLPBDRFRZTZYKYWHSZYQKWDQZRKMSYNBCRXQBJYFAZPZZEDZCJYWBCJWHYJBQSZYWRYSZPTDKZPFPBNZTKLQYHBB" +
+"ZPNPPTYZZYBQNYDCPJMMCYCQMCYFZZDCMNLFPBPLNGQJTBTTNJZPZBBZNJKLJQYLNBZQHKSJZNGGQSZZKYXSHPZSNBCGZKDDZQANZHJKDRTLZLSWJ" +
+"LJZLYWTJNDJZJHXYAYNCBGTZCSSQMNJPJYTYSWXZFKWJQTKHTZPLBHSNJZSYZBWZZZZLSYLSBJHDWWQPSLMMFBJDWAQYZTCJTBNNWZXQXCDSLQGDS" +
+"DPDZHJTQQPSWLYYJZLGYXYZLCTCBJTKTYCZJTQKBSJLGMGZDMCSGPYNJZYQYYKNXRPWSZXMTNCSZZYXYBYHYZAXYWQCJTLLCKJJTJHGDXDXYQYZZB" +
+"YWDLWQCGLZGJGQRQZCZSSBCRPCSKYDZNXJSQGXSSJMYDNSTZTPBDLTKZWXQWQTZEXNQCZGWEZKSSBYBRTSSSLCCGBPSZQSZLCCGLLLZXHZQTHCZMQ" +
+"GYZQZNMCOCSZJMMZSQPJYGQLJYJPPLDXRGZYXCCSXHSHGTZNLZWZKJCXTCFCJXLBMQBCZZWPQDNHXLJCTHYZLGYLNLSZZPCXDSCQQHJQKSXZPBAJY" +
+"EMSMJTZDXLCJYRYYNWJBNGZZTMJXLTBSLYRZPYLSSCNXPHLLHYLLQQZQLXYMRSYCXZLMMCZLTZSDWTJJLLNZGGQXPFSKYGYGHBFZPDKMWGHCXMSGD" +
+"XJMCJZDYCABXJDLNBCDQYGSKYDQTXDJJYXMSZQAZDZFSLQXYJSJZYLBTXXWXQQZBJZUFBBLYLWDSLJHXJYZJWTDJCZFQZQZZDZSXZZQLZCDZFJHYS" +
+"PYMPQZMLPPLFFXJJNZZYLSJEYQZFPFZKSYWJJJHRDJZZXTXXGLGHYDXCSKYSWMMZCWYBAZBJKSHFHJCXMHFQHYXXYZFTSJYZFXYXPZLCHMZMBXHZZ" +
+"SXYFYMNCWDABAZLXKTCSHHXKXJJZJSTHYGXSXYYHHHJWXKZXSSBZZWHHHCWTZZZPJXSNXQQJGZYZYWLLCWXZFXXYXYHXMKYYSWSQMNLNAYCYSPMJK" +
+"HWCQHYLAJJMZXHMMCNZHBHXCLXTJPLTXYJHDYYLTTXFSZHYXXSJBJYAYRSMXYPLCKDUYHLXRLNLLSTYZYYQYGYHHSCCSMZCTZQXKYQFPYYRPFFLKQ" +
+"UNTSZLLZMWWTCQQYZWTLLMLMPWMBZSSTZRBPDDTLQJJBXZCSRZQQYGWCSXFWZLXCCRSZDZMCYGGDZQSGTJSWLJMYMMZYHFBJDGYXCCPSHXNZCSBSJ" +
+"YJGJMPPWAFFYFNXHYZXZYLREMZGZCYZSSZDLLJCSQFNXZKPTXZGXJJGFMYYYSNBTYLBNLHPFZDCYFBMGQRRSSSZXYSGTZRNYDZZCDGPJAFJFZKNZB" +
+"LCZSZPSGCYCJSZLMLRSZBZZLDLSLLYSXSQZQLYXZLSKKBRXBRBZCYCXZZZEEYFGKLZLYYHGZSGZLFJHGTGWKRAAJYZKZQTSSHJJXDCYZUYJLZYRZD" +
+"QQHGJZXSSZBYKJPBFRTJXLLFQWJHYLQTYMBLPZDXTZYGBDHZZRBGXHWNJTJXLKSCFSMWLSDQYSJTXKZSCFWJLBXFTZLLJZLLQBLSQMQQCGCZFPBPH" +
+"ZCZJLPYYGGDTGWDCFCZQYYYQYSSCLXZSKLZZZGFFCQNWGLHQYZJJCZLQZZYJPJZZBPDCCMHJGXDQDGDLZQMFGPSYTSDYFWWDJZJYSXYYCZCYHZWPB" +
+"YKXRYLYBHKJKSFXTZJMMCKHLLTNYYMSYXYZPYJQYCSYCWMTJJKQYRHLLQXPSGTLYYCLJSCPXJYZFNMLRGJJTYZBXYZMSJYJHHFZQMSYXRSZCWTLRT" +
+"QZSSTKXGQKGSPTGCZNJSJCQCXHMXGGZTQYDJKZDLBZSXJLHYQGGGTHQSZPYHJHHGYYGKGGCWJZZYLCZLXQSFTGZSLLLMLJSKCTBLLZZSZMMNYTPZS" +
+"XQHJCJYQXYZXZQZCPSHKZZYSXCDFGMWQRLLQXRFZTLYSTCTMJCXJJXHJNXTNRZTZFQYHQGLLGCXSZSJDJLJCYDSJTLNYXHSZXCGJZYQPYLFHDJSBP" +
+"CCZHJJJQZJQDYBSSLLCMYTTMQTBHJQNNYGKYRQYQMZGCJKPDCGMYZHQLLSLLCLMHOLZGDYYFZSLJCQZLYLZQJESHNYLLJXGJXLYSYYYXNBZLJSSZC" +
+"QQCJYLLZLTJYLLZLLBNYLGQCHXYYXOXCXQKYJXXXYKLXSXXYQXCYKQXQCSGYXXYQXYGYTQOHXHXPYXXXULCYEYCHZZCBWQBBWJQZSCSZSSLZYLKDE" +
+"SJZWMYMCYTSDSXXSCJPQQSQYLYYZYCMDJDZYWCBTJSYDJKCYDDJLBDJJSODZYSYXQQYXDHHGQQYQHDYXWGMMMAJDYBBBPPBCMUUPLJZSMTXERXJMH" +
+"QNUTPJDCBSSMSSSTKJTSSMMTRCPLZSZMLQDSDMJMQPNQDXCFYNBFSDQXYXHYAYKQYDDLQYYYSSZBYDSLNTFQTZQPZMCHDHCZCWFDXTMYQSPHQYYXS" +
+"RGJCWTJTZZQMGWJJTJHTQJBBHWZPXXHYQFXXQYWYYHYSCDYDHHQMNMTMWCPBSZPPZZGLMZFOLLCFWHMMSJZTTDHZZYFFYTZZGZYSKYJXQYJZQBHMB" +
+"ZZLYGHGFMSHPZFZSNCLPBQSNJXZSLXXFPMTYJYGBXLLDLXPZJYZJYHHZCYWHJYLSJEXFSZZYWXKZJLUYDTMLYMQJPWXYHXSKTQJEZRPXXZHHMHWQP" +
+"WQLYJJQJJZSZCPHJLCHHNXJLQWZJHBMZYXBDHHYPZLHLHLGFWLCHYYTLHJXCJMSCPXSTKPNHQXSRTYXXTESYJCTLSSLSTDLLLWWYHDHRJZSFGXTSY" +
+"CZYNYHTDHWJSLHTZDQDJZXXQHGYLTZPHCSQFCLNJTCLZPFSTPDYNYLGMJLLYCQHYSSHCHYLHQYQTMZYPBYWRFQYKQSYSLZDQJMPXYYSSRHZJNYWTQ" +
+"DFZBWWTWWRXCWHGYHXMKMYYYQMSMZHNGCEPMLQQMTCWCTMMPXJPJJHFXYYZSXZHTYBMSTSYJTTQQQYYLHYNPYQZLCYZHZWSMYLKFJXLWGXYPJYTYS" +
+"YXYMZCKTTWLKSMZSYLMPWLZWXWQZSSAQSYXYRHSSNTSRAPXCPWCMGDXHXZDZYFJHGZTTSBJHGYZSZYSMYCLLLXBTYXHBBZJKSSDMALXHYCFYGMQYP" +
+"JYCQXJLLLJGSLZGQLYCJCCZOTYXMTMTTLLWTGPXYMZMKLPSZZZXHKQYSXCTYJZYHXSHYXZKXLZWPSQPYHJWPJPWXQQYLXSDHMRSLZZYZWTTCYXYSZ" +
+"ZSHBSCCSTPLWSSCJCHNLCGCHSSPHYLHFHHXJSXYLLNYLSZDHZXYLSXLWZYKCLDYAXZCMDDYSPJTQJZLNWQPSSSWCTSTSZLBLNXSMNYYMJQBQHRZWT" +
+"YYDCHQLXKPZWBGQYBKFCMZWPZLLYYLSZYDWHXPSBCMLJBSCGBHXLQHYRLJXYSWXWXZSLDFHLSLYNJLZYFLYJYCDRJLFSYZFSLLCQYQFGJYHYXZLYL" +
+"MSTDJCYHBZLLNWLXXYGYYHSMGDHXXHHLZZJZXCZZZCYQZFNGWPYLCPKPYYPMCLQKDGXZGGWQBDXZZKZFBXXLZXJTPJPTTBYTSZZDWSLCHZHSLTYXH" +
+"QLHYXXXYYZYSWTXZKHLXZXZPYHGCHKCFSYHUTJRLXFJXPTZTWHPLYXFCRHXSHXKYXXYHZQDXQWULHYHMJTBFLKHTXCWHJFWJCFPQRYQXCYYYQYGRP" +
+"YWSGSUNGWCHKZDXYFLXXHJJBYZWTSXXNCYJJYMSWZJQRMHXZWFQSYLZJZGBHYNSLBGTTCSYBYXXWXYHXYYXNSQYXMQYWRGYQLXBBZLJSYLPSYTJZY" +
+"HYZAWLRORJMKSCZJXXXYXCHDYXRYXXJDTSQFXLYLTSFFYXLMTYJMJUYYYXLTZCSXQZQHZXLYYXZHDNBRXXXJCTYHLBRLMBRLLAXKYLLLJLYXXLYCR" +
+"YLCJTGJCMTLZLLCYZZPZPCYAWHJJFYBDYYZSMPCKZDQYQPBPCJPDCYZMDPBCYYDYCNNPLMTMLRMFMMGWYZBSJGYGSMZQQQZTXMKQWGXLLPJGZBQCD" +
+"JJJFPKJKCXBLJMSWMDTQJXLDLPPBXCWRCQFBFQJCZAHZGMYKPHYYHZYKNDKZMBPJYXPXYHLFPNYYGXJDBKXNXHJMZJXSTRSTLDXSKZYSYBZXJLXYS" +
+"LBZYSLHXJPFXPQNBYLLJQKYGZMCYZZYMCCSLCLHZFWFWYXZMWSXTYNXJHPYYMCYSPMHYSMYDYSHQYZCHMJJMZCAAGCFJBBHPLYZYLXXSDJGXDHKXX" +
+"TXXNBHRMLYJSLTXMRHNLXQJXYZLLYSWQGDLBJHDCGJYQYCMHWFMJYBMBYJYJWYMDPWHXQLDYGPDFXXBCGJSPCKRSSYZJMSLBZZJFLJJJLGXZGYXYX" +
+"LSZQYXBEXYXHGCXBPLDYHWETTWWCJMBTXCHXYQXLLXFLYXLLJLSSFWDPZSMYJCLMWYTCZPCHQEKCQBWLCQYDPLQPPQZQFJQDJHYMMCXTXDRMJWRHX" +
+"CJZYLQXDYYNHYYHRSLSRSYWWZJYMTLTLLGTQCJZYABTCKZCJYCCQLJZQXALMZYHYWLWDXZXQDLLQSHGPJFJLJHJABCQZDJGTKHSSTCYJLPSWZLXZX" +
+"RWGLDLZRLZXTGSLLLLZLYXXWGDZYGBDPHZPBRLWSXQBPFDWOFMWHLYPCBJCCLDMBZPBZZLCYQXLDOMZBLZWPDWYYGDSTTHCSQSCCRSSSYSLFYBFNT" +
+"YJSZDFNDPDHDZZMBBLSLCMYFFGTJJQWFTMTPJWFNLBZCMMJTGBDZLQLPYFHYYMJYLSDCHDZJWJCCTLJCLDTLJJCPDDSQDSSZYBNDBJLGGJZXSXNLY" +
+"CYBJXQYCBYLZCFZPPGKCXZDZFZTJJFJSJXZBNZYJQTTYJYHTYCZHYMDJXTTMPXSPLZCDWSLSHXYPZGTFMLCJTYCBPMGDKWYCYZCDSZZYHFLYCTYGW" +
+"HKJYYLSJCXGYWJCBLLCSNDDBTZBSCLYZCZZSSQDLLMQYYHFSLQLLXFTYHABXGWNYWYYPLLSDLDLLBJCYXJZMLHLJDXYYQYTDLLLBUGBFDFBBQJZZM" +
+"DPJHGCLGMJJPGAEHHBWCQXAXHHHZCHXYPHJAXHLPHJPGPZJQCQZGJJZZUZDMQYYBZZPHYHYBWHAZYJHYKFGDPFQSDLZMLJXKXGALXZDAGLMDGXMWZ" +
+"QYXXDXXPFDMMSSYMPFMDMMKXKSYZYSHDZKXSYSMMZZZMSYDNZZCZXFPLSTMZDNMXCKJMZTYYMZMZZMSXHHDCZJEMXXKLJSTLWLSQLYJZLLZJSSDPP" +
+"MHNLZJCZYHMXXHGZCJMDHXTKGRMXFWMCGMWKDTKSXQMMMFZZYDKMSCLCMPCGMHSPXQPZDSSLCXKYXTWLWJYAHZJGZQMCSNXYYMMPMLKJXMHLMLQMX" +
+"CTKZMJQYSZJSYSZHSYJZJCDAJZYBSDQJZGWZQQXFKDMSDJLFWEHKZQKJPEYPZYSZCDWYJFFMZZYLTTDZZEFMZLBNPPLPLPEPSZALLTYLKCKQZKGEN" +
+"QLWAGYXYDPXLHSXQQWQCQXQCLHYXXMLYCCWLYMQYSKGCHLCJNSZKPYZKCQZQLJPDMDZHLASXLBYDWQLWDNBQCRYDDZTJYBKBWSZDXDTNPJDTCTQDF" +
+"XQQMGNXECLTTBKPWSLCTYQLPWYZZKLPYGZCQQPLLKCCYLPQMZCZQCLJSLQZDJXLDDHPZQDLJJXZQDXYZQKZLJCYQDYJPPYPQYKJYRMPCBYMCXKLLZ" +
+"LLFQPYLLLMBSGLCYSSLRSYSQTMXYXZQZFDZUYSYZTFFMZZSMZQHZSSCCMLYXWTPZGXZJGZGSJSGKDDHTQGGZLLBJDZLCBCHYXYZHZFYWXYZYMSDBZ" +
+"ZYJGTSMTFXQYXQSTDGSLNXDLRYZZLRYYLXQHTXSRTZNGZXBNQQZFMYKMZJBZYMKBPNLYZPBLMCNQYZZZSJZHJCTZKHYZZJRDYZHNPXGLFZTLKGJTC" +
+"TSSYLLGZRZBBQZZKLPKLCZYSSUYXBJFPNJZZXCDWXZYJXZZDJJKGGRSRJKMSMZJLSJYWQSKYHQJSXPJZZZLSNSHRNYPZTWCHKLPSRZLZXYJQXQKYS" +
+"JYCZTLQZYBBYBWZPQDWWYZCYTJCJXCKCWDKKZXSGKDZXWWYYJQYYTCYTDLLXWKCZKKLCCLZCQQDZLQLCSFQCHQHSFSMQZZLNBJJZBSJHTSZDYSJQJ" +
+"PDLZCDCWJKJZZLPYCGMZWDJJBSJQZSYZYHHXJPBJYDSSXDZNCGLQMBTSFSBPDZDLZNFGFJGFSMPXJQLMBLGQCYYXBQKDJJQYRFKZTJDHCZKLBSDZC" +
+"FJTPLLJGXHYXZCSSZZXSTJYGKGCKGYOQXJPLZPBPGTGYJZGHZQZZLBJLSQFZGKQQJZGYCZBZQTLDXRJXBSXXPZXHYZYCLWDXJJHXMFDZPFZHQHQMQ" +
+"GKSLYHTYCGFRZGNQXCLPDLBZCSCZQLLJBLHBZCYPZZPPDYMZZSGYHCKCPZJGSLJLNSCDSLDLXBMSTLDDFJMKDJDHZLZXLSZQPQPGJLLYBDSZGQLBZ" +
+"LSLKYYHZTTNTJYQTZZPSZQZTLLJTYYLLQLLQYZQLBDZLSLYYZYMDFSZSNHLXZNCZQZPBWSKRFBSYZMTHBLGJPMCZZLSTLXSHTCSYZLZBLFEQHLXFL" +
+"CJLYLJQCBZLZJHHSSTBRMHXZHJZCLXFNBGXGTQJCZTMSFZKJMSSNXLJKBHSJXNTNLZDNTLMSJXGZJYJCZXYJYJWRWWQNZTNFJSZPZSHZJFYRDJSFS" +
+"ZJZBJFZQZZHZLXFYSBZQLZSGYFTZDCSZXZJBQMSZKJRHYJZCKMJKHCHGTXKXQGLXPXFXTRTYLXJXHDTSJXHJZJXZWZLCQSBTXWXGXTXXHXFTSDKFJ" +
+"HZYJFJXRZSDLLLTQSQQZQWZXSYQTWGWBZCGZLLYZBCLMQQTZHZXZXLJFRMYZFLXYSQXXJKXRMQDZDMMYYBSQBHGZMWFWXGMXLZPYYTGZYCCDXYZXY" +
+"WGSYJYZNBHPZJSQSYXSXRTFYZGRHZTXSZZTHCBFCLSYXZLZQMZLMPLMXZJXSFLBYZMYQHXJSXRXSQZZZSSLYFRCZJRCRXHHZXQYDYHXSJJHZCXZBT" +
+"YNSYSXJBQLPXZQPYMLXZKYXLXCJLCYSXXZZLXDLLLJJYHZXGYJWKJRWYHCPSGNRZLFZWFZZNSXGXFLZSXZZZBFCSYJDBRJKRDHHGXJLJJTGXJXXST" +
+"JTJXLYXQFCSGSWMSBCTLQZZWLZZKXJMLTMJYHSDDBXGZHDLBMYJFRZFSGCLYJBPMLYSMSXLSZJQQHJZFXGFQFQBPXZGYYQXGZTCQWYLTLGWSGWHRL" +
+"FSFGZJMGMGBGTJFSYZZGZYZAFLSSPMLPFLCWBJZCLJJMZLPJJLYMQDMYYYFBGYGYZMLYZDXQYXRQQQHSYYYQXYLJTYXFSFSLLGNQCYHYCWFHCCCFX" +
+"PYLYPLLZYXXXXXKQHHXSHJZCFZSCZJXCPZWHHHHHAPYLQALPQAFYHXDYLUKMZQGGGDDESRNNZLTZGCHYPPYSQJJHCLLJTOLNJPZLJLHYMHEYDYDSQ" +
+"YCDDHGZUNDZCLZYZLLZNTNYZGSLHSLPJJBDGWXPCDUTJCKLKCLWKLLCASSTKZZDNQNTTLYYZSSYSSZZRYLJQKCQDHHCRXRZYDGRGCWCGZQFFFPPJF" +
+"ZYNAKRGYWYQPQXXFKJTSZZXSWZDDFBBXTBGTZKZNPZZPZXZPJSZBMQHKCYXYLDKLJNYPKYGHGDZJXXEAHPNZKZTZCMXCXMMJXNKSZQNMNLWBWWXJK" +
+"YHCPSTMCSQTZJYXTPCTPDTNNPGLLLZSJLSPBLPLQHDTNJNLYYRSZFFJFQWDPHZDWMRZCCLODAXNSSNYZRESTYJWJYJDBCFXNMWTTBYLWSTSZGYBLJ" +
+"PXGLBOCLHPCBJLTMXZLJYLZXCLTPNCLCKXTPZJSWCYXSFYSZDKNTLBYJCYJLLSTGQCBXRYZXBXKLYLHZLQZLNZCXWJZLJZJNCJHXMNZZGJZZXTZJX" +
+"YCYYCXXJYYXJJXSSSJSTSSTTPPGQTCSXWZDCSYFPTFBFHFBBLZJCLZZDBXGCXLQPXKFZFLSYLTUWBMQJHSZBMDDBCYSCCLDXYCDDQLYJJWMQLLCSG" +
+"LJJSYFPYYCCYLTJANTJJPWYCMMGQYYSXDXQMZHSZXPFTWWZQSWQRFKJLZJQQYFBRXJHHFWJJZYQAZMYFRHCYYBYQWLPEXCCZSTYRLTTDMQLYKMBBG" +
+"MYYJPRKZNPBSXYXBHYZDJDNGHPMFSGMWFZMFQMMBCMZZCJJLCNUXYQLMLRYGQZCYXZLWJGCJCGGMCJNFYZZJHYCPRRCMTZQZXHFQGTJXCCJEAQCRJ" +
+"YHPLQLSZDJRBCQHQDYRHYLYXJSYMHZYDWLDFRYHBPYDTSSCNWBXGLPZMLZZTQSSCPJMXXYCSJYTYCGHYCJWYRXXLFEMWJNMKLLSWTXHYYYNCMMCWJ" +
+"DQDJZGLLJWJRKHPZGGFLCCSCZMCBLTBHBQJXQDSPDJZZGKGLFQYWBZYZJLTSTDHQHCTCBCHFLQMPWDSHYYTQWCNZZJTLBYMBPDYYYXSQKXWYYFLXX" +
+"NCWCXYPMAELYKKJMZZZBRXYYQJFLJPFHHHYTZZXSGQQMHSPGDZQWBWPJHZJDYSCQWZKTXXSQLZYYMYSDZGRXCKKUJLWPYSYSCSYZLRMLQSYLJXBCX" +
+"TLWDQZPCYCYKPPPNSXFYZJJRCEMHSZMSXLXGLRWGCSTLRSXBZGBZGZTCPLUJLSLYLYMTXMTZPALZXPXJTJWTCYYZLBLXBZLQMYLXPGHDSLSSDMXMB" +
+"DZZSXWHAMLCZCPJMCNHJYSNSYGCHSKQMZZQDLLKABLWJXSFMOCDXJRRLYQZKJMYBYQLYHETFJZFRFKSRYXFJTWDSXXSYSQJYSLYXWJHSNLXYYXHBH" +
+"AWHHJZXWMYLJCSSLKYDZTXBZSYFDXGXZJKHSXXYBSSXDPYNZWRPTQZCZENYGCXQFJYKJBZMLJCMQQXUOXSLYXXLYLLJDZBTYMHPFSTTQQWLHOKYBL" +
+"ZZALZXQLHZWRRQHLSTMYPYXJJXMQSJFNBXYXYJXXYQYLTHYLQYFMLKLJTMLLHSZWKZHLJMLHLJKLJSTLQXYLMBHHLNLZXQJHXCFXXLHYHJJGBYZZK" +
+"BXSCQDJQDSUJZYYHZHHMGSXCSYMXFEBCQWWRBPYYJQTYZCYQYQQZYHMWFFHGZFRJFCDPXNTQYZPDYKHJLFRZXPPXZDBBGZQSTLGDGYLCQMLCHHMFY" +
+"WLZYXKJLYPQHSYWMQQGQZMLZJNSQXJQSYJYCBEHSXFSZPXZWFLLBCYYJDYTDTHWZSFJMQQYJLMQXXLLDTTKHHYBFPWTYYSQQWNQWLGWDEBZWCMYGC" +
+"ULKJXTMXMYJSXHYBRWFYMWFRXYQMXYSZTZZTFYKMLDHQDXWYYNLCRYJBLPSXCXYWLSPRRJWXHQYPHTYDNXHHMMYWYTZCSQMTSSCCDALWZTCPQPYJL" +
+"LQZYJSWXMZZMMYLMXCLMXCZMXMZSQTZPPQQBLPGXQZHFLJJHYTJSRXWZXSCCDLXTYJDCQJXSLQYCLZXLZZXMXQRJMHRHZJBHMFLJLMLCLQNLDXZLL" +
+"LPYPSYJYSXCQQDCMQJZZXHNPNXZMEKMXHYKYQLXSXTXJYYHWDCWDZHQYYBGYBCYSCFGPSJNZDYZZJZXRZRQJJYMCANYRJTLDPPYZBSTJKXXZYPFDW" +
+"FGZZRPYMTNGXZQBYXNBUFNQKRJQZMJEGRZGYCLKXZDSKKNSXKCLJSPJYYZLQQJYBZSSQLLLKJXTBKTYLCCDDBLSPPFYLGYDTZJYQGGKQTTFZXBDKT" +
+"YYHYBBFYTYYBCLPDYTGDHRYRNJSPTCSNYJQHKLLLZSLYDXXWBCJQSPXBPJZJCJDZFFXXBRMLAZHCSNDLBJDSZBLPRZTSWSBXBCLLXXLZDJZSJPYLY" +
+"XXYFTFFFBHJJXGBYXJPMMMPSSJZJMTLYZJXSWXTYLEDQPJMYGQZJGDJLQJWJQLLSJGJGYGMSCLJJXDTYGJQJQJCJZCJGDZZSXQGSJGGCXHQXSNQLZ" +
+"ZBXHSGZXCXYLJXYXYYDFQQJHJFXDHCTXJYRXYSQTJXYEFYYSSYYJXNCYZXFXMSYSZXYYSCHSHXZZZGZZZGFJDLTYLNPZGYJYZYYQZPBXQBDZTZCZY" +
+"XXYHHSQXSHDHGQHJHGYWSZTMZMLHYXGEBTYLZKQWYTJZRCLEKYSTDBCYKQQSAYXCJXWWGSBHJYZYDHCSJKQCXSWXFLTYNYZPZCCZJQTZWJQDZZZQZ" +
+"LJJXLSBHPYXXPSXSHHEZTXFPTLQYZZXHYTXNCFZYYHXGNXMYWXTZSJPTHHGYMXMXQZXTSBCZYJYXXTYYZYPCQLMMSZMJZZLLZXGXZAAJZYXJMZXWD" +
+"XZSXZDZXLEYJJZQBHZWZZZQTZPSXZTDSXJJJZNYAZPHXYYSRNQDTHZHYYKYJHDZXZLSWCLYBZYECWCYCRYLCXNHZYDZYDYJDFRJJHTRSQTXYXJRJH" +
+"OJYNXELXSFSFJZGHPZSXZSZDZCQZBYYKLSGSJHCZSHDGQGXYZGXCHXZJWYQWGYHKSSEQZZNDZFKWYSSTCLZSTSYMCDHJXXYWEYXCZAYDMPXMDSXYB" +
+"SQMJMZJMTZQLPJYQZCGQHXJHHLXXHLHDLDJQCLDWBSXFZZYYSCHTYTYYBHECXHYKGJPXHHYZJFXHWHBDZFYZBCAPNPGNYDMSXHMMMMAMYNBYJTMPX" +
+"YYMCTHJBZYFCGTYHWPHFTWZZEZSBZEGPFMTSKFTYCMHFLLHGPZJXZJGZJYXZSBBQSCZZLZCCSTPGXMJSFTCCZJZDJXCYBZLFCJSYZFGSZLYBCWZZB" +
+"YZDZYPSWYJZXZBDSYUXLZZBZFYGCZXBZHZFTPBGZGEJBSTGKDMFHYZZJHZLLZZGJQZLSFDJSSCBZGPDLFZFZSZYZYZSYGCXSNXXCHCZXTZZLJFZGQ" +
+"SQYXZJQDCCZTQCDXZJYQJQCHXZTDLGSCXZSYQJQTZWLQDQZTQCHQQJZYEZZZPBWKDJFCJPZTYPQYQTTYNLMBDKTJZPQZQZZFPZSBNJLGYJDXJDZZK" +
+"ZGQKXDLPZJTCJDQBXDJQJSTCKNXBXZMSLYJCQMTJQWWCJQNJNLLLHJCWQTBZQYDZCZPZZDZYDDCYZZZCCJTTJFZDPRRTZTJDCQTQZDTJNPLZBCLLC" +
+"TZSXKJZQZPZLBZRBTJDCXFCZDBCCJJLTQQPLDCGZDBBZJCQDCJWYNLLZYZCCDWLLXWZLXRXNTQQCZXKQLSGDFQTDDGLRLAJJTKUYMKQLLTZYTDYYC" +
+"ZGJWYXDXFRSKSTQTENQMRKQZHHQKDLDAZFKYPBGGPZREBZZYKZZSPEGJXGYKQZZZSLYSYYYZWFQZYLZZLZHWCHKYPQGNPGBLPLRRJYXCCSYYHSFZF" +
+"YBZYYTGZXYLXCZWXXZJZBLFFLGSKHYJZEYJHLPLLLLCZGXDRZELRHGKLZZYHZLYQSZZJZQLJZFLNBHGWLCZCFJYSPYXZLZLXGCCPZBLLCYBBBBUBB" +
+"CBPCRNNZCZYRBFSRLDCGQYYQXYGMQZWTZYTYJXYFWTEHZZJYWLCCNTZYJJZDEDPZDZTSYQJHDYMBJNYJZLXTSSTPHNDJXXBYXQTZQDDTJTDYYTGWS" +
+"CSZQFLSHLGLBCZPHDLYZJYCKWTYTYLBNYTSDSYCCTYSZYYEBHEXHQDTWNYGYCLXTSZYSTQMYGZAZCCSZZDSLZCLZRQXYYELJSBYMXSXZTEMBBLLYY" +
+"LLYTDQYSHYMRQWKFKBFXNXSBYCHXBWJYHTQBPBSBWDZYLKGZSKYHXQZJXHXJXGNLJKZLYYCDXLFYFGHLJGJYBXQLYBXQPQGZTZPLNCYPXDJYQYDYM" +
+"RBESJYYHKXXSTMXRCZZYWXYQYBMCLLYZHQYZWQXDBXBZWZMSLPDMYSKFMZKLZCYQYCZLQXFZZYDQZPZYGYJYZMZXDZFYFYTTQTZHGSPCZMLCCYTZX" +
+"JCYTJMKSLPZHYSNZLLYTPZCTZZCKTXDHXXTQCYFKSMQCCYYAZHTJPCYLZLYJBJXTPNYLJYYNRXSYLMMNXJSMYBCSYSYLZYLXJJQYLDZLPQBFZZBLF" +
+"NDXQKCZFYWHGQMRDSXYCYTXNQQJZYYPFZXDYZFPRXEJDGYQBXRCNFYYQPGHYJDYZXGRHTKYLNWDZNTSMPKLBTHBPYSZBZTJZSZZJTYYXZPHSSZZBZ" +
+"CZPTQFZMYFLYPYBBJQXZMXXDJMTSYSKKBJZXHJCKLPSMKYJZCXTMLJYXRZZQSLXXQPYZXMKYXXXJCLJPRMYYGADYSKQLSNDHYZKQXZYZTCGHZTLML" +
+"WZYBWSYCTBHJHJFCWZTXWYTKZLXQSHLYJZJXTMPLPYCGLTBZZTLZJCYJGDTCLKLPLLQPJMZPAPXYZLKKTKDZCZZBNZDYDYQZJYJGMCTXLTGXSZLML" +
+"HBGLKFWNWZHDXUHLFMKYSLGXDTWWFRJEJZTZHYDXYKSHWFZCQSHKTMQQHTZHYMJDJSKHXZJZBZZXYMPAGQMSTPXLSKLZYNWRTSQLSZBPSPSGZWYHT" +
+"LKSSSWHZZLYYTNXJGMJSZSUFWNLSOZTXGXLSAMMLBWLDSZYLAKQCQCTMYCFJBSLXCLZZCLXXKSBZQCLHJPSQPLSXXCKSLNHPSFQQYTXYJZLQLDXZQ" +
+"JZDYYDJNZPTUZDSKJFSLJHYLZSQZLBTXYDGTQFDBYAZXDZHZJNHHQBYKNXJJQCZMLLJZKSPLDYCLBBLXKLELXJLBQYCXJXGCNLCQPLZLZYJTZLJGY" +
+"ZDZPLTQCSXFDMNYCXGBTJDCZNBGBQYQJWGKFHTNPYQZQGBKPBBYZMTJDYTBLSQMPSXTBNPDXKLEMYYCJYNZCTLDYKZZXDDXHQSHDGMZSJYCCTAYRZ" +
+"LPYLTLKXSLZCGGEXCLFXLKJRTLQJAQZNCMBYDKKCXGLCZJZXJHPTDJJMZQYKQSECQZDSHHADMLZFMMZBGNTJNNLGBYJBRBTMLBYJDZXLCJLPLDLPC" +
+"QDHLXZLYCBLCXZZJADJLNZMMSSSMYBHBSQKBHRSXXJMXSDZNZPXLGBRHWGGFCXGMSKLLTSJYYCQLTSKYWYYHYWXBXQYWPYWYKQLSQPTNTKHQCWDQK" +
+"TWPXXHCPTHTWUMSSYHBWCRWXHJMKMZNGWTMLKFGHKJYLSYYCXWHYECLQHKQHTTQKHFZLDXQWYZYYDESBPKYRZPJFYYZJCEQDZZDLATZBBFJLLCXDL" +
+"MJSSXEGYGSJQXCWBXSSZPDYZCXDNYXPPZYDLYJCZPLTXLSXYZYRXCYYYDYLWWNZSAHJSYQYHGYWWAXTJZDAXYSRLTDPSSYYFNEJDXYZHLXLLLZQZS" +
+"JNYQYQQXYJGHZGZCYJCHZLYCDSHWSHJZYJXCLLNXZJJYYXNFXMWFPYLCYLLABWDDHWDXJMCXZTZPMLQZHSFHZYNZTLLDYWLSLXHYMMYLMBWWKYXYA" +
+"DTXYLLDJPYBPWUXJMWMLLSAFDLLYFLBHHHBQQLTZJCQJLDJTFFKMMMBYTHYGDCQRDDWRQJXNBYSNWZDBYYTBJHPYBYTTJXAAHGQDQTMYSTQXKBTZP" +
+"KJLZRBEQQSSMJJBDJOTGTBXPGBKTLHQXJJJCTHXQDWJLWRFWQGWSHCKRYSWGFTGYGBXSDWDWRFHWYTJJXXXJYZYSLPYYYPAYXHYDQKXSHXYXGSKQH" +
+"YWFDDDPPLCJLQQEEWXKSYYKDYPLTJTHKJLTCYYHHJTTPLTZZCDLTHQKZXQYSTEEYWYYZYXXYYSTTJKLLPZMCYHQGXYHSRMBXPLLNQYDQHXSXXWGDQ" +
+"BSHYLLPJJJTHYJKYPPTHYYKTYEZYENMDSHLCRPQFDGFXZPSFTLJXXJBSWYYSKSFLXLPPLBBBLBSFXFYZBSJSSYLPBBFFFFSSCJDSTZSXZRYYSYFFS" +
+"YZYZBJTBCTSBSDHRTJJBYTCXYJEYLXCBNEBJDSYXYKGSJZBXBYTFZWGENYHHTHZHHXFWGCSTBGXKLSXYWMTMBYXJSTZSCDYQRCYTWXZFHMYMCXLZN" +
+"SDJTTTXRYCFYJSBSDYERXJLJXBBDEYNJGHXGCKGSCYMBLXJMSZNSKGXFBNBPTHFJAAFXYXFPXMYPQDTZCXZZPXRSYWZDLYBBKTYQPQJPZYPZJZNJP" +
+"ZJLZZFYSBTTSLMPTZRTDXQSJEHBZYLZDHLJSQMLHTXTJECXSLZZSPKTLZKQQYFSYGYWPCPQFHQHYTQXZKRSGTTSQCZLPTXCDYYZXSQZSLXLZMYCPC" +
+"QBZYXHBSXLZDLTCDXTYLZJYYZPZYZLTXJSJXHLPMYTXCQRBLZSSFJZZTNJYTXMYJHLHPPLCYXQJQQKZZSCPZKSWALQSBLCCZJSXGWWWYGYKTJBBZT" +
+"DKHXHKGTGPBKQYSLPXPJCKBMLLXDZSTBKLGGQKQLSBKKTFXRMDKBFTPZFRTBBRFERQGXYJPZSSTLBZTPSZQZSJDHLJQLZBPMSMMSXLQQNHKNBLRDD" +
+"NXXDHDDJCYYGYLXGZLXSYGMQQGKHBPMXYXLYTQWLWGCPBMQXCYZYDRJBHTDJYHQSHTMJSBYPLWHLZFFNYPMHXXHPLTBQPFBJWQDBYGPNZTPFZJGSD" +
+"DTQSHZEAWZZYLLTYYBWJKXXGHLFKXDJTMSZSQYNZGGSWQSPHTLSSKMCLZXYSZQZXNCJDQGZDLFNYKLJCJLLZLMZZNHYDSSHTHZZLZZBBHQZWWYCRZ" +
+"HLYQQJBEYFXXXWHSRXWQHWPSLMSSKZTTYGYQQWRSLALHMJTQJSMXQBJJZJXZYZKXBYQXBJXSHZTSFJLXMXZXFGHKZSZGGYLCLSARJYHSLLLMZXELG" +
+"LXYDJYTLFBHBPNLYZFBBHPTGJKWETZHKJJXZXXGLLJLSTGSHJJYQLQZFKCGNNDJSSZFDBCTWWSEQFHQJBSAQTGYPQLBXBMMYWXGSLZHGLZGQYFLZB" +
+"YFZJFRYSFMBYZHQGFWZSYFYJJPHZBYYZFFWODGRLMFTWLBZGYCQXCDJYGZYYYYTYTYDWEGAZYHXJLZYYHLRMGRXXZCLHNELJJTJTPWJYBJJBXJJTJ" +
+"TEEKHWSLJPLPSFYZPQQBDLQJJTYYQLYZKDKSQJYYQZLDQTGJQYZJSUCMRYQTHTEJMFCTYHYPKMHYZWJDQFHYYXWSHCTXRLJHQXHCCYYYJLTKTTYTM" +
+"XGTCJTZAYYOCZLYLBSZYWJYTSJYHBYSHFJLYGJXXTMZYYLTXXYPZLXYJZYZYYPNHMYMDYYLBLHLSYYQQLLNJJYMSOYQBZGDLYXYLCQYXTSZEGXHZG" +
+"LHWBLJHEYXTWQMAKBPQCGYSHHEGQCMWYYWLJYJHYYZLLJJYLHZYHMGSLJLJXCJJYCLYCJPCPZJZJMMYLCQLNQLJQJSXYJMLSZLJQLYCMMHCFMMFPQ" +
+"QMFYLQMCFFQMMMMHMZNFHHJGTTHHKHSLNCHHYQDXTMMQDCYZYXYQMYQYLTDCYYYZAZZCYMZYDLZFFFMMYCQZWZZMABTBYZTDMNZZGGDFTYPCGQYTT" +
+"SSFFWFDTZQSSYSTWXJHXYTSXXYLBYQHWWKXHZXWZNNZZJZJJQJCCCHYYXBZXZCYZTLLCQXYNJYCYYCYNZZQYYYEWYCZDCJYCCHYJLBTZYYCQWMPWP" +
+"YMLGKDLDLGKQQBGYCHJXY";
+// 375 polyphonic words are included here
+let oMultiDiff = { "19969": "DZ", "19975": "WM", "19988": "QJ", "20048": "YL", "20056": "SC", "20060": "NM",
+  "20094": "QG", "20127": "QJ", "20167": "QC", "20193": "YG", "20250": "KH", "20256": "ZC", "20282": "SC",
+  "20285": "QJG", "20291": "TD", "20314": "YD", "20340": "NE", "20375": "TD", "20389": "YJ", "20391": "CZ",
+  "20415": "PB", "20446": "YS", "20447": "SQ", "20504": "TC", "20608": "KG", "20854": "QJ", "20857": "ZC",
+  "20911": "PF",  "20985": "AW", "21032": "PB", "21048": "XQ", "21049": "SC", "21089": "YS", "21119": "JC",
+  "21242": "SB", "21273": "SC", "21305": "YP", "21306": "QO", "21330": "ZC", "21333": "SDC", "21345": "QK",
+  "21378": "CA", "21397": "SC", "21414": "XS", "21442": "SC", "21477": "JG", "21480": "TD", "21484": "ZS",
+  "21494": "YX", "21505": "YX", "21512": "HG", "21523": "XH", "21537": "PB", "21542": "PF", "21549": "KH",
+  "21571": "E", "21574": "DA", "21588": "TD", "21589": "O", "21618": "ZC", "21621": "KHA", "21632": "ZJ",
+  "21654": "KG", "21679": "LKG", "21683": "KH", "21710": "A", "21719": "YH", "21734": "WOE", "21769": "A",
+  "21780": "WN", "21804": "XH", "21834": "A", "21899": "ZD", "21903": "RN", "21908": "WO", "21939": "ZC",
+  "21956": "SA", "21964": "YA", "21970": "TD", "22003": "A", "22031": "JG", "22040": "XS", "22060": "ZC",
+  "22066": "ZC", "22079": "MH", "22129": "XJ", "22179": "XA", "22237": "NJ", "22244": "TD", "22280": "JQ",
+  "22300": "YH", "22313": "XW", "22331": "YQ", "22343": "YJ", "22351": "PH", "22395": "DC", "22412": "TD",
+  "22484": "PB", "22500": "PB", "22534": "ZD", "22549": "DH", "22561": "PB", "22612": "TD", "22771": "KQ",
+  "22831": "HB", "22841": "JG", "22855": "QJ", "22865": "XQ", "23013": "ML", "23081": "WM", "23487": "SX",
+  "23558": "QJ", "23561": "YW", "23586": "YW", "23614": "YW", "23615": "SN", "23631": "PB", "23646": "ZS",
+  "23663": "ZT", "23673": "YG", "23762": "TD", "23769": "ZS", "23780": "QJ", "23884": "QK", "24055": "XH",
+  "24113": "DC", "24162": "ZC", "24191": "GA", "24273": "QJ", "24324": "NL", "24377": "TD", "24378": "QJ",
+  "24439": "PF", "24554": "ZS", "24683": "TD", "24694": "WE", "24733": "LK", "24925": "TN", "25094": "ZG",
+  "25100": "XQ", "25103": "XH", "25153": "PB", "25170": "PB", "25179": "KG", "25203": "PB", "25240": "ZS",
+  "25282": "FB", "25303": "NA", "25324": "KG", "25341": "ZY", "25373": "WZ", "25375": "XJ", "25384": "A",
+  "25457": "A", "25528": "SD", "25530": "SC", "25552": "TD", "25774": "ZC", "25874": "ZC", "26044": "YW",
+  "26080": "WM", "26292": "PB", "26333": "PB", "26355": "ZY", "26366": "CZ", "26397": "ZC", "26399": "QJ",
+  "26415": "ZS", "26451": "SB", "26526": "ZC", "26552": "JG", "26561": "TD", "26588": "JG", "26597": "CZ",
+  "26629": "ZS", "26638": "YL", "26646": "XQ", "26653": "KG", "26657": "XJ", "26727": "HG", "26894": "ZC",
+  "26937": "ZS", "26946": "ZC", "26999": "KJ", "27099": "KJ", "27449": "YQ", "27481": "XS", "27542": "ZS",
+  "27663": "ZS", "27748": "TS", "27784": "SC", "27788": "ZD", "27795": "TD", "27812": "O", "27850": "PB",
+  "27852": "MB", "27895": "SL", "27898": "PL", "27973": "QJ", "27981": "KH", "27986": "HX", "27994": "XJ",
+  "28044": "YC", "28065": "WG", "28177": "SM", "28267": "QJ", "28291": "KH", "28337": "ZQ", "28463": "TL",
+  "28548": "DC", "28601": "TD", "28689": "PB", "28805": "JG", "28820": "QG", "28846": "PB", "28952": "TD",
+  "28975": "ZC", "29100": "A", "29325": "QJ", "29575": "SL", "29602": "FB", "30010": "TD", "30044": "CX",
+  "30058": "PF", "30091": "YSP", "30111": "YN", "30229": "XJ", "30427": "SC", "30465": "SX", "30631": "YQ",
+  "30655": "QJ", "30684": "QJG", "30707": "SD", "30729": "XH", "30796": "LG", "30917": "PB", "31074": "NM",
+  "31085": "JZ", "31109": "SC", "31181": "ZC", "31192": "MLB", "31293": "JQ", "31400": "YX", "31584": "YJ",
+  "31896": "ZN", "31909": "ZY", "31995": "XJ", "32321": "PF", "32327": "ZY", "32418": "HG", "32420": "XQ",
+  "32421": "HG", "32438": "LG", "32473": "GJ", "32488": "TD", "32521": "QJ", "32527": "PB", "32562": "ZSQ",
+  "32564": "JZ", "32735": "ZD", "32793": "PB", "33071": "PF", "33098": "XL", "33100": "YA", "33152": "PB",
+  "33261": "CX", "33324": "BP", "33333": "TD", "33406": "YA", "33426": "WM", "33432": "PB", "33445": "JG",
+  "33486": "ZN", "33493": "TS", "33507": "QJ", "33540": "QJ", "33544": "ZC", "33564": "XQ", "33617": "YT",
+  "33632": "QJ", "33636": "XH", "33637": "YX", "33694": "WG", "33705": "PF", "33728": "YW", "33882": "SR",
+  "34067": "WM", "34074": "YW", "34121": "QJ", "34255": "ZC", "34259": "XL", "34425": "JH", "34430": "XH",
+  "34485": "KH", "34503": "YS", "34532": "HG", "34552": "XS", "34558": "YE", "34593": "ZL", "34660": "YQ",
+  "34892": "XH", "34928": "SC", "34999": "QJ", "35048": "PB", "35059": "SC", "35098": "ZC", "35203": "TQ",
+  "35265": "JX", "35299": "JX", "35782": "SZ", "35828": "YS", "35830": "E", "35843": "TD", "35895": "YG",
+  "35977": "MH", "36158": "JG", "36228": "QJ", "36426": "XQ", "36466": "DC", "36710": "JC", "36711": "ZYG",
+  "36767": "PB", "36866": "SK", "36951": "YW", "37034": "YX", "37063": "XH", "37218": "ZC", "37325": "ZC",
+  "38063": "PB", "38079": "TD", "38085": "QY", "38107": "DC", "38116": "TD", "38123": "YD", "38224": "HG",
+  "38241": "XTC", "38271": "ZC", "38415": "YE", "38426": "KH", "38461": "YD", "38463": "AE", "38466": "PB",
+  "38477": "XJ", "38518": "YT", "38551": "WK", "38585": "ZC", "38704": "XS", "38739": "LJ", "38761": "GJ",
+  "38808": "SQ", "39048": "JG", "39049": "XJ", "39052": "HG", "39076": "CZ", "39271": "XT", "39534": "TD",
+  "39552": "TD", "39584": "PB", "39647": "SB", "39730": "LG", "39748": "TPB", "40109": "ZQ", "40479": "ND",
+  "40516": "HG", "40536": "HG", "40583": "QJ", "40765": "YQ", "40784": "QJ", "40840": "YK", "40863": "QJG" };
+
+// Program that returns the first letter array of Chinese characters
+export function makePy(str) {
+  if (typeof(str) != "string")
+    throw new Error("函数makePy需要字符串类型参数!");
+  var arrResult = [];
+  // Convert string to array
+  for (var i = 0, len = str.length; i < len; i++) {
+    var ch = str.charAt(i);
+    arrResult.push(checkCh(ch));
+  }
+  return mkRslt(arrResult);
+}
+
+// Check processing Chinese characters
+function checkCh(ch) {
+  var uni = ch.charCodeAt(Constants.CHAR_CODE);
+  // If it is not within the scope of Chinese character processing, return the original character, and you can also call your own processing function
+  if (uni > Constants.UNI_MAX || uni < Constants.UNI_MIN)
+  return ch; //dealWithOthers(ch);
+  // Check whether it is a polyphonic word, it is processed as a polyphonic word, if not, just find the corresponding first letter in the strChineseFirstPY string.
+  return (oMultiDiff[uni] ? oMultiDiff[uni] : (strChineseFirstPY.charAt(uni - Constants.UNI_MIN)));
+}
+
+// Process the characters and return an array of letters
+function mkRslt(arr) {
+  var arrRslt = [""];
+  for (var i = 0, len = arr.length; i < len; i++) {
+    var str = arr[i];
+    var strlen = str.length;
+    if (strlen == 1) {
+      for (var k = 0; k < arrRslt.length; k++) {
+        arrRslt[k] += str;
+      }
+    } else {
+      var tmpArr = arrRslt.slice(0);
+      arrRslt = [];
+      for (k = 0; k < strlen; k++) {
+        // Copy an identical arrRslt
+        var tmp = tmpArr.slice(0);
+        // Add the current character str[k] to the end of each element
+        for (var j = 0; j < tmp.length; j++) {
+          tmp[j] += str.charAt(k);
+        }
+        // Concatenate the copied and modified array to arrRslt
+        arrRslt = arrRslt.concat(tmp);
+      }
+    }
+  }
+  return arrRslt;
+}
+
+/**
+ * Get the corresponding permission group id according to the permission
+ * @param {String} permission app name id
+ * @return {Number} groupId
+ */
+export function getPermissionGroup(permission: string) {
+  for (var i = 0; i < permissionGroups.length; i++) {
+    if (permissionGroups[i].permissionName == permission) {
+      if(permissionGroups[i].groupName == 'OTHER') {
+        return {
+          "name": permissionGroups[i].groupName,
+          "groupName": permissionGroups[i].label,
+          "label": permissionGroups[i].text,
+          "icon": permissionGroups[i].icon,
+          "description": '',
+          "permissions": [
+            permissionGroups[i].permissionName
+          ]
+        }
+      }else {
+        return groups[permissionGroups[i].groupId]
+      }
+    }
+  }
+}
+
+const TAG = 'PermissionManager_Log';
+
+export class Log {
+  static info(log) {
+    console.info(`Info: ${TAG}  ${log}`)
+  }
+
+  static error(log) {
+    console.error(`Error: ${TAG}  ${log}`)
+  }
 }
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/application-secondary.ets b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/application-secondary.ets
index 6ff3deb72f928a82c9aee361ad2a9bb41d1d1a2c..e7dcc0ea9e15ec1a09237dbb4a94917a68016aa7 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/application-secondary.ets
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/application-secondary.ets
@@ -1,346 +1,346 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-import { backBar } from "../common/components/backBar";
-import router from '@system.router';
-import abilityAccessCtrl from '@ohos.abilityAccessCtrl';
-import { groups } from "../common/model/permissionGroup";
-import Constants from '../common/utils/constant';
-
-var TAG = 'PermissionManager_MainAbility:'
-
-const allowedStatus = 0; // Status: Allowed
-const bannedStatus = 1; // Status: Banned
-
-class AllowedObj {
-  groupName: string;
-  permission: string[];
-  constructor(groupName: string, permission: string[]) {
-    this.groupName = groupName;
-    this.permission = permission;
-  }
-} // Class Allowed
-class BannedObj {
-  groupName: string;
-  permission: string[];
-  constructor(groupName: string, permission: string[]) {
-    this.groupName = groupName;
-    this.permission = permission;
-  }
-} // Class Banned
-
-@Entry
-@Component
-struct appNamePlusPage {
-  @State allowedListItem: AllowedObj[] = []; // Array of allowed permissions
-  @State bannedListItem: BannedObj[] = []; // array of forbidden permissions
-  private routerData = router.getParams().routerData; // Routing jump data
-
-  @Builder ListItemLayout(item, index, status) {
-    ListItem() {
-      Row() {
-        Column() {
-          Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
-            Row() {
-              Text(item.groupName)
-                .fontSize(Constants.TEXT_MIDDLE_FONT_SIZE)
-                .fontColor($r('app.color.text_color'))
-                .fontWeight(FontWeight.Medium)
-                .flexGrow(Constants.FLEX_GROW)
-              Image($r('app.media.rightarrow'))
-                .objectFit(ImageFit.Contain)
-                .height(Constants.IMAGE_HEIGHT)
-                .width(Constants.IMAGE_WIDTH)
-            }
-            .width(Constants.FULL_WIDTH)
-            .height(Constants.LISTITEM_ROW_HEIGHT)
-          }
-          if (!index) {
-            Row() {
-              Column()
-                .backgroundColor($r('app.color.text_decoration_color'))
-                .width(Constants.FULL_WIDTH)
-                .height(Constants.TEXT_DECORATION_HEIGHT)
-            }
-          }
-        }.onClick(() => {
-          if (status === 'allow') {
-            if (item.groupName == "其他权限") {
-              router.push({
-                uri: 'pages/other-permissions',
-                params: {
-                  routerData: this.routerData.bundleName,
-                  backTitle: item.groupName,
-                  permission: item.permission,
-                  status: allowedStatus,
-                  tokenId: this.routerData.tokenId
-                }
-              });
-            } else {
-              router.push({
-                uri: 'pages/application-tertiary',
-                params: {
-                  routerData: this.routerData.bundleName,
-                  backTitle: item.groupName,
-                  permission: item.permission,
-                  status: allowedStatus
-                }
-              });
-            }
-          }
-          else if (status === 'banned') {
-            if (item.groupName == "其他权限") {
-              router.push({
-                uri: 'pages/other-permissions',
-                params: {
-                  routerData: this.routerData.bundleName,
-                  backTitle: item.groupName,
-                  permission: item.permission,
-                  status: bannedStatus,
-                  tokenId: this.routerData.tokenId
-                }
-              });
-            } else {
-              router.push({
-                uri: 'pages/application-tertiary',
-                params: {
-                  routerData: this.routerData.bundleName,
-                  backTitle: item.groupName,
-                  permission: item.permission,
-                  status: bannedStatus
-                }
-              });
-            }
-          }
-        })
-      }
-    }.padding({ left: Constants.DEFAULT_PADDING_START, right: Constants.DEFAULT_PADDING_END })
-  }
-
-  /**
-   * Initialize permission status information and group permission information
-   */
-  async initialPermissions() {
-    var reqPermissions = this.routerData.permissions;
-    var reqGroupIds = this.routerData.groupId;
-
-    if (!reqGroupIds.length) {
-      this.allowedListItem = [];
-      this.bannedListItem = [];
-      return;
-    }
-
-    for (let i = 0; i < reqGroupIds.length; i++) {
-      let id = reqGroupIds[i];
-      let groupName = groups[id].groupName;
-      let groupReqPermissons = [];
-      for (let j = 0; j < reqPermissions.length; j++) {
-        let permission = reqPermissions[j];
-        if (groups[id].permissions.indexOf(permission) != -1) {
-          groupReqPermissons.push(permission)
-        }
-      }
-      let isGranted = true;
-      for (let i = 0; i < groupReqPermissons.length; i++) {
-        let permission = groupReqPermissons[i]
-        let res = await abilityAccessCtrl.createAtManager().verifyAccessToken(
-          this.routerData.tokenId, permission);
-        if (res != 0) {
-          isGranted = false;
-        }
-      }
-
-      if (isGranted) {
-        this.allowedListItem.push(new AllowedObj(groupName, groupReqPermissons));
-      } else {
-        this.bannedListItem.push(new BannedObj(groupName, groupReqPermissons));
-      }
-    }
-  }
-
-  /**
-   * Lifecycle function, triggered once when this page is displayed
-   */
-  onPageShow() {
-    console.log(TAG + 'onPageShow application-secondary')
-    this.initialPermissions();
-  }
-
-  /**
-   * Lifecycle function, triggered once when this page disappears
-   */
-  onPageHide() {
-    console.log(TAG + 'onPageHide application-secondary')
-    setTimeout(()=> {
-      this.allowedListItem = [];
-      this.bannedListItem = [];
-    }, Constants.DELAY_TIME)
-  }
-
-  build() {
-    Column(){
-      GridContainer({ gutter: Constants.GUTTER, margin: Constants.GRID_MARGIN }) {
-        Row({}) {
-          Row()
-            .useSizeType({
-              xs: { span: Constants.LEFT_XS_SPAN, offset: Constants.LEFT_XS_OFFSET },
-              sm: { span: Constants.LEFT_SM_SPAN, offset: Constants.LEFT_SM_OFFSET },
-              md: { span: Constants.LEFT_MD_SPAN, offset: Constants.LEFT_MD_OFFSET },
-              lg: { span: Constants.LEFT_LG_SPAN, offset: Constants.LEFT_LG_OFFSET }
-            })
-            .height(Constants.FULL_HEIGHT)
-          Row() {
-            Column() {
-              Row() {
-                backBar({ title: JSON.stringify(this.routerData.labelId), recordable: false })
-              }
-              Row() {
-                Column() {
-                  if (!this.allowedListItem.length && !this.bannedListItem.length) {
-                    Row() {
-                      List() {
-                        ListItem() {
-                          Row() {
-                            Column() {
-                              Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
-                                Row() {
-                                  Column() {
-                                    Row() {
-                                      Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
-                                        Text($r('app.string.no_permission'))
-                                          .fontSize(Constants.TEXT_MIDDLE_FONT_SIZE)
-                                          .fontColor($r('app.color.text_color'))
-                                      }.margin({ top: Constants.FLEX_MARGIN_TOP, bottom: Constants.FLEX_MARGIN_BOTTOM })
-                                    }.height(Constants.FULL_HEIGHT)
-                                  }.flexGrow(Constants.FLEX_GROW)
-                                   .constraintSize({minHeight: Constants.CONSTRAINTSIZE_MINHEIGHT })
-                                }
-                                .width(Constants.FULL_WIDTH)
-                                .height(Constants.LISTITEM_ROW_HEIGHT)
-                              }
-                            }
-                          }
-                        }.padding({ left: Constants.LISTITEM_PADDING_LEFT, right: Constants.LISTITEM_PADDING_RIGHT })
-                      }
-                      .backgroundColor($r('app.color.default_background_color'))
-                      .borderRadius(Constants.BORDER_RADIUS)
-                      .padding({ top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
-                    }.margin({ top: Constants.ROW_MARGIN_TOP })
-                     .padding({ left: Constants.SECONDARY_LIST_PADDING_LEFT, right: Constants.SECONDARY_LIST_PADDING_RIGHT })
-                  } else {
-                    Scroll() {
-                      List() {
-                        if (this.allowedListItem.length) {
-                          ListItem() {
-                            Row() {
-                              Text($r('app.string.allowed'))
-                                .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
-                                .fontColor($r('app.color.label_color_light'))
-                                .fontWeight(FontWeight.Medium)
-                                .lineHeight(Constants.SUBTITLE_LINE_HEIGHT)
-                            }.constraintSize({ minHeight: Constants.SUBTITLE_MIN_HEIGHT })
-                            .padding({ top: Constants.SUBTITLE_PADDING_TOP, bottom: Constants.SUBTITLE_PADDING_BOTTOM,
-                              left: Constants.SECONDARY_TEXT_MARGIN_LEFT})
-                          }
-
-                          ListItem() {
-                            Row() {
-                              List() {
-                                ForEach(this.allowedListItem.slice(Constants.SLICE_START, this.allowedListItem.length - 1),
-                                  (item) => {
-                                    this.ListItemLayout(item, Constants.SLICE_START_INDEX, 'allow')
-                                  }, item => item.toString())
-                                ForEach(this.allowedListItem.slice(Constants.SLICE_END), (item, index) => {
-                                  this.ListItemLayout(item, Constants.SLICE_END_INDEX, 'allow')
-                                }, item => item.toString())
-                              }
-                              .backgroundColor($r('app.color.default_background_color'))
-                              .borderRadius(Constants.BORDER_RADIUS)
-                              .padding({ top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
-                            }.margin({ top: Constants.ROW_MARGIN_TOP })
-                            .padding({
-                              left: Constants.SECONDARY_LIST_PADDING_LEFT,
-                              right: Constants.SECONDARY_LIST_PADDING_RIGHT
-                            })
-                          }
-                        }
-                        if (this.bannedListItem.length) {
-                          ListItem() {
-                            Row() {
-                              Text($r('app.string.banned'))
-                                .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
-                                .fontColor($r('app.color.label_color_light'))
-                                .fontWeight(FontWeight.Medium)
-                                .lineHeight(Constants.SUBTITLE_LINE_HEIGHT)
-                            }.constraintSize({ minHeight: Constants.SUBTITLE_MIN_HEIGHT })
-                            .padding({ top: Constants.SUBTITLE_PADDING_TOP, bottom: Constants.SUBTITLE_PADDING_BOTTOM,
-                              left: Constants.SECONDARY_TEXT_MARGIN_LEFT})
-                          }
-
-                          ListItem() {
-                            Row() {
-                              List() {
-                                ForEach(this.bannedListItem.slice(Constants.SLICE_START, this.bannedListItem.length - 1),
-                                  (item) => {
-                                    this.ListItemLayout(item, Constants.SLICE_START_INDEX, 'banned')
-                                  }, item => item.toString())
-                                ForEach(this.bannedListItem.slice(Constants.SLICE_END), (item) => {
-                                  this.ListItemLayout(item, Constants.SLICE_END_INDEX, 'banned')
-                                }, item => item.toString())
-                              }
-                              .backgroundColor($r('app.color.default_background_color'))
-                              .borderRadius(Constants.BORDER_RADIUS)
-                              .padding({ top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
-                            }.margin({ top: Constants.ROW_MARGIN_TOP })
-                            .padding({
-                              left: Constants.SECONDARY_LIST_PADDING_LEFT,
-                              right: Constants.SECONDARY_LIST_PADDING_RIGHT
-                            })
-                          }
-                        }
-                      }
-                    }.scrollBar(BarState.Off)
-                  }
-                }
-                .width(Constants.FULL_WIDTH)
-                .height(Constants.FULL_HEIGHT)
-              }
-              .layoutWeight(Constants.LAYOUT_WEIGHT)
-            }
-          }
-          .useSizeType({
-            xs: { span: Constants.MIDDLE_XS_SPAN, offset: Constants.MIDDLE_XS_OFFSET },
-            sm: { span: Constants.MIDDLE_SM_SPAN, offset: Constants.MIDDLE_SM_OFFSET },
-            md: { span: Constants.MIDDLE_MD_SPAN, offset: Constants.MIDDLE_MD_OFFSET },
-            lg: { span: Constants.MIDDLE_LG_SPAN, offset: Constants.MIDDLE_LG_OFFSET }
-          })
-          .height(Constants.FULL_HEIGHT)
-          Row()
-            .useSizeType({
-              xs: { span: Constants.RIGHT_XS_SPAN, offset: Constants.RIGHT_XS_OFFSET },
-              sm: { span: Constants.RIGHT_SM_SPAN, offset: Constants.RIGHT_SM_OFFSET },
-              md: { span: Constants.RIGHT_MD_SPAN, offset: Constants.RIGHT_MD_OFFSET },
-              lg: { span: Constants.RIGHT_LG_SPAN, offset: Constants.RIGHT_LG_OFFSET }
-            })
-            .height(Constants.FULL_HEIGHT)
-        }
-        .height(Constants.FULL_HEIGHT)
-        .width(Constants.FULL_WIDTH)
-        .backgroundColor($r("sys.color.ohos_id_color_sub_background"))
-        .opacity(Constants.MANAGEMENT_TRANSPARENCY)
-      }
-    }
-  }
-}
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+import { backBar } from "../common/components/backBar";
+import router from '@system.router';
+import abilityAccessCtrl from '@ohos.abilityAccessCtrl';
+import { groups } from "../common/model/permissionGroup";
+import Constants from '../common/utils/constant';
+
+var TAG = 'PermissionManager_MainAbility:'
+
+const allowedStatus = 0; // Status: Allowed
+const bannedStatus = 1; // Status: Banned
+
+class AllowedObj {
+  groupName: string;
+  permission: string[];
+  constructor(groupName: string, permission: string[]) {
+    this.groupName = groupName;
+    this.permission = permission;
+  }
+} // Class Allowed
+class BannedObj {
+  groupName: string;
+  permission: string[];
+  constructor(groupName: string, permission: string[]) {
+    this.groupName = groupName;
+    this.permission = permission;
+  }
+} // Class Banned
+
+@Entry
+@Component
+struct appNamePlusPage {
+  @State allowedListItem: AllowedObj[] = []; // Array of allowed permissions
+  @State bannedListItem: BannedObj[] = []; // array of forbidden permissions
+  private routerData = router.getParams().routerData; // Routing jump data
+
+  @Builder ListItemLayout(item, index, status) {
+    ListItem() {
+      Row() {
+        Column() {
+          Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
+            Row() {
+              Text(item.groupName)
+                .fontSize(Constants.TEXT_MIDDLE_FONT_SIZE)
+                .fontColor($r('app.color.text_color'))
+                .fontWeight(FontWeight.Medium)
+                .flexGrow(Constants.FLEX_GROW)
+              Image($r('app.media.rightarrow'))
+                .objectFit(ImageFit.Contain)
+                .height(Constants.IMAGE_HEIGHT)
+                .width(Constants.IMAGE_WIDTH)
+            }
+            .width(Constants.FULL_WIDTH)
+            .height(Constants.LISTITEM_ROW_HEIGHT)
+          }
+          if (!index) {
+            Row() {
+              Column()
+                .backgroundColor($r('app.color.text_decoration_color'))
+                .width(Constants.FULL_WIDTH)
+                .height(Constants.TEXT_DECORATION_HEIGHT)
+            }
+          }
+        }.onClick(() => {
+          if (status === 'allow') {
+            if (item.groupName == "其他权限") {
+              router.push({
+                uri: 'pages/other-permissions',
+                params: {
+                  routerData: this.routerData.bundleName,
+                  backTitle: item.groupName,
+                  permission: item.permission,
+                  status: allowedStatus,
+                  tokenId: this.routerData.tokenId
+                }
+              });
+            } else {
+              router.push({
+                uri: 'pages/application-tertiary',
+                params: {
+                  routerData: this.routerData.bundleName,
+                  backTitle: item.groupName,
+                  permission: item.permission,
+                  status: allowedStatus
+                }
+              });
+            }
+          }
+          else if (status === 'banned') {
+            if (item.groupName == "其他权限") {
+              router.push({
+                uri: 'pages/other-permissions',
+                params: {
+                  routerData: this.routerData.bundleName,
+                  backTitle: item.groupName,
+                  permission: item.permission,
+                  status: bannedStatus,
+                  tokenId: this.routerData.tokenId
+                }
+              });
+            } else {
+              router.push({
+                uri: 'pages/application-tertiary',
+                params: {
+                  routerData: this.routerData.bundleName,
+                  backTitle: item.groupName,
+                  permission: item.permission,
+                  status: bannedStatus
+                }
+              });
+            }
+          }
+        })
+      }
+    }.padding({ left: Constants.DEFAULT_PADDING_START, right: Constants.DEFAULT_PADDING_END })
+  }
+
+  /**
+   * Initialize permission status information and group permission information
+   */
+  async initialPermissions() {
+    var reqPermissions = this.routerData.permissions;
+    var reqGroupIds = this.routerData.groupId;
+
+    if (!reqGroupIds.length) {
+      this.allowedListItem = [];
+      this.bannedListItem = [];
+      return;
+    }
+
+    for (let i = 0; i < reqGroupIds.length; i++) {
+      let id = reqGroupIds[i];
+      let groupName = groups[id].groupName;
+      let groupReqPermissons = [];
+      for (let j = 0; j < reqPermissions.length; j++) {
+        let permission = reqPermissions[j];
+        if (groups[id].permissions.indexOf(permission) != -1) {
+          groupReqPermissons.push(permission)
+        }
+      }
+      let isGranted = true;
+      for (let i = 0; i < groupReqPermissons.length; i++) {
+        let permission = groupReqPermissons[i]
+        let res = await abilityAccessCtrl.createAtManager().verifyAccessToken(
+          this.routerData.tokenId, permission);
+        if (res != 0) {
+          isGranted = false;
+        }
+      }
+
+      if (isGranted) {
+        this.allowedListItem.push(new AllowedObj(groupName, groupReqPermissons));
+      } else {
+        this.bannedListItem.push(new BannedObj(groupName, groupReqPermissons));
+      }
+    }
+  }
+
+  /**
+   * Lifecycle function, triggered once when this page is displayed
+   */
+  onPageShow() {
+    console.log(TAG + 'onPageShow application-secondary')
+    this.initialPermissions();
+  }
+
+  /**
+   * Lifecycle function, triggered once when this page disappears
+   */
+  onPageHide() {
+    console.log(TAG + 'onPageHide application-secondary')
+    setTimeout(()=> {
+      this.allowedListItem = [];
+      this.bannedListItem = [];
+    }, Constants.DELAY_TIME)
+  }
+
+  build() {
+    Column(){
+      GridContainer({ gutter: Constants.GUTTER, margin: Constants.GRID_MARGIN }) {
+        Row({}) {
+          Row()
+            .useSizeType({
+              xs: { span: Constants.LEFT_XS_SPAN, offset: Constants.LEFT_XS_OFFSET },
+              sm: { span: Constants.LEFT_SM_SPAN, offset: Constants.LEFT_SM_OFFSET },
+              md: { span: Constants.LEFT_MD_SPAN, offset: Constants.LEFT_MD_OFFSET },
+              lg: { span: Constants.LEFT_LG_SPAN, offset: Constants.LEFT_LG_OFFSET }
+            })
+            .height(Constants.FULL_HEIGHT)
+          Row() {
+            Column() {
+              Row() {
+                backBar({ title: JSON.stringify(this.routerData.labelId), recordable: false })
+              }
+              Row() {
+                Column() {
+                  if (!this.allowedListItem.length && !this.bannedListItem.length) {
+                    Row() {
+                      List() {
+                        ListItem() {
+                          Row() {
+                            Column() {
+                              Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
+                                Row() {
+                                  Column() {
+                                    Row() {
+                                      Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
+                                        Text($r('app.string.no_permission'))
+                                          .fontSize(Constants.TEXT_MIDDLE_FONT_SIZE)
+                                          .fontColor($r('app.color.text_color'))
+                                      }.margin({ top: Constants.FLEX_MARGIN_TOP, bottom: Constants.FLEX_MARGIN_BOTTOM })
+                                    }.height(Constants.FULL_HEIGHT)
+                                  }.flexGrow(Constants.FLEX_GROW)
+                                   .constraintSize({minHeight: Constants.CONSTRAINTSIZE_MINHEIGHT })
+                                }
+                                .width(Constants.FULL_WIDTH)
+                                .height(Constants.LISTITEM_ROW_HEIGHT)
+                              }
+                            }
+                          }
+                        }.padding({ left: Constants.LISTITEM_PADDING_LEFT, right: Constants.LISTITEM_PADDING_RIGHT })
+                      }
+                      .backgroundColor($r('app.color.default_background_color'))
+                      .borderRadius(Constants.BORDER_RADIUS)
+                      .padding({ top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
+                    }.margin({ top: Constants.ROW_MARGIN_TOP })
+                     .padding({ left: Constants.SECONDARY_LIST_PADDING_LEFT, right: Constants.SECONDARY_LIST_PADDING_RIGHT })
+                  } else {
+                    Scroll() {
+                      List() {
+                        if (this.allowedListItem.length) {
+                          ListItem() {
+                            Row() {
+                              Text($r('app.string.allowed'))
+                                .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
+                                .fontColor($r('app.color.label_color_light'))
+                                .fontWeight(FontWeight.Medium)
+                                .lineHeight(Constants.SUBTITLE_LINE_HEIGHT)
+                            }.constraintSize({ minHeight: Constants.SUBTITLE_MIN_HEIGHT })
+                            .padding({ top: Constants.SUBTITLE_PADDING_TOP, bottom: Constants.SUBTITLE_PADDING_BOTTOM,
+                              left: Constants.SECONDARY_TEXT_MARGIN_LEFT})
+                          }
+
+                          ListItem() {
+                            Row() {
+                              List() {
+                                ForEach(this.allowedListItem.slice(Constants.SLICE_START, this.allowedListItem.length - 1),
+                                  (item) => {
+                                    this.ListItemLayout(item, Constants.SLICE_START_INDEX, 'allow')
+                                  }, item => item.toString())
+                                ForEach(this.allowedListItem.slice(Constants.SLICE_END), (item, index) => {
+                                  this.ListItemLayout(item, Constants.SLICE_END_INDEX, 'allow')
+                                }, item => item.toString())
+                              }
+                              .backgroundColor($r('app.color.default_background_color'))
+                              .borderRadius(Constants.BORDER_RADIUS)
+                              .padding({ top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
+                            }.margin({ top: Constants.ROW_MARGIN_TOP })
+                            .padding({
+                              left: Constants.SECONDARY_LIST_PADDING_LEFT,
+                              right: Constants.SECONDARY_LIST_PADDING_RIGHT
+                            })
+                          }
+                        }
+                        if (this.bannedListItem.length) {
+                          ListItem() {
+                            Row() {
+                              Text($r('app.string.banned'))
+                                .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
+                                .fontColor($r('app.color.label_color_light'))
+                                .fontWeight(FontWeight.Medium)
+                                .lineHeight(Constants.SUBTITLE_LINE_HEIGHT)
+                            }.constraintSize({ minHeight: Constants.SUBTITLE_MIN_HEIGHT })
+                            .padding({ top: Constants.SUBTITLE_PADDING_TOP, bottom: Constants.SUBTITLE_PADDING_BOTTOM,
+                              left: Constants.SECONDARY_TEXT_MARGIN_LEFT})
+                          }
+
+                          ListItem() {
+                            Row() {
+                              List() {
+                                ForEach(this.bannedListItem.slice(Constants.SLICE_START, this.bannedListItem.length - 1),
+                                  (item) => {
+                                    this.ListItemLayout(item, Constants.SLICE_START_INDEX, 'banned')
+                                  }, item => item.toString())
+                                ForEach(this.bannedListItem.slice(Constants.SLICE_END), (item) => {
+                                  this.ListItemLayout(item, Constants.SLICE_END_INDEX, 'banned')
+                                }, item => item.toString())
+                              }
+                              .backgroundColor($r('app.color.default_background_color'))
+                              .borderRadius(Constants.BORDER_RADIUS)
+                              .padding({ top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
+                            }.margin({ top: Constants.ROW_MARGIN_TOP })
+                            .padding({
+                              left: Constants.SECONDARY_LIST_PADDING_LEFT,
+                              right: Constants.SECONDARY_LIST_PADDING_RIGHT
+                            })
+                          }
+                        }
+                      }
+                    }.scrollBar(BarState.Off)
+                  }
+                }
+                .width(Constants.FULL_WIDTH)
+                .height(Constants.FULL_HEIGHT)
+              }
+              .layoutWeight(Constants.LAYOUT_WEIGHT)
+            }
+          }
+          .useSizeType({
+            xs: { span: Constants.MIDDLE_XS_SPAN, offset: Constants.MIDDLE_XS_OFFSET },
+            sm: { span: Constants.MIDDLE_SM_SPAN, offset: Constants.MIDDLE_SM_OFFSET },
+            md: { span: Constants.MIDDLE_MD_SPAN, offset: Constants.MIDDLE_MD_OFFSET },
+            lg: { span: Constants.MIDDLE_LG_SPAN, offset: Constants.MIDDLE_LG_OFFSET }
+          })
+          .height(Constants.FULL_HEIGHT)
+          Row()
+            .useSizeType({
+              xs: { span: Constants.RIGHT_XS_SPAN, offset: Constants.RIGHT_XS_OFFSET },
+              sm: { span: Constants.RIGHT_SM_SPAN, offset: Constants.RIGHT_SM_OFFSET },
+              md: { span: Constants.RIGHT_MD_SPAN, offset: Constants.RIGHT_MD_OFFSET },
+              lg: { span: Constants.RIGHT_LG_SPAN, offset: Constants.RIGHT_LG_OFFSET }
+            })
+            .height(Constants.FULL_HEIGHT)
+        }
+        .height(Constants.FULL_HEIGHT)
+        .width(Constants.FULL_WIDTH)
+        .backgroundColor($r("sys.color.ohos_id_color_sub_background"))
+        .opacity(Constants.MANAGEMENT_TRANSPARENCY)
+      }
+    }
+  }
+}
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/application-tertiary.ets b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/application-tertiary.ets
index e4d4e0c5258a83dc22bb58dbeca54f13fa49ae7f..e5b47e7638dbfda8281c7d7f89de3656527dbf62 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/application-tertiary.ets
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/application-tertiary.ets
@@ -1,431 +1,431 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-import { backBar } from "../common/components/backBar";
-import router from '@system.router';
-import bundle from "@ohos.bundle";
-import { getAppLabel, getAppIcon, verifyAccessToken } from "../common/utils/utils";
-import abilityAccessCtrl from '@ohos.abilityAccessCtrl';
-import Resmgr from '@ohos.resourceManager'
-import { authorizeDialog } from "../common/components/dialog";
-import { permissionDescriptions, permissionGroups, showSubpermissionsGrop } from "../common/model/permissionGroup";
-import Constants from '../common/utils/constant';
-
-var TAG = 'PermissionManager_MainAbility:'
-
-let routerData = router.getParams().routerData; // Routing jump data
-let backTitle = router.getParams().backTitle; // return title name
-let status = router.getParams().status; // Status: Allowed, Forbidden
-let permissions = router.getParams().permission; // permissions name
-let nowGrantResult = Constants.PERMISSION_NUM; // Authorization results now
-let nowRevokeResult = Constants.PERMISSION_NUM; // Now deauthorize results
-let GrantResultFlag = []; // Authorization result Flag
-let RevokeResultFlag = []; // Cancel authorization result Flag
-let reason = null  // Authorized reason
-class MeidaDocObj {
-  name: string
-  index: number
-  groupName: string
-  accessTokenId: string
-  permissions: []
-  constructor(
-    name: string,
-    index: number,
-    groupName: string,
-    accessTokenId: string,
-    permissions: []
-  ) {
-    this.name = name
-    this.index = index
-    this.groupName = groupName
-    this.accessTokenId = accessTokenId
-    this.permissions = permissions
-  }
-}; // permission information class
-class MediaListObj {
-  labelId: string
-  iconId: string
-  versionName: string
-  description: string
-  constructor(
-    labelId: string,
-    iconId: string,
-    versionName: string,
-    description: string
-  ) {
-    this.labelId = labelId
-    this.iconId = iconId
-    this.versionName = versionName
-    this.description = description
-  }
-}; // Permission application information class
-
-@Entry
-@Component
-struct mediaDocumentPage {
-  build() {
-    Column() {
-      GridContainer({ gutter: Constants.GUTTER, margin: Constants.GRID_MARGIN }) {
-        Row() {
-          Row()
-            .useSizeType({
-              xs: { span: Constants.LEFT_XS_SPAN, offset: Constants.LEFT_XS_OFFSET },
-              sm: { span: Constants.LEFT_SM_SPAN, offset: Constants.LEFT_SM_OFFSET },
-              md: { span: Constants.LEFT_MD_SPAN, offset: Constants.LEFT_MD_OFFSET },
-              lg: { span: Constants.LEFT_LG_SPAN, offset: Constants.LEFT_LG_OFFSET }
-            })
-            .height(Constants.FULL_HEIGHT)
-          Row() {
-            Column() {
-              Row() {
-                backBar({ title: JSON.stringify(backTitle), recordable: false })
-              }
-              Row() {
-                Column() {
-                  mediaDocumentItem()
-                }.width(Constants.FULL_WIDTH)
-              }
-              .margin({ top: Constants.TITLE_MARGIN_BOTTOM })
-              .layoutWeight(Constants.LAYOUT_WEIGHT)
-            }
-          }
-          .useSizeType({
-            xs: { span: Constants.MIDDLE_XS_SPAN, offset: Constants.MIDDLE_XS_OFFSET },
-            sm: { span: Constants.MIDDLE_SM_SPAN, offset: Constants.MIDDLE_SM_OFFSET },
-            md: { span: Constants.MIDDLE_MD_SPAN, offset: Constants.MIDDLE_MD_OFFSET },
-            lg: { span: Constants.MIDDLE_LG_SPAN, offset: Constants.MIDDLE_LG_OFFSET }
-          })
-          .height(Constants.FULL_HEIGHT)
-          Row()
-            .useSizeType({
-              xs: { span: Constants.RIGHT_XS_SPAN, offset: Constants.RIGHT_XS_OFFSET },
-              sm: { span: Constants.RIGHT_SM_SPAN, offset: Constants.RIGHT_SM_OFFSET },
-              md: { span: Constants.RIGHT_MD_SPAN, offset: Constants.RIGHT_MD_OFFSET },
-              lg: { span: Constants.RIGHT_LG_SPAN, offset: Constants.RIGHT_LG_OFFSET }
-            })
-            .height(Constants.FULL_HEIGHT)
-        }
-        .height(Constants.FULL_HEIGHT)
-        .width(Constants.FULL_WIDTH)
-        .backgroundColor($r("sys.color.ohos_id_color_sub_background"))
-        .opacity(Constants.MANAGEMENT_TRANSPARENCY)
-      }
-    }
-  }
-}
-
-@Component
-struct mediaDocumentItem {
-  @State mediaDocListItem: MeidaDocObj[] = []; // Permission information array
-  @State mediaListItem: MediaListObj = {
-    labelId: '',
-    iconId: '',
-    versionName: '',
-    description: ''
-  }; // application info array
-  @State isCheckList: boolean[] = []; // Permission status array
-
-  authorizeDialogController: CustomDialogController = new CustomDialogController({
-    builder: authorizeDialog({ }),
-    autoCancel: true,
-    alignment: DialogAlignment.Center
-  });
-
-  /**
-   * Grant permissions to the app
-   * @param {Number} accessTokenId
-   * @param {String} permission permission name
-   */
-  grantUserGrantedPermission(accessTokenId, permission) {
-    abilityAccessCtrl.createAtManager().grantUserGrantedPermission(
-      accessTokenId, permission, Constants.PERMISSION_FLAG).then((result) => {
-      nowGrantResult = result;
-    })
-    .catch((error) => {
-      console.error(TAG + 'grantUserGrantedPermission failed. Cause: ' + JSON.stringify(error));
-    })
-  }
-
-  /**
-   * Deauthorize the app
-   * @param {Number} accessTokenId
-   * @param {String} permission permission name
-   */
-  revokeUserGrantedPermission(accessTokenId, permission) {
-    abilityAccessCtrl.createAtManager().revokeUserGrantedPermission(
-      accessTokenId, permission, Constants.PERMISSION_FLAG).then((result) => {
-      nowRevokeResult = result;
-    })
-      .catch((error) => {
-        console.error(TAG + 'revokeUserGrantedPermission failed. Cause: ' + JSON.stringify(error));
-      })
-  }
-
-  /**
-   * Lifecycle function, executed when the page is initialized
-   */
-  aboutToAppear() {
-    let permissionDescription = permissionDescriptions[backTitle];
-    if(showSubpermissionsGrop.indexOf(backTitle) != -1) {
-      reason = []
-      permissions.forEach(permission => {
-        permissionGroups.forEach(permissionGroup => {
-          if(permissionGroup.permissionName == permission) {
-            reason.push(permissionGroup.label)
-          }
-        })
-      })
-      Resmgr.getResourceManager(globalThis.context, Constants.BUNDLE_NAME).then(item => {
-        Promise.all([item.getString($r("app.string.separator").id),
-        item.getString($r("app.string.reason_suffix").id)])
-          .then(values => {
-            reason = reason.join(values[0])
-            reason += values[1]
-          })
-      })
-    }else {
-      reason = ''
-    }
-    let hasReason = false
-    bundle.getBundleInfo(routerData, Constants.PARMETER_BUNDLE_FLAG).then(res => {
-      permissions.forEach(permission => {
-        res.reqPermissionDetails.forEach(reqPermissionDetail => {
-          if(reqPermissionDetail.name == permission) {
-            Resmgr.getResourceManager(globalThis.context, routerData).then(item => {
-              item.getString(reqPermissionDetail.reasonId, (err, value) => {
-                if (value !== undefined && !hasReason) {
-                  reason += value.slice(Constants.START_SUBSCRIPT, Constants.END_SUBSCRIPT)
-                  hasReason = true
-                }
-              })
-            })
-          }
-        })
-      })
-      Promise.all([getAppLabel(res.appInfo.labelId, res.name),
-      getAppIcon(res.appInfo.iconId, res.name)])
-        .then((values) => {
-          this.mediaListItem = new MediaListObj(
-            String(values[0]), String(values[1]), res.versionName, permissionDescription);
-        })
-      this.mediaDocListItem.push(
-        new MeidaDocObj(
-          Constants.RADIO_ALLOW_NAME,
-          Constants.RADIO_ALLOW_INDEX,
-          Constants.RADIO_ALLOW_GROUP_NAME,
-          res.appInfo.accessTokenId,
-          permissions
-        )
-      );
-      this.mediaDocListItem.push(
-        new MeidaDocObj(
-          Constants.RADIO_BAN_NAME,
-          Constants.RADIO_BAN_INDEX,
-          Constants.RADIO_BAN_GROUP_NAME,
-          res.appInfo.accessTokenId,
-          permissions
-        )
-      );
-    }).catch((error) => {
-      console.error(TAG + 'bundle.getBundleInfo failed. Cause: ' + JSON.stringify(error));
-      this.mediaListItem = new MediaListObj('', '', '', permissionDescription);
-      this.mediaDocListItem.push(
-        new MeidaDocObj(Constants.RADIO_ALLOW_NAME, Constants.RADIO_ALLOW_INDEX,
-          Constants.RADIO_ALLOW_GROUP_NAME, '', permissions)
-      );
-      this.mediaDocListItem.push(
-        new MeidaDocObj(Constants.RADIO_BAN_NAME, Constants.RADIO_BAN_INDEX,
-          Constants.RADIO_BAN_GROUP_NAME, '', permissions)
-      );
-    })
-    // Get permission status
-    if (!status) {
-      this.isCheckList = [true, false];
-    } else {
-      this.isCheckList = [false, true];
-    }
-  }
-
-  build(){
-    Column() {
-      Row() {
-        Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
-          Image(this.mediaListItem.iconId)
-            .width(Constants.TERTIARY_IMAGE_WIDTH)
-            .height(Constants.TERTIARY_IMAGE_HEIGHT)
-            .margin({ left: Constants.TERTIARY_IMAGE_MARGIN_LEFT, right: Constants.TERTIARY_IMAGE_MARGIN_RIGHT })
-          Column() {
-            Row() {
-              Text(this.mediaListItem.labelId)
-                .fontSize(Constants.TEXT_MIDDLE_FONT_SIZE)
-                .fontColor($r('app.color.label_color'))
-                .fontWeight(FontWeight.Bold)
-                .textAlign(TextAlign.Start)
-            }
-            .width(Constants.TERTIARY_HALF_WIDTH)
-            .margin({ bottom: Constants.TERTIARY_LABEL_MARGIN_BOTTOM })
-            Row() {
-              Text(this.mediaListItem.versionName)
-                .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
-                .fontColor($r('app.color.label_color_light'))
-                .textAlign(TextAlign.Start)
-            }
-            .width(Constants.TERTIARY_HALF_WIDTH)
-          }
-        }.margin({ left: Constants.TERTIARY_MARGIN_LEFT })
-      }
-      if(reason) {
-        Row() {
-          Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
-            Row() {
-              Text(reason)
-                .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
-                .fontColor($r('app.color.label_color_light'))
-                .textAlign(TextAlign.Start)
-            }.margin({ left: Constants.TERTIARY_IMAGE_MARGIN_LEFT, right: Constants.TERTIARY_IMAGE_MARGIN_RIGHT })
-          }
-        }
-        .margin({ top: Constants.TERTIARY_ROW_MARGIN_TOP, left: Constants.TERTIARY_MARGIN_LEFT })
-      }
-      Row() {
-        Text(backTitle)
-          .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
-          .fontColor($r('app.color.label_color_light'))
-          .fontWeight(FontWeight.Medium)
-          .textAlign(TextAlign.Start)
-          .lineHeight(Constants.SUBTITLE_LINE_HEIGHT)
-        Text($r('app.string.access_permission'))
-          .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
-          .fontColor($r('app.color.label_color_light'))
-          .fontWeight(FontWeight.Medium)
-          .textAlign(TextAlign.Start)
-          .lineHeight(Constants.SUBTITLE_LINE_HEIGHT)
-      }.width(Constants.FULL_WIDTH)
-      .constraintSize({ minHeight: Constants.SUBTITLE_MIN_HEIGHT })
-      .padding({ top: Constants.SUBTITLE_PADDING_TOP, bottom: Constants.SUBTITLE_PADDING_BOTTOM,
-        left: Constants.TERTIARY_TEXT_MARGIN_LEFT, right: Constants.TERTIARY_IMAGE_MARGIN_RIGHT})
-      .margin({ top: Constants.TERTIARY_PERMISSION_ROW_MARGIN_TOP })
-      Column() {
-        List() {
-          ForEach(this.mediaDocListItem, (item) => {
-            ListItem() {
-              Column() {
-                Row() {
-                  Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
-                    Row() {
-                      Text(item.name)
-                        .fontSize(Constants.TEXT_MIDDLE_FONT_SIZE)
-                        .fontColor($r('app.color.label_color'))
-                        .fontWeight(FontWeight.Medium)
-                        .flexGrow(Constants.FLEX_GROW)
-                      if (this.isCheckList[item.index] === true) {
-                        Shape() {
-                          Circle().width(Constants.SHAPE_DIA).height(Constants.SHAPE_DIA)
-                            .fill($r("app.color.shape_allow_color")).offset({ x: 0, y: 0 })
-                          Circle().width(Constants.SHAPE_ALLOW_DIA).height(Constants.SHAPE_ALLOW_DIA)
-                            .fill($r("app.color.default_background_color"))
-                            .offset({ x: Constants.SHAPE_ALLOW_OFFSET, y: Constants.SHAPE_ALLOW_OFFSET })
-                        }
-                      } else if (this.isCheckList[item.index] === false) {
-                        Shape() {
-                          Circle().width(Constants.SHAPE_DIA).height(Constants.SHAPE_DIA)
-                            .fill($r("app.color.shape_ban_color")).offset({ x: 0, y: 0 })
-                          Circle().width(Constants.SHAPE_BAN_DIA).height(Constants.SHAPE_BAN_DIA)
-                            .fill($r("app.color.default_background_color"))
-                            .offset({ x: Constants.SHAPE_BAN_OFFSET, y: Constants.SHAPE_BAN_OFFSET })
-                        }
-                      }
-                    }
-                    .width(Constants.FULL_WIDTH)
-                    .height(Constants.LISTITEM_ROW_HEIGHT)
-                    .onClick(() => {
-                        item.permissions.forEach((permission) => {
-                          if (!item.index) {
-                            this.grantUserGrantedPermission(item.accessTokenId, permission)
-                            if (nowGrantResult != Constants.PERMISSION_INDEX) {
-                              GrantResultFlag.push(-1)
-                            }else{
-                              GrantResultFlag.push(0)
-                            }
-                          } else {
-                            this.revokeUserGrantedPermission(item.accessTokenId, permission)
-                            if (nowRevokeResult != Constants.PERMISSION_INDEX) {
-                              RevokeResultFlag.push(-1)
-                              this.authorizeDialogController.open();
-                              setTimeout(()=> {
-                                this.authorizeDialogController.close();
-                              }, Constants.DELAY_TIME)
-                            }else{
-                              RevokeResultFlag.push(0)
-                            }
-                          }
-                        })
-                        if (!item.index) {
-                          if(GrantResultFlag.indexOf(-1) > -1){
-                            this.authorizeDialogController.open();
-                            setTimeout(()=> {
-                              this.authorizeDialogController.close();
-                            }, Constants.DELAY_TIME)
-                          }else{
-                            this.isCheckList = [true, false];
-                          }
-                        }else{
-                          if (RevokeResultFlag.indexOf(-1) > -1){
-                            this.authorizeDialogController.open();
-                            setTimeout(()=> {
-                              this.authorizeDialogController.close();
-                            }, Constants.DELAY_TIME)
-                          }else{
-                            this.isCheckList = [false, true];
-                          }
-                        }
-                    })
-                  }
-                }
-                if (!item.index) {
-                  Row() {
-                    Column()
-                      .backgroundColor($r('app.color.text_decoration_color'))
-                      .width(Constants.FULL_WIDTH)
-                      .height(Constants.TEXT_DECORATION_HEIGHT)
-                  }
-                }
-              }
-              .onClick(() => {
-              })
-            }
-            .padding({
-              left: Constants.DEFAULT_PADDING_START,
-              right: Constants.DEFAULT_PADDING_END
-            })
-            .margin({ top: Constants.TERTIARY_LISTITEM_MARGIN_TOP })
-          }, item => item.toString())
-        }
-        .borderRadius(Constants.BORDER_RADIUS)
-        .backgroundColor($r('app.color.default_background_color'))
-        .padding({
-          top: Constants.TERTIARY_LIST_PADDING_TOP, bottom: Constants.TERTIARY_LIST_PADDING_BOTTOM
-        })
-      }
-      .padding({
-        left: Constants.LIST_PADDING_LEFT,
-        right: Constants.LIST_PADDING_LEFT
-      })
-      .width(Constants.FULL_WIDTH)
-      .height(Constants.FULL_HEIGHT)
-    }
-    .width(Constants.FULL_WIDTH)
-  }
-}
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+import { backBar } from "../common/components/backBar";
+import router from '@system.router';
+import bundle from "@ohos.bundle";
+import { getAppLabel, getAppIcon, verifyAccessToken } from "../common/utils/utils";
+import abilityAccessCtrl from '@ohos.abilityAccessCtrl';
+import Resmgr from '@ohos.resourceManager'
+import { authorizeDialog } from "../common/components/dialog";
+import { permissionDescriptions, permissionGroups, showSubpermissionsGrop } from "../common/model/permissionGroup";
+import Constants from '../common/utils/constant';
+
+var TAG = 'PermissionManager_MainAbility:'
+
+let routerData = router.getParams().routerData; // Routing jump data
+let backTitle = router.getParams().backTitle; // return title name
+let status = router.getParams().status; // Status: Allowed, Forbidden
+let permissions = router.getParams().permission; // permissions name
+let nowGrantResult = Constants.PERMISSION_NUM; // Authorization results now
+let nowRevokeResult = Constants.PERMISSION_NUM; // Now deauthorize results
+let GrantResultFlag = []; // Authorization result Flag
+let RevokeResultFlag = []; // Cancel authorization result Flag
+let reason = null  // Authorized reason
+class MeidaDocObj {
+  name: string
+  index: number
+  groupName: string
+  accessTokenId: string
+  permissions: []
+  constructor(
+    name: string,
+    index: number,
+    groupName: string,
+    accessTokenId: string,
+    permissions: []
+  ) {
+    this.name = name
+    this.index = index
+    this.groupName = groupName
+    this.accessTokenId = accessTokenId
+    this.permissions = permissions
+  }
+}; // permission information class
+class MediaListObj {
+  labelId: string
+  iconId: string
+  versionName: string
+  description: string
+  constructor(
+    labelId: string,
+    iconId: string,
+    versionName: string,
+    description: string
+  ) {
+    this.labelId = labelId
+    this.iconId = iconId
+    this.versionName = versionName
+    this.description = description
+  }
+}; // Permission application information class
+
+@Entry
+@Component
+struct mediaDocumentPage {
+  build() {
+    Column() {
+      GridContainer({ gutter: Constants.GUTTER, margin: Constants.GRID_MARGIN }) {
+        Row() {
+          Row()
+            .useSizeType({
+              xs: { span: Constants.LEFT_XS_SPAN, offset: Constants.LEFT_XS_OFFSET },
+              sm: { span: Constants.LEFT_SM_SPAN, offset: Constants.LEFT_SM_OFFSET },
+              md: { span: Constants.LEFT_MD_SPAN, offset: Constants.LEFT_MD_OFFSET },
+              lg: { span: Constants.LEFT_LG_SPAN, offset: Constants.LEFT_LG_OFFSET }
+            })
+            .height(Constants.FULL_HEIGHT)
+          Row() {
+            Column() {
+              Row() {
+                backBar({ title: JSON.stringify(backTitle), recordable: false })
+              }
+              Row() {
+                Column() {
+                  mediaDocumentItem()
+                }.width(Constants.FULL_WIDTH)
+              }
+              .margin({ top: Constants.TITLE_MARGIN_BOTTOM })
+              .layoutWeight(Constants.LAYOUT_WEIGHT)
+            }
+          }
+          .useSizeType({
+            xs: { span: Constants.MIDDLE_XS_SPAN, offset: Constants.MIDDLE_XS_OFFSET },
+            sm: { span: Constants.MIDDLE_SM_SPAN, offset: Constants.MIDDLE_SM_OFFSET },
+            md: { span: Constants.MIDDLE_MD_SPAN, offset: Constants.MIDDLE_MD_OFFSET },
+            lg: { span: Constants.MIDDLE_LG_SPAN, offset: Constants.MIDDLE_LG_OFFSET }
+          })
+          .height(Constants.FULL_HEIGHT)
+          Row()
+            .useSizeType({
+              xs: { span: Constants.RIGHT_XS_SPAN, offset: Constants.RIGHT_XS_OFFSET },
+              sm: { span: Constants.RIGHT_SM_SPAN, offset: Constants.RIGHT_SM_OFFSET },
+              md: { span: Constants.RIGHT_MD_SPAN, offset: Constants.RIGHT_MD_OFFSET },
+              lg: { span: Constants.RIGHT_LG_SPAN, offset: Constants.RIGHT_LG_OFFSET }
+            })
+            .height(Constants.FULL_HEIGHT)
+        }
+        .height(Constants.FULL_HEIGHT)
+        .width(Constants.FULL_WIDTH)
+        .backgroundColor($r("sys.color.ohos_id_color_sub_background"))
+        .opacity(Constants.MANAGEMENT_TRANSPARENCY)
+      }
+    }
+  }
+}
+
+@Component
+struct mediaDocumentItem {
+  @State mediaDocListItem: MeidaDocObj[] = []; // Permission information array
+  @State mediaListItem: MediaListObj = {
+    labelId: '',
+    iconId: '',
+    versionName: '',
+    description: ''
+  }; // application info array
+  @State isCheckList: boolean[] = []; // Permission status array
+
+  authorizeDialogController: CustomDialogController = new CustomDialogController({
+    builder: authorizeDialog({ }),
+    autoCancel: true,
+    alignment: DialogAlignment.Center
+  });
+
+  /**
+   * Grant permissions to the app
+   * @param {Number} accessTokenId
+   * @param {String} permission permission name
+   */
+  grantUserGrantedPermission(accessTokenId, permission) {
+    abilityAccessCtrl.createAtManager().grantUserGrantedPermission(
+      accessTokenId, permission, Constants.PERMISSION_FLAG).then((result) => {
+      nowGrantResult = result;
+    })
+    .catch((error) => {
+      console.error(TAG + 'grantUserGrantedPermission failed. Cause: ' + JSON.stringify(error));
+    })
+  }
+
+  /**
+   * Deauthorize the app
+   * @param {Number} accessTokenId
+   * @param {String} permission permission name
+   */
+  revokeUserGrantedPermission(accessTokenId, permission) {
+    abilityAccessCtrl.createAtManager().revokeUserGrantedPermission(
+      accessTokenId, permission, Constants.PERMISSION_FLAG).then((result) => {
+      nowRevokeResult = result;
+    })
+      .catch((error) => {
+        console.error(TAG + 'revokeUserGrantedPermission failed. Cause: ' + JSON.stringify(error));
+      })
+  }
+
+  /**
+   * Lifecycle function, executed when the page is initialized
+   */
+  aboutToAppear() {
+    let permissionDescription = permissionDescriptions[backTitle];
+    if(showSubpermissionsGrop.indexOf(backTitle) != -1) {
+      reason = []
+      permissions.forEach(permission => {
+        permissionGroups.forEach(permissionGroup => {
+          if(permissionGroup.permissionName == permission) {
+            reason.push(permissionGroup.label)
+          }
+        })
+      })
+      Resmgr.getResourceManager(globalThis.context, Constants.BUNDLE_NAME).then(item => {
+        Promise.all([item.getString($r("app.string.separator").id),
+        item.getString($r("app.string.reason_suffix").id)])
+          .then(values => {
+            reason = reason.join(values[0])
+            reason += values[1]
+          })
+      })
+    }else {
+      reason = ''
+    }
+    let hasReason = false
+    bundle.getBundleInfo(routerData, Constants.PARMETER_BUNDLE_FLAG).then(res => {
+      permissions.forEach(permission => {
+        res.reqPermissionDetails.forEach(reqPermissionDetail => {
+          if(reqPermissionDetail.name == permission) {
+            Resmgr.getResourceManager(globalThis.context, routerData).then(item => {
+              item.getString(reqPermissionDetail.reasonId, (err, value) => {
+                if (value !== undefined && !hasReason) {
+                  reason += value.slice(Constants.START_SUBSCRIPT, Constants.END_SUBSCRIPT)
+                  hasReason = true
+                }
+              })
+            })
+          }
+        })
+      })
+      Promise.all([getAppLabel(res.appInfo.labelId, res.name),
+      getAppIcon(res.appInfo.iconId, res.name)])
+        .then((values) => {
+          this.mediaListItem = new MediaListObj(
+            String(values[0]), String(values[1]), res.versionName, permissionDescription);
+        })
+      this.mediaDocListItem.push(
+        new MeidaDocObj(
+          Constants.RADIO_ALLOW_NAME,
+          Constants.RADIO_ALLOW_INDEX,
+          Constants.RADIO_ALLOW_GROUP_NAME,
+          res.appInfo.accessTokenId,
+          permissions
+        )
+      );
+      this.mediaDocListItem.push(
+        new MeidaDocObj(
+          Constants.RADIO_BAN_NAME,
+          Constants.RADIO_BAN_INDEX,
+          Constants.RADIO_BAN_GROUP_NAME,
+          res.appInfo.accessTokenId,
+          permissions
+        )
+      );
+    }).catch((error) => {
+      console.error(TAG + 'bundle.getBundleInfo failed. Cause: ' + JSON.stringify(error));
+      this.mediaListItem = new MediaListObj('', '', '', permissionDescription);
+      this.mediaDocListItem.push(
+        new MeidaDocObj(Constants.RADIO_ALLOW_NAME, Constants.RADIO_ALLOW_INDEX,
+          Constants.RADIO_ALLOW_GROUP_NAME, '', permissions)
+      );
+      this.mediaDocListItem.push(
+        new MeidaDocObj(Constants.RADIO_BAN_NAME, Constants.RADIO_BAN_INDEX,
+          Constants.RADIO_BAN_GROUP_NAME, '', permissions)
+      );
+    })
+    // Get permission status
+    if (!status) {
+      this.isCheckList = [true, false];
+    } else {
+      this.isCheckList = [false, true];
+    }
+  }
+
+  build(){
+    Column() {
+      Row() {
+        Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
+          Image(this.mediaListItem.iconId)
+            .width(Constants.TERTIARY_IMAGE_WIDTH)
+            .height(Constants.TERTIARY_IMAGE_HEIGHT)
+            .margin({ left: Constants.TERTIARY_IMAGE_MARGIN_LEFT, right: Constants.TERTIARY_IMAGE_MARGIN_RIGHT })
+          Column() {
+            Row() {
+              Text(this.mediaListItem.labelId)
+                .fontSize(Constants.TEXT_MIDDLE_FONT_SIZE)
+                .fontColor($r('app.color.label_color'))
+                .fontWeight(FontWeight.Bold)
+                .textAlign(TextAlign.Start)
+            }
+            .width(Constants.TERTIARY_HALF_WIDTH)
+            .margin({ bottom: Constants.TERTIARY_LABEL_MARGIN_BOTTOM })
+            Row() {
+              Text(this.mediaListItem.versionName)
+                .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
+                .fontColor($r('app.color.label_color_light'))
+                .textAlign(TextAlign.Start)
+            }
+            .width(Constants.TERTIARY_HALF_WIDTH)
+          }
+        }.margin({ left: Constants.TERTIARY_MARGIN_LEFT })
+      }
+      if(reason) {
+        Row() {
+          Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
+            Row() {
+              Text(reason)
+                .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
+                .fontColor($r('app.color.label_color_light'))
+                .textAlign(TextAlign.Start)
+            }.margin({ left: Constants.TERTIARY_IMAGE_MARGIN_LEFT, right: Constants.TERTIARY_IMAGE_MARGIN_RIGHT })
+          }
+        }
+        .margin({ top: Constants.TERTIARY_ROW_MARGIN_TOP, left: Constants.TERTIARY_MARGIN_LEFT })
+      }
+      Row() {
+        Text(backTitle)
+          .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
+          .fontColor($r('app.color.label_color_light'))
+          .fontWeight(FontWeight.Medium)
+          .textAlign(TextAlign.Start)
+          .lineHeight(Constants.SUBTITLE_LINE_HEIGHT)
+        Text($r('app.string.access_permission'))
+          .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
+          .fontColor($r('app.color.label_color_light'))
+          .fontWeight(FontWeight.Medium)
+          .textAlign(TextAlign.Start)
+          .lineHeight(Constants.SUBTITLE_LINE_HEIGHT)
+      }.width(Constants.FULL_WIDTH)
+      .constraintSize({ minHeight: Constants.SUBTITLE_MIN_HEIGHT })
+      .padding({ top: Constants.SUBTITLE_PADDING_TOP, bottom: Constants.SUBTITLE_PADDING_BOTTOM,
+        left: Constants.TERTIARY_TEXT_MARGIN_LEFT, right: Constants.TERTIARY_IMAGE_MARGIN_RIGHT})
+      .margin({ top: Constants.TERTIARY_PERMISSION_ROW_MARGIN_TOP })
+      Column() {
+        List() {
+          ForEach(this.mediaDocListItem, (item) => {
+            ListItem() {
+              Column() {
+                Row() {
+                  Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
+                    Row() {
+                      Text(item.name)
+                        .fontSize(Constants.TEXT_MIDDLE_FONT_SIZE)
+                        .fontColor($r('app.color.label_color'))
+                        .fontWeight(FontWeight.Medium)
+                        .flexGrow(Constants.FLEX_GROW)
+                      if (this.isCheckList[item.index] === true) {
+                        Shape() {
+                          Circle().width(Constants.SHAPE_DIA).height(Constants.SHAPE_DIA)
+                            .fill($r("app.color.shape_allow_color")).offset({ x: 0, y: 0 })
+                          Circle().width(Constants.SHAPE_ALLOW_DIA).height(Constants.SHAPE_ALLOW_DIA)
+                            .fill($r("app.color.default_background_color"))
+                            .offset({ x: Constants.SHAPE_ALLOW_OFFSET, y: Constants.SHAPE_ALLOW_OFFSET })
+                        }
+                      } else if (this.isCheckList[item.index] === false) {
+                        Shape() {
+                          Circle().width(Constants.SHAPE_DIA).height(Constants.SHAPE_DIA)
+                            .fill($r("app.color.shape_ban_color")).offset({ x: 0, y: 0 })
+                          Circle().width(Constants.SHAPE_BAN_DIA).height(Constants.SHAPE_BAN_DIA)
+                            .fill($r("app.color.default_background_color"))
+                            .offset({ x: Constants.SHAPE_BAN_OFFSET, y: Constants.SHAPE_BAN_OFFSET })
+                        }
+                      }
+                    }
+                    .width(Constants.FULL_WIDTH)
+                    .height(Constants.LISTITEM_ROW_HEIGHT)
+                    .onClick(() => {
+                        item.permissions.forEach((permission) => {
+                          if (!item.index) {
+                            this.grantUserGrantedPermission(item.accessTokenId, permission)
+                            if (nowGrantResult != Constants.PERMISSION_INDEX) {
+                              GrantResultFlag.push(-1)
+                            }else{
+                              GrantResultFlag.push(0)
+                            }
+                          } else {
+                            this.revokeUserGrantedPermission(item.accessTokenId, permission)
+                            if (nowRevokeResult != Constants.PERMISSION_INDEX) {
+                              RevokeResultFlag.push(-1)
+                              this.authorizeDialogController.open();
+                              setTimeout(()=> {
+                                this.authorizeDialogController.close();
+                              }, Constants.DELAY_TIME)
+                            }else{
+                              RevokeResultFlag.push(0)
+                            }
+                          }
+                        })
+                        if (!item.index) {
+                          if(GrantResultFlag.indexOf(-1) > -1){
+                            this.authorizeDialogController.open();
+                            setTimeout(()=> {
+                              this.authorizeDialogController.close();
+                            }, Constants.DELAY_TIME)
+                          }else{
+                            this.isCheckList = [true, false];
+                          }
+                        }else{
+                          if (RevokeResultFlag.indexOf(-1) > -1){
+                            this.authorizeDialogController.open();
+                            setTimeout(()=> {
+                              this.authorizeDialogController.close();
+                            }, Constants.DELAY_TIME)
+                          }else{
+                            this.isCheckList = [false, true];
+                          }
+                        }
+                    })
+                  }
+                }
+                if (!item.index) {
+                  Row() {
+                    Column()
+                      .backgroundColor($r('app.color.text_decoration_color'))
+                      .width(Constants.FULL_WIDTH)
+                      .height(Constants.TEXT_DECORATION_HEIGHT)
+                  }
+                }
+              }
+              .onClick(() => {
+              })
+            }
+            .padding({
+              left: Constants.DEFAULT_PADDING_START,
+              right: Constants.DEFAULT_PADDING_END
+            })
+            .margin({ top: Constants.TERTIARY_LISTITEM_MARGIN_TOP })
+          }, item => item.toString())
+        }
+        .borderRadius(Constants.BORDER_RADIUS)
+        .backgroundColor($r('app.color.default_background_color'))
+        .padding({
+          top: Constants.TERTIARY_LIST_PADDING_TOP, bottom: Constants.TERTIARY_LIST_PADDING_BOTTOM
+        })
+      }
+      .padding({
+        left: Constants.LIST_PADDING_LEFT,
+        right: Constants.LIST_PADDING_LEFT
+      })
+      .width(Constants.FULL_WIDTH)
+      .height(Constants.FULL_HEIGHT)
+    }
+    .width(Constants.FULL_WIDTH)
+  }
+}
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/authority-management.ets b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/authority-management.ets
index a1e25356287db91257a9e2a493dfc2e9a0c673fa..10c7318b21dc4209197451a9f755bb235fee6b08 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/authority-management.ets
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/authority-management.ets
@@ -1,715 +1,715 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-import { backBar } from "../common/components/backBar";
-import { alphabetIndexerComponent } from "../common/components/alphabeticalIndex";
-import { textInput } from "../common/components/search";
-import router from '@system.router';
-import bundle from "@ohos.bundle";
-import Resmgr from '@ohos.resourceManager';
-import abilityAccessCtrl from '@ohos.abilityAccessCtrl';
-import { groups, userGrantPermissions, permissionGroupPermissions, noNeedDisplayApp } from "../common/model/permissionGroup";
-import { permissionGroups, permissionPermissionGroup, permissionGroupIds } from "../common/model/permissionGroup";
-import { makePy } from "../common/utils/utils";
-import Constants from '../common/utils/constant';
-
-var TAG = 'PermissionManager_MainAbility:'
-
-@Extend(Image) function customizeImage(width: number, height: number) {
-  .objectFit(ImageFit.Contain)
-  .width(width)
-  .height(height)
-};
-
-interface applicationPermissions {
-  'bundleName': string,
-  'iconId': string,
-  'permissions': string[],
-  'labelId': string,
-  'tokenId': number,
-  'groupId': number[]
-};
-
-interface permissionApplications {
-  'permission': string,
-  'groupName': string,
-  'bundleNames': string[],
-  'icon': string
-};
-
-interface groupPermission {
-  'group': string,
-  'permissions': string[],
-  'groupName': string,
-  'icon': string,
-  'isShow':boolean
-};
-
-let bundleInfosList: any[] = []; // Permission information array
-let textInput_placeholder: any = ''
-
-@Entry
-@Component
-struct authorityManagementPage {
-  @Builder ListItemLayout(item, index) {
-    ListItem() {
-      Row() {
-        Column() {
-          Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
-            Row() {
-              Image(item.icon)
-                .customizeImage(Constants.MANAGEMENT_IMAGE_WIDTH, Constants.MANAGEMENT_IMAGE_HEIGHT)
-                .margin({ right: Constants.MANAGEMENT_IMAGE_MARGIN_RIGHT })
-              Text(item.groupName)
-                .fontSize(Constants.TEXT_MIDDLE_FONT_SIZE)
-                .fontWeight(FontWeight.Medium)
-                .fontColor($r('app.color.label_color'))
-                .flexGrow(Constants.FLEX_GROW)
-              Image($r('app.media.rightarrow'))
-                .customizeImage(Constants.IMAGE_WIDTH, Constants.IMAGE_HEIGHT)
-            }
-            .width(Constants.FULL_WIDTH)
-            .height(Constants.MANAGEMENT_ROW_HEIGHT)
-          }
-          if (!index) {
-            Row() {
-              Flex() {
-                Column().width(Constants.MANAGEMENT_TEXT_DECORATION_MARGIN_LEFT)
-                Column()
-                  .backgroundColor($r('app.color.text_decoration_color'))
-                  .height(Constants.TEXT_DECORATION_HEIGHT)
-                  .flexGrow(Constants.FLEX_GROW)
-              }
-            }
-          }
-        }.onClick(() => {
-          if (item.groupName === '其他权限' || item.groupName === '电话' || item.groupName === '通讯录' || item.groupName === '信息'
-          || item.groupName === '通话记录' || item.groupName === '日历') {
-            router.push({
-              uri: 'pages/authority-secondary',
-              params: { routerData: this.allPermissionApplications, backTitle: item.groupName }
-            })
-          } else {
-            var dataList = this.allPermissionApplications.filter((ele) => {
-              return ele.groupName === item.group
-            })
-
-            router.push({
-              uri: 'pages/authority-tertiary-groups',
-              params: { routerData: dataList, backTitle: item.groupName  }
-            })
-          }
-        })
-      }
-    }.padding({ left: Constants.DEFAULT_PADDING_START, right: Constants.DEFAULT_PADDING_END })
-  }
-
-  @State allApplicationPermissions: applicationPermissions[] = []; // All permissions apply
-  @State allPermissions: string[] = []; // All permissions
-  @State allSystemPermissions: string[] = []; // All system permissions
-  @State allUserPermissions: string[] = []; // All user rights
-  @State allPermissionApplications: permissionApplications [] = [] // All app permissions
-  @State allGroups: string[] = [] // All groups
-  @State allGroupPermission: groupPermission[] = [] // All group permissions
-  @State currentIndex: number = 0
-  @Builder TabBuilder(index: number) {
-    Flex({ alignItems: ItemAlign.Center, justifyContent: FlexAlign.Center }) {
-      Text(index ? $r('app.string.application') : $r('app.string.authority'))
-        .fontColor(this.currentIndex == index ? $r('app.color.button_color') : $r('app.color.label_color'))
-        .fontWeight(this.currentIndex == index ? FontWeight.Bold : FontWeight.Regular)
-        .lineHeight(Constants.TEXT_LINE_HEIGHT)
-      if(this.currentIndex == index) {
-        Row().width(Constants.FULL_WIDTH).height(Constants.TAB_DECORATION_HEIGHT)
-          .backgroundColor($r('app.color.button_color'))
-          .position({ y: Constants.TAB_DECORATION_POSITION_Y })
-      }
-    }.height(Constants.TAB_HEIGHT)
-  }
-
-  /**
-   * Convert the permission array into key, value key-value objects for easy sorting
-   * @param {Array} order User rights
-   * @return {Object} return the processed object
-   */
-  orderDict(order) {
-    let result = {};
-    for (let i = 0; i < order.length; i++) {
-      let key = order[i];
-      result[key] = i;
-    }
-    return result;
-  }
-
-  /**
-   * Compare and sort the permission array according to the permission key value
-   * @param {String} prop Sort by permission
-   * @param {Object} orderSort objects to be sorted
-   * @return {Array} Returns a sorted array of permissions
-   */
-  compare(prop, orderSort) {
-    return function(a, b) {
-      let aSortValue = orderSort[a[prop]];
-      let bSortValue = orderSort[b[prop]];
-      if (aSortValue == undefined) {
-        throw new Error('当前的字段不在排序列表里：' + a[prop]);
-      }
-      if (bSortValue == undefined) {
-        throw new Error('当前的字段不在排序列表里：' + b[prop]);
-      }
-      return aSortValue - bSortValue;
-    }
-  }
-
-  /**
-   * Get all app permission information
-   * @param {Array} allPermissions All permissions
-   * @param {Object} allApplicationPermissions All app permissions
-   */
-  getAllBundlePermissions(allPermissions: string[], allApplicationPermissions: applicationPermissions[]) {
-    bundle.getAllBundleInfo(Constants.PARMETER_BUNDLE_FLAG).then(async(res) => {
-      const bundleInfos = res;
-      var count = bundleInfos.length;
-      if (count <= 0) {
-        console.info(TAG + 'bundle.getAllBundleInfo result.length less than or equal to zero');
-        return;
-      }
-      var infoIndex = 0;
-      for (let i = 0; i < count; i++) {
-        var info = bundleInfos[i];
-        // Filter blank icon icon and text label resources
-        try {
-          const ret = await bundle.queryAbilityByWant({
-            bundleName: info.name,
-            action: "action.system.home",
-            entities: ["entity.system.home"]
-          }, bundle.BundleFlag.GET_ABILITY_INFO_WITH_APPLICATION, Constants.USERID);
-        } catch(e) {
-          console.log(TAG + 'queryAbilityByWant catch error: ' + JSON.stringify(e))
-          continue;
-        }
-
-        if (noNeedDisplayApp.indexOf(info.name) != -1) {
-          continue;
-        }
-        await this.deduplicationPermissions(info, allPermissions, allApplicationPermissions);
-        this.updateAppLabel(infoIndex, info.name, info.appInfo.label);
-        this.updateAppIcon(infoIndex, info.name);
-        infoIndex = infoIndex + 1;
-      }
-      this.getAllPermissionApplications();
-      let orderSort = this.orderDict(userGrantPermissions);
-      this.allPermissionApplications.sort(this.compare('permission', orderSort));
-      this.getAllGroupPermission();
-      bundleInfosList = this.allApplicationPermissions;
-      bundleInfosList.forEach((item) => {
-        if (!isNaN(item.labelId)) {
-          item.alphabeticalIndex = '';
-        } else {
-          item.alphabeticalIndex = makePy(item.labelId)[0].slice(0, 1); // Get the first letter in the returned initials array
-        }
-      })
-    })
-      .catch((error) => {
-        console.error(TAG + 'bundle.getAllBundleInfo failed. Cause: ' + JSON.stringify(error));
-      })
-  }
-
-  /**
-   * Get the corresponding permission group id according to the permission
-   * @param {String} permission app name id
-   * @return {Number} groupId
-   */
-  getPermissionGroupByPermission(permission: string) {
-    for (let i = 0; i < permissionGroups.length; i++) {
-      if (permissionGroups[i].permissionName == permission) {
-        return groups[permissionGroups[i].groupId];
-      }
-    }
-  }
-
-  /**
-   * Get all app permission information
-   */
-  getAllPermissionApplications() {
-    const this_ = this;
-    var leng = this_.allPermissions.length;
-    if (leng > 0) {
-      for (let i = 0; i < leng; i++) {
-        if (userGrantPermissions.indexOf(this_.allPermissions[i]) == -1) {
-          this_.allSystemPermissions.push(this_.allPermissions[i]);
-        } else {
-          this_.allUserPermissions.push(this_.allPermissions[i]);
-        }
-      }
-    }
-    for (let i = 0; i < this_.allUserPermissions.length; i++) {
-      var permissionGroup = this_.getPermissionGroupByPermission(this_.allUserPermissions[i]);
-      var icon: string = permissionGroup.icon;
-      var bundleNames: string[] = [];
-      for (let j = 0; j < this_.allApplicationPermissions.length; j++) {
-        if (this_.allApplicationPermissions[j].permissions.indexOf(this_.allUserPermissions[i]) != -1) {
-          bundleNames.push(this_.allApplicationPermissions[j].bundleName);
-        }
-      }
-      var pa: permissionApplications = {
-        'permission': this_.allUserPermissions[i],
-        'groupName': permissionGroup.name,
-        'bundleNames': bundleNames,
-        'icon': icon
-      };
-      this_.allPermissionApplications.push(pa);
-    }
-  }
-
-  /**
-   * Get permission group information
-   */
-  getAllGroupPermission() {
-    const this_ = this;
-    var temp1 = [];
-    temp1 = ["LOCATION","CAMERA","MICROPHONE","MEDIA","CALENDAR","SPORT","HEALTH"];
-    groups.forEach((item) => {
-      if (temp1.indexOf(item.name) > -1) {
-        var gp: groupPermission = {
-          "group": item.name,
-          "permissions": item.permissions,
-          'groupName': item.groupName,
-          'icon': item.icon,
-          'isShow': item.isShow
-        };
-        this_.allGroupPermission.push(gp);
-      }
-    })
-    let temp2 = [];
-    groups.forEach((item) => {
-      if (item.isShow && temp1.indexOf(item.name) === -1) {
-        var gp: groupPermission = {
-          "group": item.name,
-          "permissions": item.permissions,
-          'groupName': item.groupName,
-          'icon': item.icon,
-          'isShow': item.isShow
-        };
-        temp2.push(item.name);
-        this_.allGroupPermission.push(gp);
-      }
-    })
-    for (let i = 0; i < this_.allPermissionApplications.length; i++) {
-        if (this_.allGroups.indexOf(this_.allPermissionApplications[i].groupName) == -1
-        && temp1.indexOf(this_.allPermissionApplications[i].groupName) == -1) {
-          this_.allGroups.push(this_.allPermissionApplications[i].groupName);
-        }
-    }
-    // Permission layout
-    var temp = this_.allGroups;
-    temp = temp.filter(function(item) {
-      return temp1.indexOf(item) == -1 && temp2.indexOf(item) == -1;
-    });
-    if (temp.indexOf("OTHER") > -1) {
-      temp.splice(temp.indexOf("OTHER"),1);
-      temp.push("OTHER");
-    }else {
-      temp.push("OTHER");
-    }
-    this_.allGroups = temp;
-    for (let i = 0; i < this_.allGroups.length; i++) {
-      var permissions: string[] = permissionGroupPermissions[this_.allGroups[i]];
-      var gp: groupPermission = {
-        "group": this_.allGroups[i],
-        "permissions": permissions,
-        'groupName': '',
-        'icon': '',
-        'isShow': false
-      };
-      this_.allGroupPermission.push(gp);
-    }
-    this.allGroupPermission.forEach((ele) => {
-      groups.forEach((item) => {
-        if (ele.group === item.name) {
-          ele.groupName = item.groupName;
-          ele.icon = item.icon;
-          ele.isShow = item.isShow;
-        }
-      });
-    })
-  }
-
-  /**
-   * Deduplicate permission information and permission group information
-   * @param {Object} info bundleInfos Application Information
-   * @param {Array} allPermissions All permissions
-   * @param {Array} allApplicationPermissions All permissions apply
-   */
-  async deduplicationPermissions(info, allPermissions, allApplicationPermissions) {
-    var reqPermissionsLen = info.reqPermissions.length;
-    var reqUserPermissions: string[] = [];
-    var acManager = abilityAccessCtrl.createAtManager()
-    if (reqPermissionsLen > 0) {
-      for (let j = 0; j < info.reqPermissions.length; j++) {
-        var permission = info.reqPermissions[j];
-        var flag = await acManager.getPermissionFlags(info.appInfo.accessTokenId, permission)
-        if(flag == Constants.PRE_AUTHORIZATION_NOT_MODIFIED) {
-          continue
-        }
-        if (allPermissions.indexOf(permission) == -1) {
-          allPermissions.push(permission);
-        }
-        if (userGrantPermissions.indexOf(permission) != -1) {
-          reqUserPermissions.push(permission);
-        }
-      }
-    }
-    let dePermissions = [];
-    let groupIds = [];
-    for (let i = 0; i < reqUserPermissions.length; i++) {
-      if(dePermissions.indexOf(permissionPermissionGroup[reqUserPermissions[i]]) == -1){
-        dePermissions.push(permissionPermissionGroup[reqUserPermissions[i]]);
-      }
-      if(groupIds.indexOf(permissionGroupIds[reqUserPermissions[i]]) == -1){
-        groupIds.push(permissionGroupIds[reqUserPermissions[i]]);
-      }
-    }
-
-    // adapt different api
-    if (info.compatibleVersion >= Constants.API_VERSION_SUPPORT_STAGE) {
-      info.appInfo.iconId = info.hapModuleInfos[0].abilityInfo[0].iconId;
-    }
-
-    var ap: applicationPermissions = {
-      'bundleName': info.name,
-      'tokenId': info.appInfo.accessTokenId,
-      'iconId': info.appInfo.iconId,
-      'labelId': info.appInfo.labelId,
-      'permissions': reqUserPermissions,
-      'groupId': groupIds
-    };
-    allApplicationPermissions.push(ap);
-  }
-
-  /**
-   * Get app name resource
-   * @param {Number} index index of all app permissions array
-   * @param {String} bundleName Package names
-   * @param {String} labelName Application Name
-   */
-  updateAppLabel(index, bundleName, labelName) {
-    Resmgr.getResourceManager(globalThis.context, bundleName).then(item => {
-      if (index >= this.allApplicationPermissions.length) {
-        return;
-      }
-      var info = this.allApplicationPermissions[index];
-      item.getString(info['labelId'], (error, value) => {
-        if (value == undefined) {
-          info['labelId'] = labelName;
-        } else {
-          info['labelId'] = value;
-        }
-      })
-    }).catch(error => {
-      console.error(TAG + 'Resmgr.getResourceManager failed. Cause: ' + JSON.stringify(error));
-    })
-  }
-
-  /**
-   * Get app icon resources
-   * @param {Number} index index of all app permissions array
-   * @param {String} bundleName Package names
-   */
-  updateAppIcon(index, bundleName) {
-    Resmgr.getResourceManager(globalThis.context, bundleName).then(item => {
-      if (index >= this.allApplicationPermissions.length) {
-        return;
-      }
-      var info = this.allApplicationPermissions[index];
-      item.getMediaBase64(info['iconId'], (error, value) => {
-        info['iconId'] = value;
-      })
-    }).catch(error => {
-      console.error(TAG + 'Resmgr.getResourceManager failed. Cause: ' + JSON.stringify(error));
-    })
-  }
-
-  /**
-   * Lifecycle function, executed when the page is initialized
-   */
-  aboutToAppear() {
-    console.log(TAG + 'on aboutToAppear, version 1.01');
-    this.getAllBundlePermissions(this.allPermissions, this.allApplicationPermissions);
-    Resmgr.getResourceManager(globalThis.context, Constants.BUNDLE_NAME).then(item => {
-      item.getString($r("app.string.textInput_placeholder").id, (err, val) => {
-        textInput_placeholder = val
-      })
-    })
-  }
-
-  getPermissionGroup(allGroup, order) {
-    var fixedName: string[] = ['LOCATION', 'CAMERA', 'MICROPHONE']
-    var fixedGroup: any[] = []
-    var changeGroup: any[] = []
-    var otherGroup: any[] = []
-
-    allGroup.forEach(group => {
-      if(fixedName.indexOf(group.group) !== -1) {
-        fixedGroup.push(group)
-      }else if(group.group == 'OTHER') {
-        otherGroup.push(group)
-      }else {
-        changeGroup.push(group)
-      }
-    })
-
-    if(order == Constants.FIXED_GROUP){
-      return fixedGroup
-    }else if(order == Constants.CHANGE_GROUP) {
-      return changeGroup
-    }else if(order == Constants.OTHER_GROUP) {
-      return otherGroup
-    }
-  }
-
-  build() {
-    GridContainer({ gutter: Constants.GUTTER, margin: Constants.GRID_MARGIN }) {
-      Row() {
-        Row()
-          .useSizeType({
-            xs: { span: Constants.LEFT_XS_SPAN, offset: Constants.LEFT_XS_OFFSET },
-            sm: { span: Constants.LEFT_SM_SPAN, offset: Constants.LEFT_SM_OFFSET },
-            md: { span: Constants.LEFT_MD_SPAN, offset: Constants.LEFT_MD_OFFSET },
-            lg: { span: Constants.LEFT_LG_SPAN, offset: Constants.LEFT_LG_OFFSET }
-          })
-          .height(Constants.FULL_HEIGHT)
-        Row() {
-          Column() {
-            Row() {
-              backBar( { title: JSON.stringify($r('app.string.authority_management')), recordable: true })
-            }
-            Row() {
-              Column() {
-                Column() {
-                  Stack() {
-                    if(this.allGroupPermission.length) {
-                      Tabs() {
-                        TabContent() {
-                          Row() {
-                            Column() {
-                              Scroll() {
-                                Column() {
-                                  List() {
-                                    ListItem() {
-                                      List() {
-                                        ForEach(this.getPermissionGroup(this.allGroupPermission, Constants.FIXED_GROUP).slice(Constants.SLICE_START,
-                                          this.getPermissionGroup(this.allGroupPermission, Constants.FIXED_GROUP).length - 1), (item) => {
-                                          this.ListItemLayout(item, Constants.SLICE_START_INDEX)
-                                        }, item => item.toString())
-                                        ForEach(this.getPermissionGroup(this.allGroupPermission, Constants.FIXED_GROUP).slice(Constants.SLICE_END), (item, index) => {
-                                          this.ListItemLayout(item, Constants.SLICE_END_INDEX)
-                                        }, item => item.toString())
-                                      }.backgroundColor($r('app.color.default_background_color'))
-                                      .borderRadius(Constants.BORDER_RADIUS)
-                                      .padding({ top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
-                                      .margin({ bottom: Constants.LIST_MARGIN_BOTTOM })
-                                    }
-
-                                    ListItem() {
-                                      List() {
-                                        ForEach(this.getPermissionGroup(this.allGroupPermission, Constants.CHANGE_GROUP).slice(Constants.SLICE_START,
-                                          this.getPermissionGroup(this.allGroupPermission, Constants.CHANGE_GROUP).length - 1), (item) => {
-                                          this.ListItemLayout(item, Constants.SLICE_START_INDEX)
-                                        }, item => item.toString())
-                                        ForEach(this.getPermissionGroup(this.allGroupPermission, Constants.CHANGE_GROUP).slice(Constants.SLICE_END), (item, index) => {
-                                          this.ListItemLayout(item, Constants.SLICE_END_INDEX)
-                                        }, item => item.toString())
-                                      }.backgroundColor($r('app.color.default_background_color'))
-                                      .borderRadius(Constants.BORDER_RADIUS)
-                                      .padding({ top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
-                                      .margin({ bottom: Constants.LIST_MARGIN_BOTTOM })
-                                    }
-
-                                    ListItem() {
-                                      List() {
-                                        ForEach(this.getPermissionGroup(this.allGroupPermission, Constants.OTHER_GROUP), (item) => {
-                                          this.ListItemLayout(item, Constants.SLICE_END_INDEX)
-                                        }, item => item.toString())
-                                      }.backgroundColor($r('app.color.default_background_color'))
-                                      .borderRadius(Constants.BORDER_RADIUS)
-                                      .padding({ top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
-                                    }
-                                  }.height(Constants.FULL_HEIGHT)
-                                  .borderRadius(Constants.BORDER_RADIUS)
-                                  .clip(true)
-                                }.padding({
-                                  left: Constants.MANAGEMENT_ROW_PADDING_LEFT,
-                                  right: Constants.MANAGEMENT_ROW_PADDING_RIGHT,
-                                })
-                              }.scrollBar(BarState.Off)
-                              .margin({ top: Constants.MANAGEMENT_ROW_PADDING_TOP })
-                            }.width(Constants.FULL_WIDTH)
-                          }
-                        }.tabBar(this.TabBuilder(0))
-                        TabContent() {
-                          applicationItem()
-                        }.tabBar(this.TabBuilder(1))
-                      }
-                      .barWidth(Constants.BAR_WIDTH)
-                      .barMode(BarMode.Fixed)
-                      .onChange((index) => {
-                        this.currentIndex = index
-                      })
-                    }else {
-                      LoadingProgress().width(Constants.LOADING_WIDTH)
-                    }
-                  }.height(Constants.FULL_HEIGHT)
-                }
-              }
-            }
-            .layoutWeight(Constants.LAYOUT_WEIGHT)
-          }
-        }
-        .useSizeType({
-          xs: { span: Constants.MIDDLE_XS_SPAN, offset: Constants.MIDDLE_XS_OFFSET },
-          sm: { span: Constants.MIDDLE_SM_SPAN, offset: Constants.MIDDLE_SM_OFFSET },
-          md: { span: Constants.MIDDLE_MD_SPAN, offset: Constants.MIDDLE_MD_OFFSET },
-          lg: { span: Constants.MIDDLE_LG_SPAN, offset: Constants.MIDDLE_LG_OFFSET }
-        })
-        .height(Constants.FULL_HEIGHT)
-        Row()
-          .useSizeType({
-            xs: { span: Constants.RIGHT_XS_SPAN, offset: Constants.RIGHT_XS_OFFSET },
-            sm: { span: Constants.RIGHT_SM_SPAN, offset: Constants.RIGHT_SM_OFFSET },
-            md: { span: Constants.RIGHT_MD_SPAN, offset: Constants.RIGHT_MD_OFFSET },
-            lg: { span: Constants.RIGHT_LG_SPAN, offset: Constants.RIGHT_LG_OFFSET }
-          })
-          .height(Constants.FULL_HEIGHT)
-      }
-      .height(Constants.FULL_HEIGHT)
-      .width(Constants.FULL_WIDTH)
-      .backgroundColor($r("sys.color.ohos_id_color_sub_background"))
-      .opacity(Constants.MANAGEMENT_TRANSPARENCY)
-    }
-  }
-}
-
-@Component
-struct applicationItem {
-  @State applicationItem: any[] = bundleInfosList // application info array
-  @State oldApplicationItem: any[] = bundleInfosList // Original application information array
-  @State searchResult: boolean = true // search results
-
-  @Builder ListItemLayout(item, index) {
-    ListItem() {
-      Row() {
-        Column() {
-          Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
-            Row() {
-              Image(item.iconId)
-                .customizeImage(Constants.APPLICATION_IMAGE_WIDTH, Constants.APPLICATION_IMAGE_HEIGHT)
-                .margin({ right: Constants.APPLICATION_IMAGE_MARGIN_RIGHT })
-              Text(item.labelId)
-                .fontSize(Constants.TEXT_MIDDLE_FONT_SIZE)
-                .fontWeight(FontWeight.Medium)
-                .fontColor($r('app.color.label_color'))
-                .flexGrow(Constants.FLEX_GROW)
-              Text(item.groupId.length + '项权限')
-                .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
-                .fontColor($r('app.color.label_color_lighter'))
-                .margin({ right: Constants.APPLICATION_TEXT_MARGIN_RIGHT })
-              Image($r('app.media.rightarrow'))
-                .customizeImage(Constants.IMAGE_WIDTH, Constants.IMAGE_HEIGHT)
-            }
-            .width(Constants.FULL_WIDTH)
-            .height(Constants.AUTHORITY_ROW_HEIGHT)
-            .constraintSize({ minHeight: Constants.AUTHORITY_CONSTRAINTSIZE_MINHEIGHT })
-          }
-          if (!index) {
-            Row() {
-              Flex() {
-                Column().width(Constants.APPLICATION_TEXT_DECORATION_MARGIN_LEFT)
-                Column()
-                  .backgroundColor($r('app.color.text_decoration_color'))
-                  .height(Constants.TEXT_DECORATION_HEIGHT)
-                  .flexGrow(Constants.FLEX_GROW)
-              }
-            }
-          }
-        }.onClick(() => {
-          router.push({
-            uri: 'pages/application-secondary',
-            params: { routerData: item }
-          });
-        })
-      }
-    }.padding({
-      left: Constants.DEFAULT_PADDING_START,
-      right: Constants.DEFAULT_PADDING_END
-    })
-  }
-
-  build() {
-    Column() {
-      Row() {
-        textInput({
-          placeholder: textInput_placeholder,
-          applicationItem: $applicationItem,
-          oldApplicationItem: $oldApplicationItem,
-          searchResult: $searchResult
-        })
-      }.padding({
-        left: Constants.APPLICATION_TEXTINPUT_PADDING_LEFT,
-        top: Constants.APPLICATION_TEXTINPUT_PADDING_TOP,
-        right: Constants.APPLICATION_TEXTINPUT_PADDING_RIGHT
-      })
-      Row() {
-        Flex({ alignItems: ItemAlign.Start }) {
-          Column() {
-            Column() {
-              if (!this.applicationItem.length) {
-                Row() {
-                  Flex({ justifyContent: FlexAlign.Center, alignItems: ItemAlign.Center }) {
-                    Image($r('app.media.searchnoresult'))
-                      .customizeImage(Constants.SEARCHNORESULT_IMAGE_WIDTH, Constants.SEARCHNORESULT_IMAGE_HEIGHT)
-                  }
-                }.margin({ top: Constants.MANAGEMENT_ROW_MARGIN_TOP })
-                .padding({ left: Constants.MANAGEMENT_ROW_PADDING_LEFT })
-              } else {
-                Row() {
-                  Scroll() {
-                    List() {
-                      ForEach(this.applicationItem.slice(Constants.SLICE_START, this.applicationItem.length - 1),
-                        (item) => {
-                          this.ListItemLayout(item, Constants.SLICE_START_INDEX)
-                        }, item => item.toString())
-                      ForEach(this.applicationItem.slice(Constants.SLICE_END), (item, index) => {
-                        this.ListItemLayout(item, Constants.SLICE_END_INDEX)
-                      }, item => item.toString())
-                    }.backgroundColor($r('app.color.default_background_color'))
-                    .borderRadius(Constants.BORDER_RADIUS)
-                    .padding({ top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
-                  }.scrollBar(BarState.Off)
-                }.margin({ left: Constants.MANAGEMENT_ROW_PADDING_LEFT })
-                .borderRadius(Constants.BORDER_RADIUS)
-                .clip(true)
-              }
-            }.backgroundColor($r('app.color.background_color'))
-            .height(Constants.FULL_HEIGHT)
-          }.margin({ top: Constants.MANAGEMENT_ROW_MARGIN_TOP, bottom: Constants.APPLICATION_LIST_MARGIN_BOTTOM })
-          Column() {
-            alphabetIndexerComponent({ applicationItem: $applicationItem, oldApplicationItem: $oldApplicationItem })
-          }.margin({ top: Constants.APPLICATION_ALPHABETINDEX_MARGIN_TOP })
-          .width(Constants.APPLICATION_ALPHABETINDEX_WIDTH)
-        }
-      }
-    }
-  }
-}
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+import { backBar } from "../common/components/backBar";
+import { alphabetIndexerComponent } from "../common/components/alphabeticalIndex";
+import { textInput } from "../common/components/search";
+import router from '@system.router';
+import bundle from "@ohos.bundle";
+import Resmgr from '@ohos.resourceManager';
+import abilityAccessCtrl from '@ohos.abilityAccessCtrl';
+import { groups, userGrantPermissions, permissionGroupPermissions, noNeedDisplayApp } from "../common/model/permissionGroup";
+import { permissionGroups, permissionPermissionGroup, permissionGroupIds } from "../common/model/permissionGroup";
+import { makePy } from "../common/utils/utils";
+import Constants from '../common/utils/constant';
+
+var TAG = 'PermissionManager_MainAbility:'
+
+@Extend(Image) function customizeImage(width: number, height: number) {
+  .objectFit(ImageFit.Contain)
+  .width(width)
+  .height(height)
+};
+
+interface applicationPermissions {
+  'bundleName': string,
+  'iconId': string,
+  'permissions': string[],
+  'labelId': string,
+  'tokenId': number,
+  'groupId': number[]
+};
+
+interface permissionApplications {
+  'permission': string,
+  'groupName': string,
+  'bundleNames': string[],
+  'icon': string
+};
+
+interface groupPermission {
+  'group': string,
+  'permissions': string[],
+  'groupName': string,
+  'icon': string,
+  'isShow':boolean
+};
+
+let bundleInfosList: any[] = []; // Permission information array
+let textInput_placeholder: any = ''
+
+@Entry
+@Component
+struct authorityManagementPage {
+  @Builder ListItemLayout(item, index) {
+    ListItem() {
+      Row() {
+        Column() {
+          Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
+            Row() {
+              Image(item.icon)
+                .customizeImage(Constants.MANAGEMENT_IMAGE_WIDTH, Constants.MANAGEMENT_IMAGE_HEIGHT)
+                .margin({ right: Constants.MANAGEMENT_IMAGE_MARGIN_RIGHT })
+              Text(item.groupName)
+                .fontSize(Constants.TEXT_MIDDLE_FONT_SIZE)
+                .fontWeight(FontWeight.Medium)
+                .fontColor($r('app.color.label_color'))
+                .flexGrow(Constants.FLEX_GROW)
+              Image($r('app.media.rightarrow'))
+                .customizeImage(Constants.IMAGE_WIDTH, Constants.IMAGE_HEIGHT)
+            }
+            .width(Constants.FULL_WIDTH)
+            .height(Constants.MANAGEMENT_ROW_HEIGHT)
+          }
+          if (!index) {
+            Row() {
+              Flex() {
+                Column().width(Constants.MANAGEMENT_TEXT_DECORATION_MARGIN_LEFT)
+                Column()
+                  .backgroundColor($r('app.color.text_decoration_color'))
+                  .height(Constants.TEXT_DECORATION_HEIGHT)
+                  .flexGrow(Constants.FLEX_GROW)
+              }
+            }
+          }
+        }.onClick(() => {
+          if (item.groupName === '其他权限' || item.groupName === '电话' || item.groupName === '通讯录' || item.groupName === '信息'
+          || item.groupName === '通话记录' || item.groupName === '日历') {
+            router.push({
+              uri: 'pages/authority-secondary',
+              params: { routerData: this.allPermissionApplications, backTitle: item.groupName }
+            })
+          } else {
+            var dataList = this.allPermissionApplications.filter((ele) => {
+              return ele.groupName === item.group
+            })
+
+            router.push({
+              uri: 'pages/authority-tertiary-groups',
+              params: { routerData: dataList, backTitle: item.groupName  }
+            })
+          }
+        })
+      }
+    }.padding({ left: Constants.DEFAULT_PADDING_START, right: Constants.DEFAULT_PADDING_END })
+  }
+
+  @State allApplicationPermissions: applicationPermissions[] = []; // All permissions apply
+  @State allPermissions: string[] = []; // All permissions
+  @State allSystemPermissions: string[] = []; // All system permissions
+  @State allUserPermissions: string[] = []; // All user rights
+  @State allPermissionApplications: permissionApplications [] = [] // All app permissions
+  @State allGroups: string[] = [] // All groups
+  @State allGroupPermission: groupPermission[] = [] // All group permissions
+  @State currentIndex: number = 0
+  @Builder TabBuilder(index: number) {
+    Flex({ alignItems: ItemAlign.Center, justifyContent: FlexAlign.Center }) {
+      Text(index ? $r('app.string.application') : $r('app.string.authority'))
+        .fontColor(this.currentIndex == index ? $r('app.color.button_color') : $r('app.color.label_color'))
+        .fontWeight(this.currentIndex == index ? FontWeight.Bold : FontWeight.Regular)
+        .lineHeight(Constants.TEXT_LINE_HEIGHT)
+      if(this.currentIndex == index) {
+        Row().width(Constants.FULL_WIDTH).height(Constants.TAB_DECORATION_HEIGHT)
+          .backgroundColor($r('app.color.button_color'))
+          .position({ y: Constants.TAB_DECORATION_POSITION_Y })
+      }
+    }.height(Constants.TAB_HEIGHT)
+  }
+
+  /**
+   * Convert the permission array into key, value key-value objects for easy sorting
+   * @param {Array} order User rights
+   * @return {Object} return the processed object
+   */
+  orderDict(order) {
+    let result = {};
+    for (let i = 0; i < order.length; i++) {
+      let key = order[i];
+      result[key] = i;
+    }
+    return result;
+  }
+
+  /**
+   * Compare and sort the permission array according to the permission key value
+   * @param {String} prop Sort by permission
+   * @param {Object} orderSort objects to be sorted
+   * @return {Array} Returns a sorted array of permissions
+   */
+  compare(prop, orderSort) {
+    return function(a, b) {
+      let aSortValue = orderSort[a[prop]];
+      let bSortValue = orderSort[b[prop]];
+      if (aSortValue == undefined) {
+        throw new Error('当前的字段不在排序列表里：' + a[prop]);
+      }
+      if (bSortValue == undefined) {
+        throw new Error('当前的字段不在排序列表里：' + b[prop]);
+      }
+      return aSortValue - bSortValue;
+    }
+  }
+
+  /**
+   * Get all app permission information
+   * @param {Array} allPermissions All permissions
+   * @param {Object} allApplicationPermissions All app permissions
+   */
+  getAllBundlePermissions(allPermissions: string[], allApplicationPermissions: applicationPermissions[]) {
+    bundle.getAllBundleInfo(Constants.PARMETER_BUNDLE_FLAG).then(async(res) => {
+      const bundleInfos = res;
+      var count = bundleInfos.length;
+      if (count <= 0) {
+        console.info(TAG + 'bundle.getAllBundleInfo result.length less than or equal to zero');
+        return;
+      }
+      var infoIndex = 0;
+      for (let i = 0; i < count; i++) {
+        var info = bundleInfos[i];
+        // Filter blank icon icon and text label resources
+        try {
+          const ret = await bundle.queryAbilityByWant({
+            bundleName: info.name,
+            action: "action.system.home",
+            entities: ["entity.system.home"]
+          }, bundle.BundleFlag.GET_ABILITY_INFO_WITH_APPLICATION, Constants.USERID);
+        } catch(e) {
+          console.log(TAG + 'queryAbilityByWant catch error: ' + JSON.stringify(e))
+          continue;
+        }
+
+        if (noNeedDisplayApp.indexOf(info.name) != -1) {
+          continue;
+        }
+        await this.deduplicationPermissions(info, allPermissions, allApplicationPermissions);
+        this.updateAppLabel(infoIndex, info.name, info.appInfo.label);
+        this.updateAppIcon(infoIndex, info.name);
+        infoIndex = infoIndex + 1;
+      }
+      this.getAllPermissionApplications();
+      let orderSort = this.orderDict(userGrantPermissions);
+      this.allPermissionApplications.sort(this.compare('permission', orderSort));
+      this.getAllGroupPermission();
+      bundleInfosList = this.allApplicationPermissions;
+      bundleInfosList.forEach((item) => {
+        if (!isNaN(item.labelId)) {
+          item.alphabeticalIndex = '';
+        } else {
+          item.alphabeticalIndex = makePy(item.labelId)[0].slice(0, 1); // Get the first letter in the returned initials array
+        }
+      })
+    })
+      .catch((error) => {
+        console.error(TAG + 'bundle.getAllBundleInfo failed. Cause: ' + JSON.stringify(error));
+      })
+  }
+
+  /**
+   * Get the corresponding permission group id according to the permission
+   * @param {String} permission app name id
+   * @return {Number} groupId
+   */
+  getPermissionGroupByPermission(permission: string) {
+    for (let i = 0; i < permissionGroups.length; i++) {
+      if (permissionGroups[i].permissionName == permission) {
+        return groups[permissionGroups[i].groupId];
+      }
+    }
+  }
+
+  /**
+   * Get all app permission information
+   */
+  getAllPermissionApplications() {
+    const this_ = this;
+    var leng = this_.allPermissions.length;
+    if (leng > 0) {
+      for (let i = 0; i < leng; i++) {
+        if (userGrantPermissions.indexOf(this_.allPermissions[i]) == -1) {
+          this_.allSystemPermissions.push(this_.allPermissions[i]);
+        } else {
+          this_.allUserPermissions.push(this_.allPermissions[i]);
+        }
+      }
+    }
+    for (let i = 0; i < this_.allUserPermissions.length; i++) {
+      var permissionGroup = this_.getPermissionGroupByPermission(this_.allUserPermissions[i]);
+      var icon: string = permissionGroup.icon;
+      var bundleNames: string[] = [];
+      for (let j = 0; j < this_.allApplicationPermissions.length; j++) {
+        if (this_.allApplicationPermissions[j].permissions.indexOf(this_.allUserPermissions[i]) != -1) {
+          bundleNames.push(this_.allApplicationPermissions[j].bundleName);
+        }
+      }
+      var pa: permissionApplications = {
+        'permission': this_.allUserPermissions[i],
+        'groupName': permissionGroup.name,
+        'bundleNames': bundleNames,
+        'icon': icon
+      };
+      this_.allPermissionApplications.push(pa);
+    }
+  }
+
+  /**
+   * Get permission group information
+   */
+  getAllGroupPermission() {
+    const this_ = this;
+    var temp1 = [];
+    temp1 = ["LOCATION","CAMERA","MICROPHONE","MEDIA","CALENDAR","SPORT","HEALTH"];
+    groups.forEach((item) => {
+      if (temp1.indexOf(item.name) > -1) {
+        var gp: groupPermission = {
+          "group": item.name,
+          "permissions": item.permissions,
+          'groupName': item.groupName,
+          'icon': item.icon,
+          'isShow': item.isShow
+        };
+        this_.allGroupPermission.push(gp);
+      }
+    })
+    let temp2 = [];
+    groups.forEach((item) => {
+      if (item.isShow && temp1.indexOf(item.name) === -1) {
+        var gp: groupPermission = {
+          "group": item.name,
+          "permissions": item.permissions,
+          'groupName': item.groupName,
+          'icon': item.icon,
+          'isShow': item.isShow
+        };
+        temp2.push(item.name);
+        this_.allGroupPermission.push(gp);
+      }
+    })
+    for (let i = 0; i < this_.allPermissionApplications.length; i++) {
+        if (this_.allGroups.indexOf(this_.allPermissionApplications[i].groupName) == -1
+        && temp1.indexOf(this_.allPermissionApplications[i].groupName) == -1) {
+          this_.allGroups.push(this_.allPermissionApplications[i].groupName);
+        }
+    }
+    // Permission layout
+    var temp = this_.allGroups;
+    temp = temp.filter(function(item) {
+      return temp1.indexOf(item) == -1 && temp2.indexOf(item) == -1;
+    });
+    if (temp.indexOf("OTHER") > -1) {
+      temp.splice(temp.indexOf("OTHER"),1);
+      temp.push("OTHER");
+    }else {
+      temp.push("OTHER");
+    }
+    this_.allGroups = temp;
+    for (let i = 0; i < this_.allGroups.length; i++) {
+      var permissions: string[] = permissionGroupPermissions[this_.allGroups[i]];
+      var gp: groupPermission = {
+        "group": this_.allGroups[i],
+        "permissions": permissions,
+        'groupName': '',
+        'icon': '',
+        'isShow': false
+      };
+      this_.allGroupPermission.push(gp);
+    }
+    this.allGroupPermission.forEach((ele) => {
+      groups.forEach((item) => {
+        if (ele.group === item.name) {
+          ele.groupName = item.groupName;
+          ele.icon = item.icon;
+          ele.isShow = item.isShow;
+        }
+      });
+    })
+  }
+
+  /**
+   * Deduplicate permission information and permission group information
+   * @param {Object} info bundleInfos Application Information
+   * @param {Array} allPermissions All permissions
+   * @param {Array} allApplicationPermissions All permissions apply
+   */
+  async deduplicationPermissions(info, allPermissions, allApplicationPermissions) {
+    var reqPermissionsLen = info.reqPermissions.length;
+    var reqUserPermissions: string[] = [];
+    var acManager = abilityAccessCtrl.createAtManager()
+    if (reqPermissionsLen > 0) {
+      for (let j = 0; j < info.reqPermissions.length; j++) {
+        var permission = info.reqPermissions[j];
+        var flag = await acManager.getPermissionFlags(info.appInfo.accessTokenId, permission)
+        if(flag == Constants.PRE_AUTHORIZATION_NOT_MODIFIED) {
+          continue
+        }
+        if (allPermissions.indexOf(permission) == -1) {
+          allPermissions.push(permission);
+        }
+        if (userGrantPermissions.indexOf(permission) != -1) {
+          reqUserPermissions.push(permission);
+        }
+      }
+    }
+    let dePermissions = [];
+    let groupIds = [];
+    for (let i = 0; i < reqUserPermissions.length; i++) {
+      if(dePermissions.indexOf(permissionPermissionGroup[reqUserPermissions[i]]) == -1){
+        dePermissions.push(permissionPermissionGroup[reqUserPermissions[i]]);
+      }
+      if(groupIds.indexOf(permissionGroupIds[reqUserPermissions[i]]) == -1){
+        groupIds.push(permissionGroupIds[reqUserPermissions[i]]);
+      }
+    }
+
+    // adapt different api
+    if (info.compatibleVersion >= Constants.API_VERSION_SUPPORT_STAGE) {
+      info.appInfo.iconId = info.hapModuleInfos[0].abilityInfo[0].iconId;
+    }
+
+    var ap: applicationPermissions = {
+      'bundleName': info.name,
+      'tokenId': info.appInfo.accessTokenId,
+      'iconId': info.appInfo.iconId,
+      'labelId': info.appInfo.labelId,
+      'permissions': reqUserPermissions,
+      'groupId': groupIds
+    };
+    allApplicationPermissions.push(ap);
+  }
+
+  /**
+   * Get app name resource
+   * @param {Number} index index of all app permissions array
+   * @param {String} bundleName Package names
+   * @param {String} labelName Application Name
+   */
+  updateAppLabel(index, bundleName, labelName) {
+    Resmgr.getResourceManager(globalThis.context, bundleName).then(item => {
+      if (index >= this.allApplicationPermissions.length) {
+        return;
+      }
+      var info = this.allApplicationPermissions[index];
+      item.getString(info['labelId'], (error, value) => {
+        if (value == undefined) {
+          info['labelId'] = labelName;
+        } else {
+          info['labelId'] = value;
+        }
+      })
+    }).catch(error => {
+      console.error(TAG + 'Resmgr.getResourceManager failed. Cause: ' + JSON.stringify(error));
+    })
+  }
+
+  /**
+   * Get app icon resources
+   * @param {Number} index index of all app permissions array
+   * @param {String} bundleName Package names
+   */
+  updateAppIcon(index, bundleName) {
+    Resmgr.getResourceManager(globalThis.context, bundleName).then(item => {
+      if (index >= this.allApplicationPermissions.length) {
+        return;
+      }
+      var info = this.allApplicationPermissions[index];
+      item.getMediaBase64(info['iconId'], (error, value) => {
+        info['iconId'] = value;
+      })
+    }).catch(error => {
+      console.error(TAG + 'Resmgr.getResourceManager failed. Cause: ' + JSON.stringify(error));
+    })
+  }
+
+  /**
+   * Lifecycle function, executed when the page is initialized
+   */
+  aboutToAppear() {
+    console.log(TAG + 'on aboutToAppear, version 1.01');
+    this.getAllBundlePermissions(this.allPermissions, this.allApplicationPermissions);
+    Resmgr.getResourceManager(globalThis.context, Constants.BUNDLE_NAME).then(item => {
+      item.getString($r("app.string.textInput_placeholder").id, (err, val) => {
+        textInput_placeholder = val
+      })
+    })
+  }
+
+  getPermissionGroup(allGroup, order) {
+    var fixedName: string[] = ['LOCATION', 'CAMERA', 'MICROPHONE']
+    var fixedGroup: any[] = []
+    var changeGroup: any[] = []
+    var otherGroup: any[] = []
+
+    allGroup.forEach(group => {
+      if(fixedName.indexOf(group.group) !== -1) {
+        fixedGroup.push(group)
+      }else if(group.group == 'OTHER') {
+        otherGroup.push(group)
+      }else {
+        changeGroup.push(group)
+      }
+    })
+
+    if(order == Constants.FIXED_GROUP){
+      return fixedGroup
+    }else if(order == Constants.CHANGE_GROUP) {
+      return changeGroup
+    }else if(order == Constants.OTHER_GROUP) {
+      return otherGroup
+    }
+  }
+
+  build() {
+    GridContainer({ gutter: Constants.GUTTER, margin: Constants.GRID_MARGIN }) {
+      Row() {
+        Row()
+          .useSizeType({
+            xs: { span: Constants.LEFT_XS_SPAN, offset: Constants.LEFT_XS_OFFSET },
+            sm: { span: Constants.LEFT_SM_SPAN, offset: Constants.LEFT_SM_OFFSET },
+            md: { span: Constants.LEFT_MD_SPAN, offset: Constants.LEFT_MD_OFFSET },
+            lg: { span: Constants.LEFT_LG_SPAN, offset: Constants.LEFT_LG_OFFSET }
+          })
+          .height(Constants.FULL_HEIGHT)
+        Row() {
+          Column() {
+            Row() {
+              backBar( { title: JSON.stringify($r('app.string.authority_management')), recordable: true })
+            }
+            Row() {
+              Column() {
+                Column() {
+                  Stack() {
+                    if(this.allGroupPermission.length) {
+                      Tabs() {
+                        TabContent() {
+                          Row() {
+                            Column() {
+                              Scroll() {
+                                Column() {
+                                  List() {
+                                    ListItem() {
+                                      List() {
+                                        ForEach(this.getPermissionGroup(this.allGroupPermission, Constants.FIXED_GROUP).slice(Constants.SLICE_START,
+                                          this.getPermissionGroup(this.allGroupPermission, Constants.FIXED_GROUP).length - 1), (item) => {
+                                          this.ListItemLayout(item, Constants.SLICE_START_INDEX)
+                                        }, item => item.toString())
+                                        ForEach(this.getPermissionGroup(this.allGroupPermission, Constants.FIXED_GROUP).slice(Constants.SLICE_END), (item, index) => {
+                                          this.ListItemLayout(item, Constants.SLICE_END_INDEX)
+                                        }, item => item.toString())
+                                      }.backgroundColor($r('app.color.default_background_color'))
+                                      .borderRadius(Constants.BORDER_RADIUS)
+                                      .padding({ top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
+                                      .margin({ bottom: Constants.LIST_MARGIN_BOTTOM })
+                                    }
+
+                                    ListItem() {
+                                      List() {
+                                        ForEach(this.getPermissionGroup(this.allGroupPermission, Constants.CHANGE_GROUP).slice(Constants.SLICE_START,
+                                          this.getPermissionGroup(this.allGroupPermission, Constants.CHANGE_GROUP).length - 1), (item) => {
+                                          this.ListItemLayout(item, Constants.SLICE_START_INDEX)
+                                        }, item => item.toString())
+                                        ForEach(this.getPermissionGroup(this.allGroupPermission, Constants.CHANGE_GROUP).slice(Constants.SLICE_END), (item, index) => {
+                                          this.ListItemLayout(item, Constants.SLICE_END_INDEX)
+                                        }, item => item.toString())
+                                      }.backgroundColor($r('app.color.default_background_color'))
+                                      .borderRadius(Constants.BORDER_RADIUS)
+                                      .padding({ top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
+                                      .margin({ bottom: Constants.LIST_MARGIN_BOTTOM })
+                                    }
+
+                                    ListItem() {
+                                      List() {
+                                        ForEach(this.getPermissionGroup(this.allGroupPermission, Constants.OTHER_GROUP), (item) => {
+                                          this.ListItemLayout(item, Constants.SLICE_END_INDEX)
+                                        }, item => item.toString())
+                                      }.backgroundColor($r('app.color.default_background_color'))
+                                      .borderRadius(Constants.BORDER_RADIUS)
+                                      .padding({ top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
+                                    }
+                                  }.height(Constants.FULL_HEIGHT)
+                                  .borderRadius(Constants.BORDER_RADIUS)
+                                  .clip(true)
+                                }.padding({
+                                  left: Constants.MANAGEMENT_ROW_PADDING_LEFT,
+                                  right: Constants.MANAGEMENT_ROW_PADDING_RIGHT,
+                                })
+                              }.scrollBar(BarState.Off)
+                              .margin({ top: Constants.MANAGEMENT_ROW_PADDING_TOP })
+                            }.width(Constants.FULL_WIDTH)
+                          }
+                        }.tabBar(this.TabBuilder(0))
+                        TabContent() {
+                          applicationItem()
+                        }.tabBar(this.TabBuilder(1))
+                      }
+                      .barWidth(Constants.BAR_WIDTH)
+                      .barMode(BarMode.Fixed)
+                      .onChange((index) => {
+                        this.currentIndex = index
+                      })
+                    }else {
+                      LoadingProgress().width(Constants.LOADING_WIDTH)
+                    }
+                  }.height(Constants.FULL_HEIGHT)
+                }
+              }
+            }
+            .layoutWeight(Constants.LAYOUT_WEIGHT)
+          }
+        }
+        .useSizeType({
+          xs: { span: Constants.MIDDLE_XS_SPAN, offset: Constants.MIDDLE_XS_OFFSET },
+          sm: { span: Constants.MIDDLE_SM_SPAN, offset: Constants.MIDDLE_SM_OFFSET },
+          md: { span: Constants.MIDDLE_MD_SPAN, offset: Constants.MIDDLE_MD_OFFSET },
+          lg: { span: Constants.MIDDLE_LG_SPAN, offset: Constants.MIDDLE_LG_OFFSET }
+        })
+        .height(Constants.FULL_HEIGHT)
+        Row()
+          .useSizeType({
+            xs: { span: Constants.RIGHT_XS_SPAN, offset: Constants.RIGHT_XS_OFFSET },
+            sm: { span: Constants.RIGHT_SM_SPAN, offset: Constants.RIGHT_SM_OFFSET },
+            md: { span: Constants.RIGHT_MD_SPAN, offset: Constants.RIGHT_MD_OFFSET },
+            lg: { span: Constants.RIGHT_LG_SPAN, offset: Constants.RIGHT_LG_OFFSET }
+          })
+          .height(Constants.FULL_HEIGHT)
+      }
+      .height(Constants.FULL_HEIGHT)
+      .width(Constants.FULL_WIDTH)
+      .backgroundColor($r("sys.color.ohos_id_color_sub_background"))
+      .opacity(Constants.MANAGEMENT_TRANSPARENCY)
+    }
+  }
+}
+
+@Component
+struct applicationItem {
+  @State applicationItem: any[] = bundleInfosList // application info array
+  @State oldApplicationItem: any[] = bundleInfosList // Original application information array
+  @State searchResult: boolean = true // search results
+
+  @Builder ListItemLayout(item, index) {
+    ListItem() {
+      Row() {
+        Column() {
+          Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
+            Row() {
+              Image(item.iconId)
+                .customizeImage(Constants.APPLICATION_IMAGE_WIDTH, Constants.APPLICATION_IMAGE_HEIGHT)
+                .margin({ right: Constants.APPLICATION_IMAGE_MARGIN_RIGHT })
+              Text(item.labelId)
+                .fontSize(Constants.TEXT_MIDDLE_FONT_SIZE)
+                .fontWeight(FontWeight.Medium)
+                .fontColor($r('app.color.label_color'))
+                .flexGrow(Constants.FLEX_GROW)
+              Text(item.groupId.length + '项权限')
+                .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
+                .fontColor($r('app.color.label_color_lighter'))
+                .margin({ right: Constants.APPLICATION_TEXT_MARGIN_RIGHT })
+              Image($r('app.media.rightarrow'))
+                .customizeImage(Constants.IMAGE_WIDTH, Constants.IMAGE_HEIGHT)
+            }
+            .width(Constants.FULL_WIDTH)
+            .height(Constants.AUTHORITY_ROW_HEIGHT)
+            .constraintSize({ minHeight: Constants.AUTHORITY_CONSTRAINTSIZE_MINHEIGHT })
+          }
+          if (!index) {
+            Row() {
+              Flex() {
+                Column().width(Constants.APPLICATION_TEXT_DECORATION_MARGIN_LEFT)
+                Column()
+                  .backgroundColor($r('app.color.text_decoration_color'))
+                  .height(Constants.TEXT_DECORATION_HEIGHT)
+                  .flexGrow(Constants.FLEX_GROW)
+              }
+            }
+          }
+        }.onClick(() => {
+          router.push({
+            uri: 'pages/application-secondary',
+            params: { routerData: item }
+          });
+        })
+      }
+    }.padding({
+      left: Constants.DEFAULT_PADDING_START,
+      right: Constants.DEFAULT_PADDING_END
+    })
+  }
+
+  build() {
+    Column() {
+      Row() {
+        textInput({
+          placeholder: textInput_placeholder,
+          applicationItem: $applicationItem,
+          oldApplicationItem: $oldApplicationItem,
+          searchResult: $searchResult
+        })
+      }.padding({
+        left: Constants.APPLICATION_TEXTINPUT_PADDING_LEFT,
+        top: Constants.APPLICATION_TEXTINPUT_PADDING_TOP,
+        right: Constants.APPLICATION_TEXTINPUT_PADDING_RIGHT
+      })
+      Row() {
+        Flex({ alignItems: ItemAlign.Start }) {
+          Column() {
+            Column() {
+              if (!this.applicationItem.length) {
+                Row() {
+                  Flex({ justifyContent: FlexAlign.Center, alignItems: ItemAlign.Center }) {
+                    Image($r('app.media.searchnoresult'))
+                      .customizeImage(Constants.SEARCHNORESULT_IMAGE_WIDTH, Constants.SEARCHNORESULT_IMAGE_HEIGHT)
+                  }
+                }.margin({ top: Constants.MANAGEMENT_ROW_MARGIN_TOP })
+                .padding({ left: Constants.MANAGEMENT_ROW_PADDING_LEFT })
+              } else {
+                Row() {
+                  Scroll() {
+                    List() {
+                      ForEach(this.applicationItem.slice(Constants.SLICE_START, this.applicationItem.length - 1),
+                        (item) => {
+                          this.ListItemLayout(item, Constants.SLICE_START_INDEX)
+                        }, item => item.toString())
+                      ForEach(this.applicationItem.slice(Constants.SLICE_END), (item, index) => {
+                        this.ListItemLayout(item, Constants.SLICE_END_INDEX)
+                      }, item => item.toString())
+                    }.backgroundColor($r('app.color.default_background_color'))
+                    .borderRadius(Constants.BORDER_RADIUS)
+                    .padding({ top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
+                  }.scrollBar(BarState.Off)
+                }.margin({ left: Constants.MANAGEMENT_ROW_PADDING_LEFT })
+                .borderRadius(Constants.BORDER_RADIUS)
+                .clip(true)
+              }
+            }.backgroundColor($r('app.color.background_color'))
+            .height(Constants.FULL_HEIGHT)
+          }.margin({ top: Constants.MANAGEMENT_ROW_MARGIN_TOP, bottom: Constants.APPLICATION_LIST_MARGIN_BOTTOM })
+          Column() {
+            alphabetIndexerComponent({ applicationItem: $applicationItem, oldApplicationItem: $oldApplicationItem })
+          }.margin({ top: Constants.APPLICATION_ALPHABETINDEX_MARGIN_TOP })
+          .width(Constants.APPLICATION_ALPHABETINDEX_WIDTH)
+        }
+      }
+    }
+  }
+}
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/authority-secondary.ets b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/authority-secondary.ets
index 21480ad4ce0d66bcd44ef4e1dff49aa5f8f26e56..d3256f8c4b078b867d11960a9fba26b343a0a1f6 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/authority-secondary.ets
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/authority-secondary.ets
@@ -1,177 +1,177 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-import { backBar } from "../common/components/backBar";
-import { permissionGroups, groups } from "../common/model/permissionGroup";
-import router from '@system.router';
-import Constants from '../common/utils/constant';
-
-var TAG = 'PermissionManager_MainAbility:'
-
-class CalendarObj {
-  permissionName: string
-  groupName: string
-  description: string
-  label: string
-  index: number
-  constructor(permissionName: string, groupName: string, description: string, label: string, index: number) {
-    this.permissionName = permissionName
-    this.groupName = groupName
-    this.description = description
-    this.label = label
-    this.index = index
-  }
-} // Permission management secondary interface data class
-
-@Entry
-@Component
-struct appNamePage {
-  private backTitle = router.getParams().backTitle; // return title name
-
-  build() {
-    GridContainer({ gutter: Constants.GUTTER, margin: Constants.GRID_MARGIN }) {
-      Row() {
-        Row()
-          .useSizeType({
-            xs: { span: Constants.LEFT_XS_SPAN, offset: Constants.LEFT_XS_OFFSET },
-            sm: { span: Constants.LEFT_SM_SPAN, offset: Constants.LEFT_SM_OFFSET },
-            md: { span: Constants.LEFT_MD_SPAN, offset: Constants.LEFT_MD_OFFSET },
-            lg: { span: Constants.LEFT_LG_SPAN, offset: Constants.LEFT_LG_OFFSET }
-          })
-          .height(Constants.FULL_HEIGHT)
-        Row() {
-          Column() {
-            Row() {
-              backBar({ title: JSON.stringify(this.backTitle), recordable: false })
-            }
-            Row() {
-              Column() {
-                Scroll() {
-                  appNameItem()
-                }
-              }
-            }.layoutWeight(Constants.LAYOUT_WEIGHT)
-          }
-        }
-        .useSizeType({
-          xs: { span: Constants.MIDDLE_XS_SPAN, offset: Constants.MIDDLE_XS_OFFSET },
-          sm: { span: Constants.MIDDLE_SM_SPAN, offset: Constants.MIDDLE_SM_OFFSET },
-          md: { span: Constants.MIDDLE_MD_SPAN, offset: Constants.MIDDLE_MD_OFFSET },
-          lg: { span: Constants.MIDDLE_LG_SPAN, offset: Constants.MIDDLE_LG_OFFSET }
-        })
-        .height(Constants.FULL_HEIGHT)
-        Row()
-          .useSizeType({
-            xs: { span: Constants.RIGHT_XS_SPAN, offset: Constants.RIGHT_XS_OFFSET },
-            sm: { span: Constants.RIGHT_SM_SPAN, offset: Constants.RIGHT_SM_OFFSET },
-            md: { span: Constants.RIGHT_MD_SPAN, offset: Constants.RIGHT_MD_OFFSET },
-            lg: { span: Constants.RIGHT_LG_SPAN, offset: Constants.RIGHT_LG_OFFSET }
-          })
-          .height(Constants.FULL_HEIGHT)
-      }
-      .height(Constants.FULL_HEIGHT)
-      .width(Constants.FULL_WIDTH)
-      .backgroundColor($r("sys.color.ohos_id_color_sub_background"))
-      .opacity(Constants.MANAGEMENT_TRANSPARENCY)
-    }
-  }
-}
-
-@Component
-struct appNameItem {
-  @State calendarListItem: CalendarObj[] = []; // Permission management secondary interface data array
-  private routerData = router.getParams().routerData; // Routing jump data
-  private backTitle = router.getParams().backTitle; // return title name
-  private allPermissionApplications = router.getParams().allPermissionApplications; // Array of all app permission names
-
-  @Builder ListItemLayout(item, index) {
-    ListItem() {
-      Row() {
-        Column() {
-          Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
-            Row() {
-              Text(item.label)
-                .fontSize(Constants.TEXT_MIDDLE_FONT_SIZE)
-                .fontColor($r('app.color.label_color'))
-                .fontWeight(FontWeight.Medium)
-                .flexGrow(Constants.FLEX_GROW)
-              Image($r('app.media.rightarrow'))
-                .objectFit(ImageFit.Contain)
-                .height(Constants.IMAGE_HEIGHT)
-                .width(Constants.IMAGE_WIDTH)
-            }
-            .width(Constants.FULL_WIDTH)
-            .height(Constants.LISTITEM_ROW_HEIGHT)
-          }
-          if (!index) {
-            Row() {
-              Column()
-                .backgroundColor($r('app.color.text_decoration_color'))
-                .width(Constants.FULL_WIDTH)
-                .height(Constants.TEXT_DECORATION_HEIGHT)
-            }
-          }
-        }.onClick(() => {
-          var dataList = this.routerData.filter((ele) => {
-            return ele.groupName === item.groupName;
-          })
-          router.push({
-            uri: 'pages/authority-tertiary',
-            params: { routerData: [dataList[item.index]], backTitle: item.label }
-          });
-        })
-      }
-    }.padding({ left: Constants.DEFAULT_PADDING_START, right: Constants.DEFAULT_PADDING_END })
-  }
-
-  /**
-   * Lifecycle function, executed when the page is initialized
-   */
-  aboutToAppear() {
-    var permissionsList = groups.filter((item) => {
-      return item.groupName === this.backTitle
-    })
-    for (let i = 0; i < permissionsList[0].permissions.length; i++) {
-      permissionGroups.forEach((item) => {
-        if (item.permissionName === permissionsList[0].permissions[i]) {
-          this.calendarListItem.push(
-            new CalendarObj(item.permissionName, item.groupName, item.description, item.label, i)
-          )
-        }
-      })
-    }
-  }
-
-  build() {
-    Row() {
-      Column() {
-        Row() {
-            List() {
-              ForEach(this.calendarListItem.slice(Constants.SLICE_START, this.calendarListItem.length - 1), (item) => {
-                this.ListItemLayout(item, Constants.SLICE_START_INDEX)
-              }, item => item.toString())
-              ForEach(this.calendarListItem.slice(Constants.SLICE_END), (item, index) => {
-                this.ListItemLayout(item, Constants.SLICE_END_INDEX)
-              }, item => item.toString())
-            }.backgroundColor($r('app.color.default_background_color')).borderRadius(Constants.BORDER_RADIUS)
-            .padding({ top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
-          }.margin({ top: Constants.ROW_MARGIN_TOP })
-        .padding({ left: Constants.LIST_PADDING_LEFT, right: Constants.LISTITEM_PADDING_RIGHT })
-      }
-      .width(Constants.FULL_WIDTH)
-      .height(Constants.FULL_HEIGHT)
-    }
-  }
-}
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+import { backBar } from "../common/components/backBar";
+import { permissionGroups, groups } from "../common/model/permissionGroup";
+import router from '@system.router';
+import Constants from '../common/utils/constant';
+
+var TAG = 'PermissionManager_MainAbility:'
+
+class CalendarObj {
+  permissionName: string
+  groupName: string
+  description: string
+  label: string
+  index: number
+  constructor(permissionName: string, groupName: string, description: string, label: string, index: number) {
+    this.permissionName = permissionName
+    this.groupName = groupName
+    this.description = description
+    this.label = label
+    this.index = index
+  }
+} // Permission management secondary interface data class
+
+@Entry
+@Component
+struct appNamePage {
+  private backTitle = router.getParams().backTitle; // return title name
+
+  build() {
+    GridContainer({ gutter: Constants.GUTTER, margin: Constants.GRID_MARGIN }) {
+      Row() {
+        Row()
+          .useSizeType({
+            xs: { span: Constants.LEFT_XS_SPAN, offset: Constants.LEFT_XS_OFFSET },
+            sm: { span: Constants.LEFT_SM_SPAN, offset: Constants.LEFT_SM_OFFSET },
+            md: { span: Constants.LEFT_MD_SPAN, offset: Constants.LEFT_MD_OFFSET },
+            lg: { span: Constants.LEFT_LG_SPAN, offset: Constants.LEFT_LG_OFFSET }
+          })
+          .height(Constants.FULL_HEIGHT)
+        Row() {
+          Column() {
+            Row() {
+              backBar({ title: JSON.stringify(this.backTitle), recordable: false })
+            }
+            Row() {
+              Column() {
+                Scroll() {
+                  appNameItem()
+                }
+              }
+            }.layoutWeight(Constants.LAYOUT_WEIGHT)
+          }
+        }
+        .useSizeType({
+          xs: { span: Constants.MIDDLE_XS_SPAN, offset: Constants.MIDDLE_XS_OFFSET },
+          sm: { span: Constants.MIDDLE_SM_SPAN, offset: Constants.MIDDLE_SM_OFFSET },
+          md: { span: Constants.MIDDLE_MD_SPAN, offset: Constants.MIDDLE_MD_OFFSET },
+          lg: { span: Constants.MIDDLE_LG_SPAN, offset: Constants.MIDDLE_LG_OFFSET }
+        })
+        .height(Constants.FULL_HEIGHT)
+        Row()
+          .useSizeType({
+            xs: { span: Constants.RIGHT_XS_SPAN, offset: Constants.RIGHT_XS_OFFSET },
+            sm: { span: Constants.RIGHT_SM_SPAN, offset: Constants.RIGHT_SM_OFFSET },
+            md: { span: Constants.RIGHT_MD_SPAN, offset: Constants.RIGHT_MD_OFFSET },
+            lg: { span: Constants.RIGHT_LG_SPAN, offset: Constants.RIGHT_LG_OFFSET }
+          })
+          .height(Constants.FULL_HEIGHT)
+      }
+      .height(Constants.FULL_HEIGHT)
+      .width(Constants.FULL_WIDTH)
+      .backgroundColor($r("sys.color.ohos_id_color_sub_background"))
+      .opacity(Constants.MANAGEMENT_TRANSPARENCY)
+    }
+  }
+}
+
+@Component
+struct appNameItem {
+  @State calendarListItem: CalendarObj[] = []; // Permission management secondary interface data array
+  private routerData = router.getParams().routerData; // Routing jump data
+  private backTitle = router.getParams().backTitle; // return title name
+  private allPermissionApplications = router.getParams().allPermissionApplications; // Array of all app permission names
+
+  @Builder ListItemLayout(item, index) {
+    ListItem() {
+      Row() {
+        Column() {
+          Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
+            Row() {
+              Text(item.label)
+                .fontSize(Constants.TEXT_MIDDLE_FONT_SIZE)
+                .fontColor($r('app.color.label_color'))
+                .fontWeight(FontWeight.Medium)
+                .flexGrow(Constants.FLEX_GROW)
+              Image($r('app.media.rightarrow'))
+                .objectFit(ImageFit.Contain)
+                .height(Constants.IMAGE_HEIGHT)
+                .width(Constants.IMAGE_WIDTH)
+            }
+            .width(Constants.FULL_WIDTH)
+            .height(Constants.LISTITEM_ROW_HEIGHT)
+          }
+          if (!index) {
+            Row() {
+              Column()
+                .backgroundColor($r('app.color.text_decoration_color'))
+                .width(Constants.FULL_WIDTH)
+                .height(Constants.TEXT_DECORATION_HEIGHT)
+            }
+          }
+        }.onClick(() => {
+          var dataList = this.routerData.filter((ele) => {
+            return ele.groupName === item.groupName;
+          })
+          router.push({
+            uri: 'pages/authority-tertiary',
+            params: { routerData: [dataList[item.index]], backTitle: item.label }
+          });
+        })
+      }
+    }.padding({ left: Constants.DEFAULT_PADDING_START, right: Constants.DEFAULT_PADDING_END })
+  }
+
+  /**
+   * Lifecycle function, executed when the page is initialized
+   */
+  aboutToAppear() {
+    var permissionsList = groups.filter((item) => {
+      return item.groupName === this.backTitle
+    })
+    for (let i = 0; i < permissionsList[0].permissions.length; i++) {
+      permissionGroups.forEach((item) => {
+        if (item.permissionName === permissionsList[0].permissions[i]) {
+          this.calendarListItem.push(
+            new CalendarObj(item.permissionName, item.groupName, item.description, item.label, i)
+          )
+        }
+      })
+    }
+  }
+
+  build() {
+    Row() {
+      Column() {
+        Row() {
+            List() {
+              ForEach(this.calendarListItem.slice(Constants.SLICE_START, this.calendarListItem.length - 1), (item) => {
+                this.ListItemLayout(item, Constants.SLICE_START_INDEX)
+              }, item => item.toString())
+              ForEach(this.calendarListItem.slice(Constants.SLICE_END), (item, index) => {
+                this.ListItemLayout(item, Constants.SLICE_END_INDEX)
+              }, item => item.toString())
+            }.backgroundColor($r('app.color.default_background_color')).borderRadius(Constants.BORDER_RADIUS)
+            .padding({ top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
+          }.margin({ top: Constants.ROW_MARGIN_TOP })
+        .padding({ left: Constants.LIST_PADDING_LEFT, right: Constants.LISTITEM_PADDING_RIGHT })
+      }
+      .width(Constants.FULL_WIDTH)
+      .height(Constants.FULL_HEIGHT)
+    }
+  }
+}
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/authority-tertiary-groups.ets b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/authority-tertiary-groups.ets
index 44cd9224d2b33bf31ef301dcab55c2462ce5f621..ed7d009dbbf2d79bec2564ec3bec0ec1f8448610 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/authority-tertiary-groups.ets
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/authority-tertiary-groups.ets
@@ -1,403 +1,403 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-import { backBar } from "../common/components/backBar";
-import { alphabetIndexerComponent } from "../common/components/alphabeticalIndex";
-import { textInput } from "../common/components/search";
-import router from '@system.router';
-import bundle from "@ohos.bundle";
-import Resmgr from '@ohos.resourceManager';
-import abilityAccessCtrl from '@ohos.abilityAccessCtrl';
-import { getAppLabel, getAppIcon, verifyAccessToken} from "../common/utils/utils";
-import { makePy } from "../common/utils/utils";
-import { authorizeDialog } from "../common/components/dialog";
-import Constants from '../common/utils/constant';
-
-var TAG = 'PermissionManager_MainAbility:'
-
-@Extend(Image) function customizeImage(width: number, height: number) {
-  .objectFit(ImageFit.Contain)
-  .width(width)
-  .height(height)
-}
-
-let routerData = router.getParams().routerData; // Routing jump data
-let backTitle = router.getParams().backTitle; // return title name
-let nowGrantResult = Constants.PERMISSION_NUM; // Authorization results now
-let nowRevokeResult = Constants.PERMISSION_NUM; // Now deauthorize results
-let GrantResultFlag = []; // Authorization result Flag
-let RevokeResultFlag = []; // Cancel authorization result Flag
-
-class ApplicationObj {
-  labelId: string
-  iconId: string
-  index: number
-  accessTokenId: number
-  permission: string
-  alphabeticalIndex: string
-  constructor(
-    labelId: string,
-    iconId: string,
-    index: number,
-    accessTokenId: number,
-    permission: string,
-    alphabeticalIndex: string) {
-    this.labelId = labelId
-    this.iconId = iconId
-    this.index = index
-    this.accessTokenId = accessTokenId
-    this.permission = permission
-    this.alphabeticalIndex = alphabeticalIndex
-  }
-} // application information
-
-@Entry
-@Component
-struct locationInfoPage {
-  build() {
-    GridContainer({ gutter: Constants.GUTTER, margin: Constants.GRID_MARGIN }) {
-      Row() {
-        Row()
-          .useSizeType({
-            xs: { span: Constants.LEFT_XS_SPAN, offset: Constants.LEFT_XS_OFFSET },
-            sm: { span: Constants.LEFT_SM_SPAN, offset: Constants.LEFT_SM_OFFSET },
-            md: { span: Constants.LEFT_MD_SPAN, offset: Constants.LEFT_MD_OFFSET },
-            lg: { span: Constants.LEFT_LG_SPAN, offset: Constants.LEFT_LG_OFFSET }
-          })
-          .height(Constants.FULL_HEIGHT)
-        Row() {
-          Column() {
-            Row() {
-              backBar({ title: JSON.stringify(backTitle), recordable: false })
-            }
-            Row() {
-              Column() {
-                applicationItem()
-
-              }.width(Constants.FULL_WIDTH)
-            }
-            .layoutWeight(Constants.LAYOUT_WEIGHT)
-          }
-        }
-        .useSizeType({
-          xs: { span: Constants.MIDDLE_XS_SPAN, offset: Constants.MIDDLE_XS_OFFSET },
-          sm: { span: Constants.MIDDLE_SM_SPAN, offset: Constants.MIDDLE_SM_OFFSET },
-          md: { span: Constants.MIDDLE_MD_SPAN, offset: Constants.MIDDLE_MD_OFFSET },
-          lg: { span: Constants.MIDDLE_LG_SPAN, offset: Constants.MIDDLE_LG_OFFSET }
-        })
-        .height(Constants.FULL_HEIGHT)
-        Row()
-          .useSizeType({
-            xs: { span: Constants.RIGHT_XS_SPAN, offset: Constants.RIGHT_XS_OFFSET },
-            sm: { span: Constants.RIGHT_SM_SPAN, offset: Constants.RIGHT_SM_OFFSET },
-            md: { span: Constants.RIGHT_MD_SPAN, offset: Constants.RIGHT_MD_OFFSET },
-            lg: { span: Constants.RIGHT_LG_SPAN, offset: Constants.RIGHT_LG_OFFSET }
-          })
-          .height(Constants.FULL_HEIGHT)
-      }
-      .height(Constants.FULL_HEIGHT)
-      .width(Constants.FULL_WIDTH)
-      .backgroundColor($r("sys.color.ohos_id_color_sub_background"))
-      .opacity(Constants.MANAGEMENT_TRANSPARENCY)
-    }
-  }
-}
-
-@Component
-struct applicationItem {
-  @State permissionNum: number = Constants.PERMISSION_NUM; // permission num
-  @State toggleIsOn: object = {}; // toggle switch state array
-  @State applicationList: ApplicationObj[] = []; // application info array
-  @State oldApplicationItem: ApplicationObj[] = []; // Original application information array
-  @State searchResult: boolean = true; // search results
-  @State placeholder: string = ''
-
-  authorizeDialogController: CustomDialogController = new CustomDialogController({
-    builder: authorizeDialog({ }),
-    autoCancel: true,
-    alignment: DialogAlignment.Center
-  });
-
-  @Builder ListItemLayout(item, index) {
-    ListItem() {
-      Row() {
-        Column() {
-          Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
-            Row() {
-              Image(item.iconId)
-                .customizeImage(Constants.AUTHORITY_IMAGE_WIDTH, Constants.AUTHORITY_IMAGE_HEIGHT)
-                .margin({ right: Constants.AUTHORITY_IMAGE_MARGIN_RIGHT })
-              Text(item.labelId)
-                .fontSize(Constants.TEXT_MIDDLE_FONT_SIZE)
-                .fontColor($r('app.color.text_color'))
-                .flexGrow(Constants.FLEX_GROW)
-              Toggle({ type: ToggleType.Switch, isOn: this.toggleIsOn[item.index] })
-                .selectedColor($r('app.color.toggle_color'))
-                .width(Constants.AUTHORITY_TOGGLE_WIDTH)
-                .height(Constants.AUTHORITY_TOGGLE_HEIGHT)
-                .onChange((isOn: boolean) => {
-                  if (item.accessTokenId === '' || item.permission === '') {
-                    return;
-                  }
-                  let _this = this;
-                  if (isOn) {
-                    let promises = routerData.map(it => new Promise((resolve, reject) => {
-                      _this.grantUserGrantedPermission(item.accessTokenId, it.permission, item.index, resolve);
-                    }));
-                    Promise.all(promises).then(function(results) {
-                      if(results.indexOf(-1) != -1) {
-                        _this.authorizeDialogController.open();
-                        _this.toggleIsOn[item.index] = false;
-                        setTimeout(()=> {
-                          _this.authorizeDialogController.close();
-                        }, Constants.DELAY_TIME)
-                      } else {
-                        _this.toggleIsOn[item.index] = true;
-                      }
-                      let num = Constants.PERMISSION_NUM;
-                      for(let key in _this.toggleIsOn){
-                        if(_this.toggleIsOn[key]){
-                          num++;
-                        }
-                      }
-                      _this.permissionNum = num;
-                    });
-                  } else {
-                    let promises = routerData.map(it => new Promise((resolve, reject) => {
-                      _this.revokeUserGrantedPermission(item.accessTokenId, it.permission, item.index, resolve);
-                    }));
-                    Promise.all(promises).then(function(results) {
-                      if(results.indexOf(-1) != -1) {
-                        _this.authorizeDialogController.open();
-                        _this.toggleIsOn[item.index] = true;
-                        setTimeout(()=> {
-                          _this.authorizeDialogController.close();
-                        }, Constants.DELAY_TIME)
-                      } else {
-                        _this.toggleIsOn[item.index] = false;
-                      }
-                      let num = Constants.PERMISSION_NUM;
-                      for(let key in _this.toggleIsOn){
-                        if(_this.toggleIsOn[key]){
-                          num++;
-                        }
-                      }
-                      _this.permissionNum = num;
-                    });
-                  }
-                })
-            }
-            .width(Constants.FULL_WIDTH)
-            .height(Constants.AUTHORITY_ROW_HEIGHT)
-            .constraintSize({ minHeight: Constants.AUTHORITY_CONSTRAINTSIZE_MINHEIGHT })
-          }
-          if (!index) {
-            Row() {
-              Flex() {
-                Column().width(Constants.APPLICATION_TEXT_DECORATION_MARGIN_LEFT)
-                Column()
-                  .backgroundColor($r('app.color.text_decoration_color'))
-                  .height(Constants.TEXT_DECORATION_HEIGHT)
-                  .flexGrow(Constants.FLEX_GROW)
-              }
-            }
-          }
-        }.onClick(() => {
-        })
-      }
-    }.padding({ left: Constants.DEFAULT_PADDING_START, right: Constants.DEFAULT_PADDING_END })
-  }
-
-  /**
-   * Grant permissions to the app
-   * @param {Number} accessTokenId
-   * @param {String} permission permission name
-   * @param {Number} index Array index to modify permission status
-   */
-  grantUserGrantedPermission(accessTokenId, permission, index, resolve) {
-    abilityAccessCtrl.createAtManager().grantUserGrantedPermission(
-      accessTokenId, permission, Constants.PERMISSION_FLAG).then(result => {
-      // result: 0 Authorization succeeded; result: -1 Authorization failed
-      resolve(result);
-    }).catch(error => {
-      resolve(-1);
-      console.error(TAG + 'abilityAccessCtrl.createAtManager.grantUserGrantedPermission failed. Cause: ' + JSON.stringify(error));
-    })
-  }
-
-  /**
-   * Deauthorize the app
-   * @param {Number} accessTokenId
-   * @param {String} permission permission name
-   * @param {Number} index Array index to modify permission status
-   */
-  revokeUserGrantedPermission(accessTokenId, permission, index, resolve) {
-    abilityAccessCtrl.createAtManager().revokeUserGrantedPermission(
-      accessTokenId, permission, Constants.PERMISSION_FLAG).then(result => {
-      // result: 0 successfully cancel the authorization; result: -1 cancel the authorization failed
-      resolve(result);
-    }).catch(error => {
-      resolve(-1);
-      console.error(TAG + 'abilityAccessCtrl.createAtManager.revokeUserGrantedPermission failed. Cause: ' + JSON.stringify(error));
-    })
-  }
-
-  /**
-   * Lifecycle function, executed when the page is initialized
-   */
-  aboutToAppear() {
-    var bundleNames = []
-    routerData.forEach(permissionmanager => {
-      permissionmanager.bundleNames.forEach( bundleName => {
-        if (bundleNames.indexOf(bundleName) == -1) {
-          bundleNames.push(bundleName)
-        }
-      })
-    })
-
-    Resmgr.getResourceManager(globalThis.context, Constants.BUNDLE_NAME).then(item => {
-      item.getString($r("app.string.textInput_placeholder").id, (err, val) => {
-        this.placeholder = val
-      })
-    })
-
-    // initial then fill values when sync return which may cause sync panic
-    for (let i = 0; i < bundleNames.length; i++) {
-      this.applicationList.push(
-        new ApplicationObj('', '', i, 0, '', ''));
-      this.oldApplicationItem.push(
-        new ApplicationObj('', '', i, 0, '', ''));
-    }
-
-    for (let i = 0; i < bundleNames.length; i++) {
-      // Get BundleInfo based on bundle name
-      bundle.getBundleInfo(bundleNames[i], Constants.PARMETER_BUNDLE_FLAG).then(res => {
-        Promise.all([getAppLabel(res.appInfo.labelId, res.name),
-        getAppIcon(res.appInfo.iconId, res.name)
-        ])
-          .then((values) => {
-            this.applicationList[i] = (
-              new ApplicationObj(
-              String(values[0]),
-              String(values[1]),
-                i,
-                res.appInfo.accessTokenId,
-                routerData[0].permission,
-              makePy(values[0])[0].slice(0, 1)) // Get the first letter in the returned initials array
-            );
-            this.oldApplicationItem[i] = (
-              new ApplicationObj(
-              String(values[0]),
-              String(values[1]),
-                i,
-                res.appInfo.accessTokenId,
-                routerData[0].permission,
-              makePy(values[0])[0].slice(0, 1)) // Get the first letter in the returned initials array
-            );
-          });
-        // 0: have permission; -1: no permission
-        var boole = true;
-        this.permissionNum++;
-        for (let j = 0; j < routerData.length; j++) {
-          if (res.reqPermissions.indexOf(routerData[j].permission) == -1) {
-            continue
-          }
-          verifyAccessToken(res.appInfo.accessTokenId, routerData[j].permission).then((access) => {
-            if (Number(access) === Constants.PERMISSION_INDEX) {
-              if(boole){
-                this.toggleIsOn[i] = true;
-              }
-            } else {
-              if(boole){
-                this.permissionNum--
-              }
-              boole = false;
-              this.toggleIsOn[i] = false;
-            }
-          });
-        }
-      }).catch(error => {
-        console.log(TAG + bundleNames[i] + "getBundleInfo failed, cause: " + JSON.stringify(error));
-      })
-    }
-  }
-
-  build() {
-    Column() {
-      Row() {
-        textInput({
-          placeholder: this.placeholder,
-          applicationItem: $applicationList,
-          oldApplicationItem: $oldApplicationItem,
-          searchResult: $searchResult
-        })
-      }.padding({
-        left: Constants.AUTHORITY_TEXTINPUT_PADDING_LEFT,
-        right: Constants.AUTHORITY_TEXTINPUT_PADDING_RIGHT
-      })
-      Row() {
-        Flex({ alignItems:ItemAlign.Start, justifyContent: FlexAlign.Start }) {
-          Column() {
-            Flex({ justifyContent: FlexAlign.Start }) {
-              Text(this.permissionNum + '个应用获取此权限')
-                .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
-                .fontColor($r('app.color.secondary_font_color'))
-                .margin({ top: Constants.AUTHORITY_TEXT_MARGIN_TOP, left: Constants.AUTHORITY_TEXT_MARGIN_LEFT })
-            }
-            Scroll() {
-              Row() {
-                Column() {
-                  if (!this.applicationList.length) {
-                    if (this.searchResult) {
-                      Row() {
-                      }.margin({ top: Constants.AUTHORITY_ROW_MARGIN_TOP })
-                    } else {
-                      Row() {
-                        Flex({ justifyContent: FlexAlign.Center, alignItems: ItemAlign.Center }) {
-                          Image($r('app.media.searchnoresult'))
-                            .customizeImage(Constants.SEARCHNORESULT_IMAGE_WIDTH, Constants.SEARCHNORESULT_IMAGE_HEIGHT)
-                        }
-                      }.margin({ top: Constants.AUTHORITY_ROW_MARGIN_TOP })
-                    }
-                  } else {
-                    Row() {
-                      List() {
-                        ForEach(this.applicationList.slice(Constants.SLICE_START, this.applicationList.length - 1),
-                        (item) => {
-                          this.ListItemLayout(item, Constants.SLICE_START_INDEX)
-                        }, item => item.toString())
-                        ForEach(this.applicationList.slice(Constants.SLICE_END), (item, index) => {
-                          this.ListItemLayout(item, Constants.SLICE_END_INDEX)
-                        }, item => item.toString())
-                      }
-                      .backgroundColor($r('app.color.default_background_color'))
-                      .borderRadius(Constants.BORDER_RADIUS)
-                      .padding({ top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
-                    }.margin({ top: Constants.AUTHORITY_ROW_MARGIN_TOP })
-                  }
-                }.width(Constants.FULL_WIDTH)
-                .height(Constants.AUTHORITY_COLUMN_HEIGHT)
-              }
-            }
-          }.padding({ left: Constants.AUTHORITY_LISTITEM_PADDING_LEFT })
-          Column() {
-            alphabetIndexerComponent({ applicationItem: $applicationList, oldApplicationItem: $oldApplicationItem })
-          }.width(Constants.AUTHORITY_ALPHABETINDEX_WIDTH)
-           .padding({ top: Constants.AUTHORITY_ALPHABETINDEX_PADDING_TOP })
-        }
-      }
-    }
-  }
-}
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+import { backBar } from "../common/components/backBar";
+import { alphabetIndexerComponent } from "../common/components/alphabeticalIndex";
+import { textInput } from "../common/components/search";
+import router from '@system.router';
+import bundle from "@ohos.bundle";
+import Resmgr from '@ohos.resourceManager';
+import abilityAccessCtrl from '@ohos.abilityAccessCtrl';
+import { getAppLabel, getAppIcon, verifyAccessToken} from "../common/utils/utils";
+import { makePy } from "../common/utils/utils";
+import { authorizeDialog } from "../common/components/dialog";
+import Constants from '../common/utils/constant';
+
+var TAG = 'PermissionManager_MainAbility:'
+
+@Extend(Image) function customizeImage(width: number, height: number) {
+  .objectFit(ImageFit.Contain)
+  .width(width)
+  .height(height)
+}
+
+let routerData = router.getParams().routerData; // Routing jump data
+let backTitle = router.getParams().backTitle; // return title name
+let nowGrantResult = Constants.PERMISSION_NUM; // Authorization results now
+let nowRevokeResult = Constants.PERMISSION_NUM; // Now deauthorize results
+let GrantResultFlag = []; // Authorization result Flag
+let RevokeResultFlag = []; // Cancel authorization result Flag
+
+class ApplicationObj {
+  labelId: string
+  iconId: string
+  index: number
+  accessTokenId: number
+  permission: string
+  alphabeticalIndex: string
+  constructor(
+    labelId: string,
+    iconId: string,
+    index: number,
+    accessTokenId: number,
+    permission: string,
+    alphabeticalIndex: string) {
+    this.labelId = labelId
+    this.iconId = iconId
+    this.index = index
+    this.accessTokenId = accessTokenId
+    this.permission = permission
+    this.alphabeticalIndex = alphabeticalIndex
+  }
+} // application information
+
+@Entry
+@Component
+struct locationInfoPage {
+  build() {
+    GridContainer({ gutter: Constants.GUTTER, margin: Constants.GRID_MARGIN }) {
+      Row() {
+        Row()
+          .useSizeType({
+            xs: { span: Constants.LEFT_XS_SPAN, offset: Constants.LEFT_XS_OFFSET },
+            sm: { span: Constants.LEFT_SM_SPAN, offset: Constants.LEFT_SM_OFFSET },
+            md: { span: Constants.LEFT_MD_SPAN, offset: Constants.LEFT_MD_OFFSET },
+            lg: { span: Constants.LEFT_LG_SPAN, offset: Constants.LEFT_LG_OFFSET }
+          })
+          .height(Constants.FULL_HEIGHT)
+        Row() {
+          Column() {
+            Row() {
+              backBar({ title: JSON.stringify(backTitle), recordable: false })
+            }
+            Row() {
+              Column() {
+                applicationItem()
+
+              }.width(Constants.FULL_WIDTH)
+            }
+            .layoutWeight(Constants.LAYOUT_WEIGHT)
+          }
+        }
+        .useSizeType({
+          xs: { span: Constants.MIDDLE_XS_SPAN, offset: Constants.MIDDLE_XS_OFFSET },
+          sm: { span: Constants.MIDDLE_SM_SPAN, offset: Constants.MIDDLE_SM_OFFSET },
+          md: { span: Constants.MIDDLE_MD_SPAN, offset: Constants.MIDDLE_MD_OFFSET },
+          lg: { span: Constants.MIDDLE_LG_SPAN, offset: Constants.MIDDLE_LG_OFFSET }
+        })
+        .height(Constants.FULL_HEIGHT)
+        Row()
+          .useSizeType({
+            xs: { span: Constants.RIGHT_XS_SPAN, offset: Constants.RIGHT_XS_OFFSET },
+            sm: { span: Constants.RIGHT_SM_SPAN, offset: Constants.RIGHT_SM_OFFSET },
+            md: { span: Constants.RIGHT_MD_SPAN, offset: Constants.RIGHT_MD_OFFSET },
+            lg: { span: Constants.RIGHT_LG_SPAN, offset: Constants.RIGHT_LG_OFFSET }
+          })
+          .height(Constants.FULL_HEIGHT)
+      }
+      .height(Constants.FULL_HEIGHT)
+      .width(Constants.FULL_WIDTH)
+      .backgroundColor($r("sys.color.ohos_id_color_sub_background"))
+      .opacity(Constants.MANAGEMENT_TRANSPARENCY)
+    }
+  }
+}
+
+@Component
+struct applicationItem {
+  @State permissionNum: number = Constants.PERMISSION_NUM; // permission num
+  @State toggleIsOn: object = {}; // toggle switch state array
+  @State applicationList: ApplicationObj[] = []; // application info array
+  @State oldApplicationItem: ApplicationObj[] = []; // Original application information array
+  @State searchResult: boolean = true; // search results
+  @State placeholder: string = ''
+
+  authorizeDialogController: CustomDialogController = new CustomDialogController({
+    builder: authorizeDialog({ }),
+    autoCancel: true,
+    alignment: DialogAlignment.Center
+  });
+
+  @Builder ListItemLayout(item, index) {
+    ListItem() {
+      Row() {
+        Column() {
+          Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
+            Row() {
+              Image(item.iconId)
+                .customizeImage(Constants.AUTHORITY_IMAGE_WIDTH, Constants.AUTHORITY_IMAGE_HEIGHT)
+                .margin({ right: Constants.AUTHORITY_IMAGE_MARGIN_RIGHT })
+              Text(item.labelId)
+                .fontSize(Constants.TEXT_MIDDLE_FONT_SIZE)
+                .fontColor($r('app.color.text_color'))
+                .flexGrow(Constants.FLEX_GROW)
+              Toggle({ type: ToggleType.Switch, isOn: this.toggleIsOn[item.index] })
+                .selectedColor($r('app.color.toggle_color'))
+                .width(Constants.AUTHORITY_TOGGLE_WIDTH)
+                .height(Constants.AUTHORITY_TOGGLE_HEIGHT)
+                .onChange((isOn: boolean) => {
+                  if (item.accessTokenId === '' || item.permission === '') {
+                    return;
+                  }
+                  let _this = this;
+                  if (isOn) {
+                    let promises = routerData.map(it => new Promise((resolve, reject) => {
+                      _this.grantUserGrantedPermission(item.accessTokenId, it.permission, item.index, resolve);
+                    }));
+                    Promise.all(promises).then(function(results) {
+                      if(results.indexOf(-1) != -1) {
+                        _this.authorizeDialogController.open();
+                        _this.toggleIsOn[item.index] = false;
+                        setTimeout(()=> {
+                          _this.authorizeDialogController.close();
+                        }, Constants.DELAY_TIME)
+                      } else {
+                        _this.toggleIsOn[item.index] = true;
+                      }
+                      let num = Constants.PERMISSION_NUM;
+                      for(let key in _this.toggleIsOn){
+                        if(_this.toggleIsOn[key]){
+                          num++;
+                        }
+                      }
+                      _this.permissionNum = num;
+                    });
+                  } else {
+                    let promises = routerData.map(it => new Promise((resolve, reject) => {
+                      _this.revokeUserGrantedPermission(item.accessTokenId, it.permission, item.index, resolve);
+                    }));
+                    Promise.all(promises).then(function(results) {
+                      if(results.indexOf(-1) != -1) {
+                        _this.authorizeDialogController.open();
+                        _this.toggleIsOn[item.index] = true;
+                        setTimeout(()=> {
+                          _this.authorizeDialogController.close();
+                        }, Constants.DELAY_TIME)
+                      } else {
+                        _this.toggleIsOn[item.index] = false;
+                      }
+                      let num = Constants.PERMISSION_NUM;
+                      for(let key in _this.toggleIsOn){
+                        if(_this.toggleIsOn[key]){
+                          num++;
+                        }
+                      }
+                      _this.permissionNum = num;
+                    });
+                  }
+                })
+            }
+            .width(Constants.FULL_WIDTH)
+            .height(Constants.AUTHORITY_ROW_HEIGHT)
+            .constraintSize({ minHeight: Constants.AUTHORITY_CONSTRAINTSIZE_MINHEIGHT })
+          }
+          if (!index) {
+            Row() {
+              Flex() {
+                Column().width(Constants.APPLICATION_TEXT_DECORATION_MARGIN_LEFT)
+                Column()
+                  .backgroundColor($r('app.color.text_decoration_color'))
+                  .height(Constants.TEXT_DECORATION_HEIGHT)
+                  .flexGrow(Constants.FLEX_GROW)
+              }
+            }
+          }
+        }.onClick(() => {
+        })
+      }
+    }.padding({ left: Constants.DEFAULT_PADDING_START, right: Constants.DEFAULT_PADDING_END })
+  }
+
+  /**
+   * Grant permissions to the app
+   * @param {Number} accessTokenId
+   * @param {String} permission permission name
+   * @param {Number} index Array index to modify permission status
+   */
+  grantUserGrantedPermission(accessTokenId, permission, index, resolve) {
+    abilityAccessCtrl.createAtManager().grantUserGrantedPermission(
+      accessTokenId, permission, Constants.PERMISSION_FLAG).then(result => {
+      // result: 0 Authorization succeeded; result: -1 Authorization failed
+      resolve(result);
+    }).catch(error => {
+      resolve(-1);
+      console.error(TAG + 'abilityAccessCtrl.createAtManager.grantUserGrantedPermission failed. Cause: ' + JSON.stringify(error));
+    })
+  }
+
+  /**
+   * Deauthorize the app
+   * @param {Number} accessTokenId
+   * @param {String} permission permission name
+   * @param {Number} index Array index to modify permission status
+   */
+  revokeUserGrantedPermission(accessTokenId, permission, index, resolve) {
+    abilityAccessCtrl.createAtManager().revokeUserGrantedPermission(
+      accessTokenId, permission, Constants.PERMISSION_FLAG).then(result => {
+      // result: 0 successfully cancel the authorization; result: -1 cancel the authorization failed
+      resolve(result);
+    }).catch(error => {
+      resolve(-1);
+      console.error(TAG + 'abilityAccessCtrl.createAtManager.revokeUserGrantedPermission failed. Cause: ' + JSON.stringify(error));
+    })
+  }
+
+  /**
+   * Lifecycle function, executed when the page is initialized
+   */
+  aboutToAppear() {
+    var bundleNames = []
+    routerData.forEach(permissionmanager => {
+      permissionmanager.bundleNames.forEach( bundleName => {
+        if (bundleNames.indexOf(bundleName) == -1) {
+          bundleNames.push(bundleName)
+        }
+      })
+    })
+
+    Resmgr.getResourceManager(globalThis.context, Constants.BUNDLE_NAME).then(item => {
+      item.getString($r("app.string.textInput_placeholder").id, (err, val) => {
+        this.placeholder = val
+      })
+    })
+
+    // initial then fill values when sync return which may cause sync panic
+    for (let i = 0; i < bundleNames.length; i++) {
+      this.applicationList.push(
+        new ApplicationObj('', '', i, 0, '', ''));
+      this.oldApplicationItem.push(
+        new ApplicationObj('', '', i, 0, '', ''));
+    }
+
+    for (let i = 0; i < bundleNames.length; i++) {
+      // Get BundleInfo based on bundle name
+      bundle.getBundleInfo(bundleNames[i], Constants.PARMETER_BUNDLE_FLAG).then(res => {
+        Promise.all([getAppLabel(res.appInfo.labelId, res.name),
+        getAppIcon(res.appInfo.iconId, res.name)
+        ])
+          .then((values) => {
+            this.applicationList[i] = (
+              new ApplicationObj(
+              String(values[0]),
+              String(values[1]),
+                i,
+                res.appInfo.accessTokenId,
+                routerData[0].permission,
+              makePy(values[0])[0].slice(0, 1)) // Get the first letter in the returned initials array
+            );
+            this.oldApplicationItem[i] = (
+              new ApplicationObj(
+              String(values[0]),
+              String(values[1]),
+                i,
+                res.appInfo.accessTokenId,
+                routerData[0].permission,
+              makePy(values[0])[0].slice(0, 1)) // Get the first letter in the returned initials array
+            );
+          });
+        // 0: have permission; -1: no permission
+        var boole = true;
+        this.permissionNum++;
+        for (let j = 0; j < routerData.length; j++) {
+          if (res.reqPermissions.indexOf(routerData[j].permission) == -1) {
+            continue
+          }
+          verifyAccessToken(res.appInfo.accessTokenId, routerData[j].permission).then((access) => {
+            if (Number(access) === Constants.PERMISSION_INDEX) {
+              if(boole){
+                this.toggleIsOn[i] = true;
+              }
+            } else {
+              if(boole){
+                this.permissionNum--
+              }
+              boole = false;
+              this.toggleIsOn[i] = false;
+            }
+          });
+        }
+      }).catch(error => {
+        console.log(TAG + bundleNames[i] + "getBundleInfo failed, cause: " + JSON.stringify(error));
+      })
+    }
+  }
+
+  build() {
+    Column() {
+      Row() {
+        textInput({
+          placeholder: this.placeholder,
+          applicationItem: $applicationList,
+          oldApplicationItem: $oldApplicationItem,
+          searchResult: $searchResult
+        })
+      }.padding({
+        left: Constants.AUTHORITY_TEXTINPUT_PADDING_LEFT,
+        right: Constants.AUTHORITY_TEXTINPUT_PADDING_RIGHT
+      })
+      Row() {
+        Flex({ alignItems:ItemAlign.Start, justifyContent: FlexAlign.Start }) {
+          Column() {
+            Flex({ justifyContent: FlexAlign.Start }) {
+              Text(this.permissionNum + '个应用获取此权限')
+                .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
+                .fontColor($r('app.color.secondary_font_color'))
+                .margin({ top: Constants.AUTHORITY_TEXT_MARGIN_TOP, left: Constants.AUTHORITY_TEXT_MARGIN_LEFT })
+            }
+            Scroll() {
+              Row() {
+                Column() {
+                  if (!this.applicationList.length) {
+                    if (this.searchResult) {
+                      Row() {
+                      }.margin({ top: Constants.AUTHORITY_ROW_MARGIN_TOP })
+                    } else {
+                      Row() {
+                        Flex({ justifyContent: FlexAlign.Center, alignItems: ItemAlign.Center }) {
+                          Image($r('app.media.searchnoresult'))
+                            .customizeImage(Constants.SEARCHNORESULT_IMAGE_WIDTH, Constants.SEARCHNORESULT_IMAGE_HEIGHT)
+                        }
+                      }.margin({ top: Constants.AUTHORITY_ROW_MARGIN_TOP })
+                    }
+                  } else {
+                    Row() {
+                      List() {
+                        ForEach(this.applicationList.slice(Constants.SLICE_START, this.applicationList.length - 1),
+                        (item) => {
+                          this.ListItemLayout(item, Constants.SLICE_START_INDEX)
+                        }, item => item.toString())
+                        ForEach(this.applicationList.slice(Constants.SLICE_END), (item, index) => {
+                          this.ListItemLayout(item, Constants.SLICE_END_INDEX)
+                        }, item => item.toString())
+                      }
+                      .backgroundColor($r('app.color.default_background_color'))
+                      .borderRadius(Constants.BORDER_RADIUS)
+                      .padding({ top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
+                    }.margin({ top: Constants.AUTHORITY_ROW_MARGIN_TOP })
+                  }
+                }.width(Constants.FULL_WIDTH)
+                .height(Constants.AUTHORITY_COLUMN_HEIGHT)
+              }
+            }
+          }.padding({ left: Constants.AUTHORITY_LISTITEM_PADDING_LEFT })
+          Column() {
+            alphabetIndexerComponent({ applicationItem: $applicationList, oldApplicationItem: $oldApplicationItem })
+          }.width(Constants.AUTHORITY_ALPHABETINDEX_WIDTH)
+           .padding({ top: Constants.AUTHORITY_ALPHABETINDEX_PADDING_TOP })
+        }
+      }
+    }
+  }
+}
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/authority-tertiary.ets b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/authority-tertiary.ets
index 040934f2f1e43bbf73319726c379dbc818b4097c..38dcd5b8a6521f4e19b6937ce5b035183d39bd80 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/authority-tertiary.ets
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/authority-tertiary.ets
@@ -1,363 +1,363 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-import { backBar } from "../common/components/backBar";
-import { alphabetIndexerComponent } from "../common/components/alphabeticalIndex";
-import { textInput } from "../common/components/search";
-import router from '@system.router';
-import bundle from "@ohos.bundle";
-import Resmgr from '@ohos.resourceManager';
-import abilityAccessCtrl from '@ohos.abilityAccessCtrl';
-import { getAppLabel, getAppIcon, verifyAccessToken } from "../common/utils/utils";
-import { makePy } from "../common/utils/utils";
-import { authorizeDialog } from "../common/components/dialog";
-import Constants from '../common/utils/constant';
-
-var TAG = 'PermissionManager_MainAbility:'
-
-@Extend(Image) function customizeImage(width: number, height: number) {
-  .objectFit(ImageFit.Contain)
-  .width(width)
-  .height(height)
-}
-
-let routerData = router.getParams().routerData; // Routing jump data
-let backTitle = router.getParams().backTitle; // return title name
-class ApplicationObj {
-  labelId: string
-  iconId: string
-  index: number
-  accessTokenId: number
-  permission: string
-  alphabeticalIndex: string
-  constructor(
-    labelId: string,
-    iconId: string,
-    index: number,
-    accessTokenId: number,
-    permission: string,
-    alphabeticalIndex: string) {
-    this.labelId = labelId
-    this.iconId = iconId
-    this.index = index
-    this.accessTokenId = accessTokenId
-    this.permission = permission
-    this.alphabeticalIndex = alphabeticalIndex
-  }
-} // application information
-
-@Entry
-@Component
-struct locationInfoPage {
-  build() {
-    GridContainer({ gutter: Constants.GUTTER, margin: Constants.GRID_MARGIN }) {
-      Row() {
-        Row()
-          .useSizeType({
-            xs: { span: Constants.LEFT_XS_SPAN, offset: Constants.LEFT_XS_OFFSET },
-            sm: { span: Constants.LEFT_SM_SPAN, offset: Constants.LEFT_SM_OFFSET },
-            md: { span: Constants.LEFT_MD_SPAN, offset: Constants.LEFT_MD_OFFSET },
-            lg: { span: Constants.LEFT_LG_SPAN, offset: Constants.LEFT_LG_OFFSET }
-          })
-          .height(Constants.FULL_HEIGHT)
-        Row() {
-          Column() {
-            Row() {
-              backBar({ title: JSON.stringify(backTitle), recordable: false })
-            }
-            Row() {
-              Column() {
-                applicationItem()
-
-              }.width(Constants.FULL_WIDTH)
-            }
-            .layoutWeight(Constants.LAYOUT_WEIGHT)
-          }
-        }
-        .useSizeType({
-          xs: { span: Constants.MIDDLE_XS_SPAN, offset: Constants.MIDDLE_XS_OFFSET },
-          sm: { span: Constants.MIDDLE_SM_SPAN, offset: Constants.MIDDLE_SM_OFFSET },
-          md: { span: Constants.MIDDLE_MD_SPAN, offset: Constants.MIDDLE_MD_OFFSET },
-          lg: { span: Constants.MIDDLE_LG_SPAN, offset: Constants.MIDDLE_LG_OFFSET }
-        })
-        .height(Constants.FULL_HEIGHT)
-        Row()
-          .useSizeType({
-            xs: { span: Constants.RIGHT_XS_SPAN, offset: Constants.RIGHT_XS_OFFSET },
-            sm: { span: Constants.RIGHT_SM_SPAN, offset: Constants.RIGHT_SM_OFFSET },
-            md: { span: Constants.RIGHT_MD_SPAN, offset: Constants.RIGHT_MD_OFFSET },
-            lg: { span: Constants.RIGHT_LG_SPAN, offset: Constants.RIGHT_LG_OFFSET }
-          })
-          .height(Constants.FULL_HEIGHT)
-      }
-      .height(Constants.FULL_HEIGHT)
-      .width(Constants.FULL_WIDTH)
-      .backgroundColor($r("sys.color.ohos_id_color_sub_background"))
-      .opacity(Constants.MANAGEMENT_TRANSPARENCY)
-    }
-  }
-}
-
-@Component
-struct applicationItem {
-  @State permissionNum: number = Constants.PERMISSION_NUM; // permission num
-  @State toggleIsOn: object = {}; // toggle switch state array
-  @State applicationList: ApplicationObj[] = []; // application info array
-  @State oldApplicationItem: ApplicationObj[] = []; // Original application information array
-  @State searchResult: boolean = true; // search results
-  @State placeholder: string = ''
-
-  authorizeDialogController: CustomDialogController = new CustomDialogController({
-    builder: authorizeDialog({ }),
-    autoCancel: true,
-    alignment: DialogAlignment.Center
-  });
-
-  @Builder ListItemLayout(item, index) {
-    ListItem() {
-      Row() {
-        Column() {
-          Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
-            Row() {
-              Image(item.iconId)
-                .customizeImage(Constants.AUTHORITY_IMAGE_WIDTH, Constants.AUTHORITY_IMAGE_HEIGHT)
-                .margin({ right: Constants.AUTHORITY_IMAGE_MARGIN_RIGHT })
-              Text(item.labelId)
-                .fontSize(Constants.TEXT_MIDDLE_FONT_SIZE)
-                .fontWeight(FontWeight.Medium)
-                .fontColor($r('app.color.label_color'))
-                .flexGrow(Constants.FLEX_GROW)
-              Toggle({ type: ToggleType.Switch, isOn: this.toggleIsOn[item.index] })
-                .selectedColor($r('app.color.toggle_color'))
-                .width(Constants.AUTHORITY_TOGGLE_WIDTH)
-                .height(Constants.AUTHORITY_TOGGLE_HEIGHT)
-                .onChange((isOn: boolean) => {
-                  if (item.accessTokenId === '' || item.permission === '') {
-                    return;
-                  }
-                  if (isOn) {
-                    this.grantUserGrantedPermission(item.accessTokenId, item.permission, item.index);
-                  } else {
-                    this.revokeUserGrantedPermission(item.accessTokenId, item.permission, item.index);
-                  }
-                })
-            }
-            .width(Constants.FULL_WIDTH)
-            .height(Constants.AUTHORITY_ROW_HEIGHT)
-            .constraintSize({ minHeight: Constants.AUTHORITY_CONSTRAINTSIZE_MINHEIGHT })
-          }
-          if (!index) {
-            Row() {
-              Flex() {
-                Column().width(Constants.APPLICATION_TEXT_DECORATION_MARGIN_LEFT)
-                Column()
-                  .backgroundColor($r('app.color.text_decoration_color'))
-                  .height(Constants.TEXT_DECORATION_HEIGHT)
-                  .flexGrow(Constants.FLEX_GROW)
-              }
-            }
-          }
-        }.onClick(() => {
-        })
-      }
-    }.padding({ left: Constants.DEFAULT_PADDING_START, right: Constants.DEFAULT_PADDING_END })
-  }
-
-  /**
-   * Grant permissions to the app
-   * @param {Number} accessTokenId
-   * @param {String} permission permission name
-   * @param {Number} index Array index to modify permission status
-   */
-  grantUserGrantedPermission(accessTokenId, permission, index) {
-    abilityAccessCtrl.createAtManager().grantUserGrantedPermission(
-      accessTokenId, permission, Constants.PERMISSION_FLAG).then(result => {
-      // result: 0 Authorization succeeded; result: -1 Authorization failed
-      if (result !== Constants.PERMISSION_INDEX) {
-        this.authorizeDialogController.open();
-        this.toggleIsOn[index] = false;
-        setTimeout(()=> {
-          this.authorizeDialogController.close();
-        }, Constants.DELAY_TIME)
-      } else {
-        this.toggleIsOn[index] = true;
-      }
-      let num = Constants.PERMISSION_NUM;
-      for(let key in this.toggleIsOn){
-        if(this.toggleIsOn[key]){
-          num++;
-        }
-      }
-      this.permissionNum = num;
-    }).catch(error => {
-      console.error(TAG + 'abilityAccessCtrl.createAtManager.grantUserGrantedPermission failed. Cause: ' + JSON.stringify(error));
-    })
-  }
-
-  /**
-   * Deauthorize the app
-   * @param {Number} accessTokenId
-   * @param {String} permission permission name
-   * @param {Number} index Array index to modify permission status
-   */
-  revokeUserGrantedPermission(accessTokenId, permission, index) {
-    abilityAccessCtrl.createAtManager().revokeUserGrantedPermission(
-      accessTokenId, permission, Constants.PERMISSION_FLAG).then(result => {
-      // result: 0 successfully cancel the authorization; result: -1 cancel the authorization failed
-      if (result !== Constants.PERMISSION_INDEX) {
-        this.authorizeDialogController.open();
-        this.toggleIsOn[index] = true;
-        setTimeout(()=> {
-          this.authorizeDialogController.close();
-        }, Constants.DELAY_TIME)
-      } else {
-        this.toggleIsOn[index] = false;
-      }
-      let num = Constants.PERMISSION_NUM;
-      for(let key in this.toggleIsOn){
-        if(this.toggleIsOn[key]){
-          num++;
-        }
-      }
-      this.permissionNum = num;
-    })
-  }
-
-  /**
-   * Lifecycle function, executed when the page is initialized
-   */
-  aboutToAppear() {
-    let bundleNames = routerData[0].bundleNames;
-
-    Resmgr.getResourceManager(globalThis.context, Constants.BUNDLE_NAME).then(item => {
-      item.getString($r("app.string.textInput_placeholder").id, (err, val) => {
-        this.placeholder = val
-      })
-    })
-
-    // initial then fill values when sync return which may cause sync panic
-    for (let i = 0; i < bundleNames.length; i++) {
-      this.applicationList.push(
-        new ApplicationObj('', '', i, 0, '', ''));
-      this.oldApplicationItem.push(
-        new ApplicationObj('', '', i, 0, '', ''));
-    }
-
-    for (let i = 0; i < bundleNames.length; i++) {
-      // Get BundleInfo based on bundle name
-      bundle.getBundleInfo(bundleNames[i], Constants.PARMETER_BUNDLE_FLAG).then(res => {
-        Promise.all([getAppLabel(res.appInfo.labelId, res.name),
-          getAppIcon(res.appInfo.iconId, res.name),
-          verifyAccessToken(res.appInfo.accessTokenId, routerData[0].permission)])
-          .then((values) => {
-          this.applicationList[i] = (
-            new ApplicationObj(
-              String(values[0]),
-              String(values[1]),
-              i,
-              res.appInfo.accessTokenId,
-              routerData[0].permission,
-              makePy(values[0])[0].slice(0, 1)) // Get the first letter in the returned initials array
-          );
-          this.oldApplicationItem[i] = (
-            new ApplicationObj(
-              String(values[0]),
-              String(values[1]),
-              i,
-              res.appInfo.accessTokenId,
-              routerData[0].permission,
-              makePy(values[0])[0].slice(0, 1)) // Get the first letter in the returned initials array
-          );
-          // 0: have permission; -1: no permission
-          if (values[2] === Constants.PERMISSION_INDEX) {
-            this.toggleIsOn[i] = true;
-            this.permissionNum++;
-          } else {
-            this.toggleIsOn[i] = false;
-          }
-          });
-      }).catch(error => {
-        console.log(TAG + bundleNames[i] + "getBundleInfo failed, cause: " + JSON.stringify(error));
-      })
-    }
-  }
-
-  build() {
-    Column() {
-      Row() {
-        textInput({
-          placeholder: this.placeholder,
-          applicationItem: $applicationList,
-          oldApplicationItem: $oldApplicationItem,
-          searchResult: $searchResult
-        })
-      }.padding({
-        left: Constants.AUTHORITY_TEXTINPUT_PADDING_LEFT,
-        right: Constants.AUTHORITY_TEXTINPUT_PADDING_RIGHT
-      })
-      Row() {
-        Flex({ alignItems:ItemAlign.Start, justifyContent: FlexAlign.Start }) {
-          Column() {
-            Flex({ justifyContent: FlexAlign.Start }) {
-              Text(this.permissionNum + '个应用获取此权限')
-                .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
-                .fontColor($r('app.color.secondary_font_color'))
-                .margin({ top: Constants.AUTHORITY_TEXT_MARGIN_TOP, left: Constants.AUTHORITY_TEXT_MARGIN_LEFT })
-            }
-            Scroll() {
-              Row() {
-                Column() {
-                  if (!this.applicationList.length) {
-                    if (this.searchResult) {
-                      Row() {
-                      }.margin({ top: Constants.AUTHORITY_ROW_MARGIN_TOP })
-                    } else {
-                      Row() {
-                        Flex({ justifyContent: FlexAlign.Center, alignItems: ItemAlign.Center }) {
-                          Image($r('app.media.searchnoresult'))
-                            .customizeImage(Constants.SEARCHNORESULT_IMAGE_WIDTH, Constants.SEARCHNORESULT_IMAGE_HEIGHT)
-                        }
-                      }.margin({ top: Constants.AUTHORITY_ROW_MARGIN_TOP })
-                    }
-                  } else {
-                    Row() {
-                      List() {
-                        ForEach(this.applicationList.slice(Constants.SLICE_START, this.applicationList.length - 1),
-                        (item) => {
-                          this.ListItemLayout(item, Constants.SLICE_START_INDEX)
-                        }, item => item.toString())
-                        ForEach(this.applicationList.slice(Constants.SLICE_END), (item, index) => {
-                          this.ListItemLayout(item, Constants.SLICE_END_INDEX)
-                        }, item => item.toString())
-                      }
-                      .backgroundColor($r('app.color.default_background_color'))
-                      .borderRadius(Constants.BORDER_RADIUS)
-                      .padding({ top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
-                    }.margin({ top: Constants.AUTHORITY_ROW_MARGIN_TOP })
-                  }
-                }.width(Constants.FULL_WIDTH)
-                .height(Constants.AUTHORITY_COLUMN_HEIGHT)
-              }
-            }
-          }.padding({ left: Constants.AUTHORITY_LISTITEM_PADDING_LEFT })
-          Column() {
-            alphabetIndexerComponent({ applicationItem: $applicationList, oldApplicationItem: $oldApplicationItem })
-          }.width(Constants.AUTHORITY_ALPHABETINDEX_WIDTH)
-           .padding({ top: Constants.AUTHORITY_ALPHABETINDEX_PADDING_TOP })
-        }
-      }
-    }
-  }
-}
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+import { backBar } from "../common/components/backBar";
+import { alphabetIndexerComponent } from "../common/components/alphabeticalIndex";
+import { textInput } from "../common/components/search";
+import router from '@system.router';
+import bundle from "@ohos.bundle";
+import Resmgr from '@ohos.resourceManager';
+import abilityAccessCtrl from '@ohos.abilityAccessCtrl';
+import { getAppLabel, getAppIcon, verifyAccessToken } from "../common/utils/utils";
+import { makePy } from "../common/utils/utils";
+import { authorizeDialog } from "../common/components/dialog";
+import Constants from '../common/utils/constant';
+
+var TAG = 'PermissionManager_MainAbility:'
+
+@Extend(Image) function customizeImage(width: number, height: number) {
+  .objectFit(ImageFit.Contain)
+  .width(width)
+  .height(height)
+}
+
+let routerData = router.getParams().routerData; // Routing jump data
+let backTitle = router.getParams().backTitle; // return title name
+class ApplicationObj {
+  labelId: string
+  iconId: string
+  index: number
+  accessTokenId: number
+  permission: string
+  alphabeticalIndex: string
+  constructor(
+    labelId: string,
+    iconId: string,
+    index: number,
+    accessTokenId: number,
+    permission: string,
+    alphabeticalIndex: string) {
+    this.labelId = labelId
+    this.iconId = iconId
+    this.index = index
+    this.accessTokenId = accessTokenId
+    this.permission = permission
+    this.alphabeticalIndex = alphabeticalIndex
+  }
+} // application information
+
+@Entry
+@Component
+struct locationInfoPage {
+  build() {
+    GridContainer({ gutter: Constants.GUTTER, margin: Constants.GRID_MARGIN }) {
+      Row() {
+        Row()
+          .useSizeType({
+            xs: { span: Constants.LEFT_XS_SPAN, offset: Constants.LEFT_XS_OFFSET },
+            sm: { span: Constants.LEFT_SM_SPAN, offset: Constants.LEFT_SM_OFFSET },
+            md: { span: Constants.LEFT_MD_SPAN, offset: Constants.LEFT_MD_OFFSET },
+            lg: { span: Constants.LEFT_LG_SPAN, offset: Constants.LEFT_LG_OFFSET }
+          })
+          .height(Constants.FULL_HEIGHT)
+        Row() {
+          Column() {
+            Row() {
+              backBar({ title: JSON.stringify(backTitle), recordable: false })
+            }
+            Row() {
+              Column() {
+                applicationItem()
+
+              }.width(Constants.FULL_WIDTH)
+            }
+            .layoutWeight(Constants.LAYOUT_WEIGHT)
+          }
+        }
+        .useSizeType({
+          xs: { span: Constants.MIDDLE_XS_SPAN, offset: Constants.MIDDLE_XS_OFFSET },
+          sm: { span: Constants.MIDDLE_SM_SPAN, offset: Constants.MIDDLE_SM_OFFSET },
+          md: { span: Constants.MIDDLE_MD_SPAN, offset: Constants.MIDDLE_MD_OFFSET },
+          lg: { span: Constants.MIDDLE_LG_SPAN, offset: Constants.MIDDLE_LG_OFFSET }
+        })
+        .height(Constants.FULL_HEIGHT)
+        Row()
+          .useSizeType({
+            xs: { span: Constants.RIGHT_XS_SPAN, offset: Constants.RIGHT_XS_OFFSET },
+            sm: { span: Constants.RIGHT_SM_SPAN, offset: Constants.RIGHT_SM_OFFSET },
+            md: { span: Constants.RIGHT_MD_SPAN, offset: Constants.RIGHT_MD_OFFSET },
+            lg: { span: Constants.RIGHT_LG_SPAN, offset: Constants.RIGHT_LG_OFFSET }
+          })
+          .height(Constants.FULL_HEIGHT)
+      }
+      .height(Constants.FULL_HEIGHT)
+      .width(Constants.FULL_WIDTH)
+      .backgroundColor($r("sys.color.ohos_id_color_sub_background"))
+      .opacity(Constants.MANAGEMENT_TRANSPARENCY)
+    }
+  }
+}
+
+@Component
+struct applicationItem {
+  @State permissionNum: number = Constants.PERMISSION_NUM; // permission num
+  @State toggleIsOn: object = {}; // toggle switch state array
+  @State applicationList: ApplicationObj[] = []; // application info array
+  @State oldApplicationItem: ApplicationObj[] = []; // Original application information array
+  @State searchResult: boolean = true; // search results
+  @State placeholder: string = ''
+
+  authorizeDialogController: CustomDialogController = new CustomDialogController({
+    builder: authorizeDialog({ }),
+    autoCancel: true,
+    alignment: DialogAlignment.Center
+  });
+
+  @Builder ListItemLayout(item, index) {
+    ListItem() {
+      Row() {
+        Column() {
+          Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
+            Row() {
+              Image(item.iconId)
+                .customizeImage(Constants.AUTHORITY_IMAGE_WIDTH, Constants.AUTHORITY_IMAGE_HEIGHT)
+                .margin({ right: Constants.AUTHORITY_IMAGE_MARGIN_RIGHT })
+              Text(item.labelId)
+                .fontSize(Constants.TEXT_MIDDLE_FONT_SIZE)
+                .fontWeight(FontWeight.Medium)
+                .fontColor($r('app.color.label_color'))
+                .flexGrow(Constants.FLEX_GROW)
+              Toggle({ type: ToggleType.Switch, isOn: this.toggleIsOn[item.index] })
+                .selectedColor($r('app.color.toggle_color'))
+                .width(Constants.AUTHORITY_TOGGLE_WIDTH)
+                .height(Constants.AUTHORITY_TOGGLE_HEIGHT)
+                .onChange((isOn: boolean) => {
+                  if (item.accessTokenId === '' || item.permission === '') {
+                    return;
+                  }
+                  if (isOn) {
+                    this.grantUserGrantedPermission(item.accessTokenId, item.permission, item.index);
+                  } else {
+                    this.revokeUserGrantedPermission(item.accessTokenId, item.permission, item.index);
+                  }
+                })
+            }
+            .width(Constants.FULL_WIDTH)
+            .height(Constants.AUTHORITY_ROW_HEIGHT)
+            .constraintSize({ minHeight: Constants.AUTHORITY_CONSTRAINTSIZE_MINHEIGHT })
+          }
+          if (!index) {
+            Row() {
+              Flex() {
+                Column().width(Constants.APPLICATION_TEXT_DECORATION_MARGIN_LEFT)
+                Column()
+                  .backgroundColor($r('app.color.text_decoration_color'))
+                  .height(Constants.TEXT_DECORATION_HEIGHT)
+                  .flexGrow(Constants.FLEX_GROW)
+              }
+            }
+          }
+        }.onClick(() => {
+        })
+      }
+    }.padding({ left: Constants.DEFAULT_PADDING_START, right: Constants.DEFAULT_PADDING_END })
+  }
+
+  /**
+   * Grant permissions to the app
+   * @param {Number} accessTokenId
+   * @param {String} permission permission name
+   * @param {Number} index Array index to modify permission status
+   */
+  grantUserGrantedPermission(accessTokenId, permission, index) {
+    abilityAccessCtrl.createAtManager().grantUserGrantedPermission(
+      accessTokenId, permission, Constants.PERMISSION_FLAG).then(result => {
+      // result: 0 Authorization succeeded; result: -1 Authorization failed
+      if (result !== Constants.PERMISSION_INDEX) {
+        this.authorizeDialogController.open();
+        this.toggleIsOn[index] = false;
+        setTimeout(()=> {
+          this.authorizeDialogController.close();
+        }, Constants.DELAY_TIME)
+      } else {
+        this.toggleIsOn[index] = true;
+      }
+      let num = Constants.PERMISSION_NUM;
+      for(let key in this.toggleIsOn){
+        if(this.toggleIsOn[key]){
+          num++;
+        }
+      }
+      this.permissionNum = num;
+    }).catch(error => {
+      console.error(TAG + 'abilityAccessCtrl.createAtManager.grantUserGrantedPermission failed. Cause: ' + JSON.stringify(error));
+    })
+  }
+
+  /**
+   * Deauthorize the app
+   * @param {Number} accessTokenId
+   * @param {String} permission permission name
+   * @param {Number} index Array index to modify permission status
+   */
+  revokeUserGrantedPermission(accessTokenId, permission, index) {
+    abilityAccessCtrl.createAtManager().revokeUserGrantedPermission(
+      accessTokenId, permission, Constants.PERMISSION_FLAG).then(result => {
+      // result: 0 successfully cancel the authorization; result: -1 cancel the authorization failed
+      if (result !== Constants.PERMISSION_INDEX) {
+        this.authorizeDialogController.open();
+        this.toggleIsOn[index] = true;
+        setTimeout(()=> {
+          this.authorizeDialogController.close();
+        }, Constants.DELAY_TIME)
+      } else {
+        this.toggleIsOn[index] = false;
+      }
+      let num = Constants.PERMISSION_NUM;
+      for(let key in this.toggleIsOn){
+        if(this.toggleIsOn[key]){
+          num++;
+        }
+      }
+      this.permissionNum = num;
+    })
+  }
+
+  /**
+   * Lifecycle function, executed when the page is initialized
+   */
+  aboutToAppear() {
+    let bundleNames = routerData[0].bundleNames;
+
+    Resmgr.getResourceManager(globalThis.context, Constants.BUNDLE_NAME).then(item => {
+      item.getString($r("app.string.textInput_placeholder").id, (err, val) => {
+        this.placeholder = val
+      })
+    })
+
+    // initial then fill values when sync return which may cause sync panic
+    for (let i = 0; i < bundleNames.length; i++) {
+      this.applicationList.push(
+        new ApplicationObj('', '', i, 0, '', ''));
+      this.oldApplicationItem.push(
+        new ApplicationObj('', '', i, 0, '', ''));
+    }
+
+    for (let i = 0; i < bundleNames.length; i++) {
+      // Get BundleInfo based on bundle name
+      bundle.getBundleInfo(bundleNames[i], Constants.PARMETER_BUNDLE_FLAG).then(res => {
+        Promise.all([getAppLabel(res.appInfo.labelId, res.name),
+          getAppIcon(res.appInfo.iconId, res.name),
+          verifyAccessToken(res.appInfo.accessTokenId, routerData[0].permission)])
+          .then((values) => {
+          this.applicationList[i] = (
+            new ApplicationObj(
+              String(values[0]),
+              String(values[1]),
+              i,
+              res.appInfo.accessTokenId,
+              routerData[0].permission,
+              makePy(values[0])[0].slice(0, 1)) // Get the first letter in the returned initials array
+          );
+          this.oldApplicationItem[i] = (
+            new ApplicationObj(
+              String(values[0]),
+              String(values[1]),
+              i,
+              res.appInfo.accessTokenId,
+              routerData[0].permission,
+              makePy(values[0])[0].slice(0, 1)) // Get the first letter in the returned initials array
+          );
+          // 0: have permission; -1: no permission
+          if (values[2] === Constants.PERMISSION_INDEX) {
+            this.toggleIsOn[i] = true;
+            this.permissionNum++;
+          } else {
+            this.toggleIsOn[i] = false;
+          }
+          });
+      }).catch(error => {
+        console.log(TAG + bundleNames[i] + "getBundleInfo failed, cause: " + JSON.stringify(error));
+      })
+    }
+  }
+
+  build() {
+    Column() {
+      Row() {
+        textInput({
+          placeholder: this.placeholder,
+          applicationItem: $applicationList,
+          oldApplicationItem: $oldApplicationItem,
+          searchResult: $searchResult
+        })
+      }.padding({
+        left: Constants.AUTHORITY_TEXTINPUT_PADDING_LEFT,
+        right: Constants.AUTHORITY_TEXTINPUT_PADDING_RIGHT
+      })
+      Row() {
+        Flex({ alignItems:ItemAlign.Start, justifyContent: FlexAlign.Start }) {
+          Column() {
+            Flex({ justifyContent: FlexAlign.Start }) {
+              Text(this.permissionNum + '个应用获取此权限')
+                .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
+                .fontColor($r('app.color.secondary_font_color'))
+                .margin({ top: Constants.AUTHORITY_TEXT_MARGIN_TOP, left: Constants.AUTHORITY_TEXT_MARGIN_LEFT })
+            }
+            Scroll() {
+              Row() {
+                Column() {
+                  if (!this.applicationList.length) {
+                    if (this.searchResult) {
+                      Row() {
+                      }.margin({ top: Constants.AUTHORITY_ROW_MARGIN_TOP })
+                    } else {
+                      Row() {
+                        Flex({ justifyContent: FlexAlign.Center, alignItems: ItemAlign.Center }) {
+                          Image($r('app.media.searchnoresult'))
+                            .customizeImage(Constants.SEARCHNORESULT_IMAGE_WIDTH, Constants.SEARCHNORESULT_IMAGE_HEIGHT)
+                        }
+                      }.margin({ top: Constants.AUTHORITY_ROW_MARGIN_TOP })
+                    }
+                  } else {
+                    Row() {
+                      List() {
+                        ForEach(this.applicationList.slice(Constants.SLICE_START, this.applicationList.length - 1),
+                        (item) => {
+                          this.ListItemLayout(item, Constants.SLICE_START_INDEX)
+                        }, item => item.toString())
+                        ForEach(this.applicationList.slice(Constants.SLICE_END), (item, index) => {
+                          this.ListItemLayout(item, Constants.SLICE_END_INDEX)
+                        }, item => item.toString())
+                      }
+                      .backgroundColor($r('app.color.default_background_color'))
+                      .borderRadius(Constants.BORDER_RADIUS)
+                      .padding({ top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
+                    }.margin({ top: Constants.AUTHORITY_ROW_MARGIN_TOP })
+                  }
+                }.width(Constants.FULL_WIDTH)
+                .height(Constants.AUTHORITY_COLUMN_HEIGHT)
+              }
+            }
+          }.padding({ left: Constants.AUTHORITY_LISTITEM_PADDING_LEFT })
+          Column() {
+            alphabetIndexerComponent({ applicationItem: $applicationList, oldApplicationItem: $oldApplicationItem })
+          }.width(Constants.AUTHORITY_ALPHABETINDEX_WIDTH)
+           .padding({ top: Constants.AUTHORITY_ALPHABETINDEX_PADDING_TOP })
+        }
+      }
+    }
+  }
+}
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/dialogPlus.ets b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/dialogPlus.ets
index a56068a7223ded5d18965f4530906d85fbd97424..a57f2a437cd248c1e35baac39787570e34404d45 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/dialogPlus.ets
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/dialogPlus.ets
@@ -1,344 +1,344 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-import abilityAccessCtrl from '@ohos.abilityAccessCtrl';
-import bundle from '@ohos.bundle';
-import Resmgr from '@ohos.resourceManager'
-import rpc from '@ohos.rpc';
-import { Log, getPermissionGroup } from '../common/utils/utils'
-import Constants from '../common/utils/constant'
-import { BundleFlag } from '../common/model/bundle'
-import { permissionGroups, showSubpermissionsGrop } from '../common/model/permissionGroup'
-
-@Extend(Button) function customizeButton() {
-  .backgroundColor($r('app.color.default_background_color'))
-  .fontColor($r('app.color.button_color'))
-  .fontWeight(FontWeight.Medium)
-  .height(Constants.BUTTON_HEIGHT)
-  .width(Constants.BUTTON_WIDTH)
-}
-
-@Entry
-@Component
-struct dialogPlusPage {
-  @State count: number = 0
-  @State result: Array<any> = []
-  @State accessTokenId: number = 0
-  @State initStatus: number = Constants.INIT_NEED_TO_WAIT
-  @State reqPerms: Array<string> = []
-  @State grantGroups: Array<any> = []
-  @State userFixedFlag: number = 2 // means user fixed
-  @State appName: string = ""
-  @State win: any = ""
-  @State proxy: any = ''
-
-  build() {
-    Flex({ justifyContent: FlexAlign.Center, alignItems: ItemAlign.Center }) {
-      Column() {
-        if ((this.initStatus != Constants.INIT_NEED_TO_WAIT) && this.verify()) {
-          Image(this.grantGroups[this.count].icon)
-            .width(Constants.DIALOG_ICON_WIDTH)
-            .height(Constants.DIALOG_ICON_HEIGHT)
-            .fillColor($r("app.color.first_font_color"))
-            .margin({
-              top: Constants.DIALOG_ICON_MARGIN_TOP
-            })
-          Text(`${this.count + 1} / ${this.grantGroups.length}`)
-            .fontSize(Constants.DIALOG_LABEL_FONT_SIZE)
-            .fontColor($r('app.color.text_secondary_color'))
-            .lineHeight(Constants.DIALOG_LABEL_LINE_HEIGHT)
-            .margin({
-              top: Constants.DIALOG_LABEL_MARGIN_TOP
-            })
-          Column() {
-            Row() {
-              Flex({ justifyContent: FlexAlign.Start }) {
-                Text("是否允许" + this.appName +
-                this.grantGroups[this.count].label)
-                  .fontSize(Constants.DIALOG_REQ_FONT_SIZE)
-                  .fontColor($r('app.color.first_font_color'))
-                  .fontWeight(FontWeight.Medium)
-                  .fontSize(Constants.DIALOG_REQ_FONT_SIZE)
-                  .lineHeight(Constants.DIALOG_REQ_LINE_HEIGHT)
-                  .margin({
-                    top: Constants.DIALOG_REQ_MARGIN_TOP,
-                    left: Constants.DIALOG_REQ_MARGIN_LEFT
-                  })
-              }
-            }
-
-            Row() {
-              Flex({ justifyContent: FlexAlign.Start }) {
-                Text(this.grantGroups[this.count].description)
-                  .fontSize(Constants.DIALOG_DESP_FONT_SIZE)
-                  .fontColor($r('app.color.text_secondary_color'))
-                  .fontSize(Constants.DIALOG_DESP_FONT_SIZE)
-                  .lineHeight(Constants.DIALOG_DESP_LINE_HEIGHT)
-                  .margin({
-                    top: Constants.DIALOG_DESP_MARGIN_TOP,
-                    left: Constants.DIALOG_DESP_MARGIN_LEFT,
-                    right: Constants.DIALOG_DESP_MARGIN_RIGHT,
-                    bottom: Constants.DIALOG_DESP_MARGIN_BOTTOM
-                  })
-              }
-            }
-          }
-        }
-        Row() {
-          Flex({ justifyContent: FlexAlign.SpaceBetween, alignItems: ItemAlign.Center }) {
-            Button('禁止')
-              .fontSize(Constants.BUTTON_FONT_SIZE)
-              .onClick(() => {
-                this.privacyCancel(this.grantGroups[this.count], this.accessTokenId, this.reqPerms, this.userFixedFlag)
-              }).customizeButton().margin({ left: Constants.BUTTON_MARGIN_LEFT })
-            Text('|').fontSize(Constants.BUTTON_DIVIDER_FONT_SIZE).fontColor($r('app.color.divider_color'))
-            Button('允许')
-              .fontSize(Constants.BUTTON_FONT_SIZE)
-              .onClick(() => {
-                this.privacyAccept(this.grantGroups[this.count], this.accessTokenId, this.reqPerms, this.userFixedFlag)
-              }).customizeButton().margin({ right: Constants.BUTTON_MARGIN_RIGHT })
-          }
-        }
-      }
-      .backgroundColor($r('app.color.default_background_color'))
-      .borderRadius(Constants.DIALOG_PRIVACY_BORDER_RADIUS)
-      .width(Constants.DIALOG_PRIVACY_WIDTH)
-      .padding({ bottom: Constants.DIALOG_PADDING_BOTTOM })
-    }.width(Constants.FULL_WIDTH)
-    .height(Constants.FULL_HEIGHT)
-  }
-
-  verify() {
-    if((this.initStatus == Constants.INIT_NEED_TO_TERMINATED) || (this.count >= this.grantGroups.length)) {
-      this.answerRequest()
-      this.initStatus = Constants.INIT_NEED_TO_WAIT
-      return false
-    }
-    return true
-  }
-
-  answerRequest() {
-    var ret: number = Constants.RESULT_SUCCESS
-    if (this.initStatus == Constants.INIT_NEED_TO_TERMINATED) {
-      ret = Constants.RESULT_FAILURE
-    }
-    this.answer(ret, this.reqPerms)
-  }
-
-  answer(ret, reqPerms) {
-    Log.info("code:" + ret + ", perms="+ JSON.stringify(reqPerms) +", result=" + JSON.stringify(this.result))
-    var perms = []
-    var results = []
-    reqPerms.forEach(perm => {
-      perms.push(perm)
-    })
-    this.result.forEach(result => {
-      results.push(result)
-    })
-    let option = new rpc.MessageOption()
-    let data = new rpc.MessageParcel()
-    let reply = new rpc.MessageParcel()
-    Promise.all([data.writeInterfaceToken(Constants.ACCESS_TOKEN),
-      data.writeStringArray(perms),
-      data.writeIntArray(results)
-    ]).then(() => {
-      this.proxy.sendRequest(Constants.RESULT_CODE, data, reply, option)
-      this.destruction()
-    }).catch(() => {
-      Log.error('write result failed!')
-      this.destruction()
-    })
-  }
-
-  destruction() {
-    this.win.destroy()
-    globalThis.windowNum --
-    Log.info("windowNum:" + globalThis.windowNum)
-    if(globalThis.windowNum == 0) {
-      globalThis.extensionContext.terminateSelf()
-    }
-  }
-
-  async privacyAccept(group, accessTokenId, permissionList, userFixedFlag) {
-    var acManager = abilityAccessCtrl.createAtManager()
-    var num = 0
-    group.permissions.forEach(async permission => {
-      let result
-      if(showSubpermissionsGrop.indexOf(group.groupName) == -1) {
-        result = await acManager.grantUserGrantedPermission(accessTokenId, permission, userFixedFlag)
-      }else {
-        if(permissionList.includes(permission)) {
-          result = await acManager.grantUserGrantedPermission(accessTokenId, permission, userFixedFlag)
-        }
-      }
-      num ++
-      Log.info("grant permission result:" + result + "permission" + permission)
-      if (result == abilityAccessCtrl.GrantStatus.PERMISSION_GRANTED) {
-        permissionList.forEach((req, idx) => {
-          if(req == permission) {
-            this.result[idx] = abilityAccessCtrl.GrantStatus.PERMISSION_GRANTED;
-          }
-        })
-        Log.info("grant permission success:" + permission)
-      } else {
-        Log.error("failed to grant permission:" + permission + " ret:" + result)
-      }
-      if(num == group.permissions.length) {
-        this.count ++
-      }
-    })
-  }
-
-  async privacyCancel(group, accessTokenId, permissionList, userFixedFlag) {
-    var acManager = abilityAccessCtrl.createAtManager()
-    group.permissions.forEach(async permission => {
-      let result
-      if(showSubpermissionsGrop.indexOf(group.groupName) == -1) {
-        result = await acManager.revokeUserGrantedPermission(accessTokenId, permission, userFixedFlag)
-      }else {
-        if(permissionList.includes(permission)) {
-          result = await acManager.revokeUserGrantedPermission(accessTokenId, permission, userFixedFlag)
-        }
-      }
-      Log.info("revoke permission result:" + result + "permission" + permission);
-    })
-    this.count ++
-  }
-
-  getgrantGroups(stateGroup) {
-    this.reqPerms.forEach((permission, idx) => {
-      //已授权
-      if(stateGroup[idx] == Constants.PASS_OPER) {
-        Log.info("permission has been fixed:" + permission)
-        this.result[idx] = abilityAccessCtrl.GrantStatus.PERMISSION_GRANTED;
-        //待授权
-      }else if(stateGroup[idx] == Constants.DYNAMIC_OPER) {
-        var group = getPermissionGroup(permission)
-        if(!group) {
-          Log.info("permission not find:" + permission)
-        }else {
-          var exist = this.grantGroups.find(grantGroup => grantGroup.name == group.name)
-          //判断是否为需要展示子权限的权限组
-          if(showSubpermissionsGrop.indexOf(group.groupName) != -1) {
-            var permissionDetail
-            permissionGroups.forEach(permissionGroup => {
-              if(permissionGroup.permissionName == permission) {
-                //获取授权的权限信息
-                permissionDetail = permissionGroup
-              }
-            })
-            //权限组已存在的情况
-            if(!exist) {
-              group.description = [permissionDetail.label]
-              this.grantGroups.push(group)
-            }else {
-              if(exist.description.indexOf(permissionDetail.label) == -1) {
-                exist.description.push(permissionDetail.label)
-              }
-            }
-          }else {
-            if(!exist) {
-              this.grantGroups.push(group)
-            }
-          }
-        }
-      }
-    })
-    this.initStatus = Constants.INIT_NEED_TO_VERIFY
-  }
-
-  getApplicationName(uid) {
-    bundle.getNameForUid(uid).then((data) => {
-      Log.info("getApplicationName bundleName:" + data)
-      Log.info("getApplicationName userId:" + Math.floor(uid/200000))
-      bundle.getApplicationInfo(data, BundleFlag.GET_BUNDLE_DEFAULT, Math.floor(uid/200000)).then(applicationInfo => {
-        Resmgr.getResourceManager(globalThis.extensionContext, data).then(item => {
-          item.getString(applicationInfo.labelId, (err, value) => {
-            if (value == undefined) {
-              this.appName = applicationInfo.label
-            } else {
-              this.appName = value
-            }
-            Log.info("hap label:" + applicationInfo.label + ", value:"+this.appName)
-          })
-        })
-      }).catch(err => {
-        Log.error("applicationInfo error :" + err)
-        this.initStatus = Constants.INIT_NEED_TO_TERMINATED
-      })
-      bundle.getBundleInfo(data, Constants.PARMETER_BUNDLE_FLAG).then(bundleInfo => {
-        this.grantGroups.forEach((group, idx) => {
-          if(group.description) {
-            Resmgr.getResourceManager(globalThis.extensionContext, Constants.BUNDLE_NAME).then(item => {
-              Promise.all([item.getString($r("app.string.separator").id),
-              item.getString($r("app.string.reason_suffix").id)])
-                .then(values => {
-                  group.description = group.description.join(values[0])
-                  group.description += values[1]
-                  this.getReason(group, bundleInfo, data)
-                })
-            })
-          }else {
-            this.getReason(group, bundleInfo, data)
-          }
-        })
-      })
-    }).catch(err => {
-      Log.error("getNameForUid error :" + JSON.stringify(err))
-      this.initStatus = Constants.INIT_NEED_TO_TERMINATED
-    })
-  }
-
-  getReason(group, bundleInfo, bundleName) {
-    group.permissions.forEach(permission => {
-      if(this.reqPerms.indexOf(permission) != -1) {
-        bundleInfo.reqPermissionDetails.forEach(reqPermissionDetail => {
-          if(reqPermissionDetail.name == permission) {
-            Resmgr.getResourceManager(globalThis.extensionContext, bundleName).then(item => {
-              item.getString(reqPermissionDetail.reasonId, (err, value) => {
-                this.initStatus = Constants.INIT_NEED_TO_REFRESH
-                if (value !== undefined && !group.hasReason) {
-                  group.description += value.slice(Constants.START_SUBSCRIPT, Constants.END_SUBSCRIPT)
-                  group.hasReason = true
-                }
-              })
-            })
-          }
-        })
-      }
-    })
-  }
-
-  aboutToAppear() {
-    this.count = 0;
-    this.initStatus = Constants.INIT_NEED_TO_WAIT
-    this.result = []
-    this.reqPerms = globalThis.abilityWant.parameters['ohos.user.grant.permission']
-    this.accessTokenId = globalThis.abilityWant.parameters['ohos.aafwk.param.callerToken']
-    this.proxy = globalThis.abilityWant.parameters['ohos.ability.params.callback'].value
-    this.win = globalThis.extensionWin
-    if (this.reqPerms == undefined || this.accessTokenId == undefined || this.reqPerms.length == 0) {
-      Log.info("invalid parameters")
-      this.initStatus = Constants.INIT_NEED_TO_TERMINATED
-      return
-    }
-    Log.info("request permission=" + JSON.stringify(this.reqPerms) + ", tokenId = " + this.accessTokenId)
-    Log.info("permission state=" + JSON.stringify(globalThis.abilityWant.parameters['ohos.user.grant.permission.state']));
-    this.result = new Array(this.reqPerms.length).fill(-1);
-    this.getgrantGroups(globalThis.abilityWant.parameters['ohos.user.grant.permission.state']);
-    this.getApplicationName(globalThis.abilityWant.parameters['ohos.aafwk.param.callerUid'])
-  }
-}
-
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+import abilityAccessCtrl from '@ohos.abilityAccessCtrl';
+import bundle from '@ohos.bundle';
+import Resmgr from '@ohos.resourceManager'
+import rpc from '@ohos.rpc';
+import { Log, getPermissionGroup } from '../common/utils/utils'
+import Constants from '../common/utils/constant'
+import { BundleFlag } from '../common/model/bundle'
+import { permissionGroups, showSubpermissionsGrop } from '../common/model/permissionGroup'
+
+@Extend(Button) function customizeButton() {
+  .backgroundColor($r('app.color.default_background_color'))
+  .fontColor($r('app.color.button_color'))
+  .fontWeight(FontWeight.Medium)
+  .height(Constants.BUTTON_HEIGHT)
+  .width(Constants.BUTTON_WIDTH)
+}
+
+@Entry
+@Component
+struct dialogPlusPage {
+  @State count: number = 0
+  @State result: Array<any> = []
+  @State accessTokenId: number = 0
+  @State initStatus: number = Constants.INIT_NEED_TO_WAIT
+  @State reqPerms: Array<string> = []
+  @State grantGroups: Array<any> = []
+  @State userFixedFlag: number = 2 // means user fixed
+  @State appName: string = ""
+  @State win: any = ""
+  @State proxy: any = ''
+
+  build() {
+    Flex({ justifyContent: FlexAlign.Center, alignItems: ItemAlign.Center }) {
+      Column() {
+        if ((this.initStatus != Constants.INIT_NEED_TO_WAIT) && this.verify()) {
+          Image(this.grantGroups[this.count].icon)
+            .width(Constants.DIALOG_ICON_WIDTH)
+            .height(Constants.DIALOG_ICON_HEIGHT)
+            .fillColor($r("app.color.first_font_color"))
+            .margin({
+              top: Constants.DIALOG_ICON_MARGIN_TOP
+            })
+          Text(`${this.count + 1} / ${this.grantGroups.length}`)
+            .fontSize(Constants.DIALOG_LABEL_FONT_SIZE)
+            .fontColor($r('app.color.text_secondary_color'))
+            .lineHeight(Constants.DIALOG_LABEL_LINE_HEIGHT)
+            .margin({
+              top: Constants.DIALOG_LABEL_MARGIN_TOP
+            })
+          Column() {
+            Row() {
+              Flex({ justifyContent: FlexAlign.Start }) {
+                Text("是否允许" + this.appName +
+                this.grantGroups[this.count].label)
+                  .fontSize(Constants.DIALOG_REQ_FONT_SIZE)
+                  .fontColor($r('app.color.first_font_color'))
+                  .fontWeight(FontWeight.Medium)
+                  .fontSize(Constants.DIALOG_REQ_FONT_SIZE)
+                  .lineHeight(Constants.DIALOG_REQ_LINE_HEIGHT)
+                  .margin({
+                    top: Constants.DIALOG_REQ_MARGIN_TOP,
+                    left: Constants.DIALOG_REQ_MARGIN_LEFT
+                  })
+              }
+            }
+
+            Row() {
+              Flex({ justifyContent: FlexAlign.Start }) {
+                Text(this.grantGroups[this.count].description)
+                  .fontSize(Constants.DIALOG_DESP_FONT_SIZE)
+                  .fontColor($r('app.color.text_secondary_color'))
+                  .fontSize(Constants.DIALOG_DESP_FONT_SIZE)
+                  .lineHeight(Constants.DIALOG_DESP_LINE_HEIGHT)
+                  .margin({
+                    top: Constants.DIALOG_DESP_MARGIN_TOP,
+                    left: Constants.DIALOG_DESP_MARGIN_LEFT,
+                    right: Constants.DIALOG_DESP_MARGIN_RIGHT,
+                    bottom: Constants.DIALOG_DESP_MARGIN_BOTTOM
+                  })
+              }
+            }
+          }
+        }
+        Row() {
+          Flex({ justifyContent: FlexAlign.SpaceBetween, alignItems: ItemAlign.Center }) {
+            Button('禁止')
+              .fontSize(Constants.BUTTON_FONT_SIZE)
+              .onClick(() => {
+                this.privacyCancel(this.grantGroups[this.count], this.accessTokenId, this.reqPerms, this.userFixedFlag)
+              }).customizeButton().margin({ left: Constants.BUTTON_MARGIN_LEFT })
+            Text('|').fontSize(Constants.BUTTON_DIVIDER_FONT_SIZE).fontColor($r('app.color.divider_color'))
+            Button('允许')
+              .fontSize(Constants.BUTTON_FONT_SIZE)
+              .onClick(() => {
+                this.privacyAccept(this.grantGroups[this.count], this.accessTokenId, this.reqPerms, this.userFixedFlag)
+              }).customizeButton().margin({ right: Constants.BUTTON_MARGIN_RIGHT })
+          }
+        }
+      }
+      .backgroundColor($r('app.color.default_background_color'))
+      .borderRadius(Constants.DIALOG_PRIVACY_BORDER_RADIUS)
+      .width(Constants.DIALOG_PRIVACY_WIDTH)
+      .padding({ bottom: Constants.DIALOG_PADDING_BOTTOM })
+    }.width(Constants.FULL_WIDTH)
+    .height(Constants.FULL_HEIGHT)
+  }
+
+  verify() {
+    if((this.initStatus == Constants.INIT_NEED_TO_TERMINATED) || (this.count >= this.grantGroups.length)) {
+      this.answerRequest()
+      this.initStatus = Constants.INIT_NEED_TO_WAIT
+      return false
+    }
+    return true
+  }
+
+  answerRequest() {
+    var ret: number = Constants.RESULT_SUCCESS
+    if (this.initStatus == Constants.INIT_NEED_TO_TERMINATED) {
+      ret = Constants.RESULT_FAILURE
+    }
+    this.answer(ret, this.reqPerms)
+  }
+
+  answer(ret, reqPerms) {
+    Log.info("code:" + ret + ", perms="+ JSON.stringify(reqPerms) +", result=" + JSON.stringify(this.result))
+    var perms = []
+    var results = []
+    reqPerms.forEach(perm => {
+      perms.push(perm)
+    })
+    this.result.forEach(result => {
+      results.push(result)
+    })
+    let option = new rpc.MessageOption()
+    let data = new rpc.MessageParcel()
+    let reply = new rpc.MessageParcel()
+    Promise.all([data.writeInterfaceToken(Constants.ACCESS_TOKEN),
+      data.writeStringArray(perms),
+      data.writeIntArray(results)
+    ]).then(() => {
+      this.proxy.sendRequest(Constants.RESULT_CODE, data, reply, option)
+      this.destruction()
+    }).catch(() => {
+      Log.error('write result failed!')
+      this.destruction()
+    })
+  }
+
+  destruction() {
+    this.win.destroy()
+    globalThis.windowNum --
+    Log.info("windowNum:" + globalThis.windowNum)
+    if(globalThis.windowNum == 0) {
+      globalThis.extensionContext.terminateSelf()
+    }
+  }
+
+  async privacyAccept(group, accessTokenId, permissionList, userFixedFlag) {
+    var acManager = abilityAccessCtrl.createAtManager()
+    var num = 0
+    group.permissions.forEach(async permission => {
+      let result
+      if(showSubpermissionsGrop.indexOf(group.groupName) == -1) {
+        result = await acManager.grantUserGrantedPermission(accessTokenId, permission, userFixedFlag)
+      }else {
+        if(permissionList.includes(permission)) {
+          result = await acManager.grantUserGrantedPermission(accessTokenId, permission, userFixedFlag)
+        }
+      }
+      num ++
+      Log.info("grant permission result:" + result + "permission" + permission)
+      if (result == abilityAccessCtrl.GrantStatus.PERMISSION_GRANTED) {
+        permissionList.forEach((req, idx) => {
+          if(req == permission) {
+            this.result[idx] = abilityAccessCtrl.GrantStatus.PERMISSION_GRANTED;
+          }
+        })
+        Log.info("grant permission success:" + permission)
+      } else {
+        Log.error("failed to grant permission:" + permission + " ret:" + result)
+      }
+      if(num == group.permissions.length) {
+        this.count ++
+      }
+    })
+  }
+
+  async privacyCancel(group, accessTokenId, permissionList, userFixedFlag) {
+    var acManager = abilityAccessCtrl.createAtManager()
+    group.permissions.forEach(async permission => {
+      let result
+      if(showSubpermissionsGrop.indexOf(group.groupName) == -1) {
+        result = await acManager.revokeUserGrantedPermission(accessTokenId, permission, userFixedFlag)
+      }else {
+        if(permissionList.includes(permission)) {
+          result = await acManager.revokeUserGrantedPermission(accessTokenId, permission, userFixedFlag)
+        }
+      }
+      Log.info("revoke permission result:" + result + "permission" + permission);
+    })
+    this.count ++
+  }
+
+  getgrantGroups(stateGroup) {
+    this.reqPerms.forEach((permission, idx) => {
+      //已授权
+      if(stateGroup[idx] == Constants.PASS_OPER) {
+        Log.info("permission has been fixed:" + permission)
+        this.result[idx] = abilityAccessCtrl.GrantStatus.PERMISSION_GRANTED;
+        //待授权
+      }else if(stateGroup[idx] == Constants.DYNAMIC_OPER) {
+        var group = getPermissionGroup(permission)
+        if(!group) {
+          Log.info("permission not find:" + permission)
+        }else {
+          var exist = this.grantGroups.find(grantGroup => grantGroup.name == group.name)
+          //判断是否为需要展示子权限的权限组
+          if(showSubpermissionsGrop.indexOf(group.groupName) != -1) {
+            var permissionDetail
+            permissionGroups.forEach(permissionGroup => {
+              if(permissionGroup.permissionName == permission) {
+                //获取授权的权限信息
+                permissionDetail = permissionGroup
+              }
+            })
+            //权限组已存在的情况
+            if(!exist) {
+              group.description = [permissionDetail.label]
+              this.grantGroups.push(group)
+            }else {
+              if(exist.description.indexOf(permissionDetail.label) == -1) {
+                exist.description.push(permissionDetail.label)
+              }
+            }
+          }else {
+            if(!exist) {
+              this.grantGroups.push(group)
+            }
+          }
+        }
+      }
+    })
+    this.initStatus = Constants.INIT_NEED_TO_VERIFY
+  }
+
+  getApplicationName(uid) {
+    bundle.getNameForUid(uid).then((data) => {
+      Log.info("getApplicationName bundleName:" + data)
+      Log.info("getApplicationName userId:" + Math.floor(uid/200000))
+      bundle.getApplicationInfo(data, BundleFlag.GET_BUNDLE_DEFAULT, Math.floor(uid/200000)).then(applicationInfo => {
+        Resmgr.getResourceManager(globalThis.extensionContext, data).then(item => {
+          item.getString(applicationInfo.labelId, (err, value) => {
+            if (value == undefined) {
+              this.appName = applicationInfo.label
+            } else {
+              this.appName = value
+            }
+            Log.info("hap label:" + applicationInfo.label + ", value:"+this.appName)
+          })
+        })
+      }).catch(err => {
+        Log.error("applicationInfo error :" + err)
+        this.initStatus = Constants.INIT_NEED_TO_TERMINATED
+      })
+      bundle.getBundleInfo(data, Constants.PARMETER_BUNDLE_FLAG).then(bundleInfo => {
+        this.grantGroups.forEach((group, idx) => {
+          if(group.description) {
+            Resmgr.getResourceManager(globalThis.extensionContext, Constants.BUNDLE_NAME).then(item => {
+              Promise.all([item.getString($r("app.string.separator").id),
+              item.getString($r("app.string.reason_suffix").id)])
+                .then(values => {
+                  group.description = group.description.join(values[0])
+                  group.description += values[1]
+                  this.getReason(group, bundleInfo, data)
+                })
+            })
+          }else {
+            this.getReason(group, bundleInfo, data)
+          }
+        })
+      })
+    }).catch(err => {
+      Log.error("getNameForUid error :" + JSON.stringify(err))
+      this.initStatus = Constants.INIT_NEED_TO_TERMINATED
+    })
+  }
+
+  getReason(group, bundleInfo, bundleName) {
+    group.permissions.forEach(permission => {
+      if(this.reqPerms.indexOf(permission) != -1) {
+        bundleInfo.reqPermissionDetails.forEach(reqPermissionDetail => {
+          if(reqPermissionDetail.name == permission) {
+            Resmgr.getResourceManager(globalThis.extensionContext, bundleName).then(item => {
+              item.getString(reqPermissionDetail.reasonId, (err, value) => {
+                this.initStatus = Constants.INIT_NEED_TO_REFRESH
+                if (value !== undefined && !group.hasReason) {
+                  group.description += value.slice(Constants.START_SUBSCRIPT, Constants.END_SUBSCRIPT)
+                  group.hasReason = true
+                }
+              })
+            })
+          }
+        })
+      }
+    })
+  }
+
+  aboutToAppear() {
+    this.count = 0;
+    this.initStatus = Constants.INIT_NEED_TO_WAIT
+    this.result = []
+    this.reqPerms = globalThis.abilityWant.parameters['ohos.user.grant.permission']
+    this.accessTokenId = globalThis.abilityWant.parameters['ohos.aafwk.param.callerToken']
+    this.proxy = globalThis.abilityWant.parameters['ohos.ability.params.callback'].value
+    this.win = globalThis.extensionWin
+    if (this.reqPerms == undefined || this.accessTokenId == undefined || this.reqPerms.length == 0) {
+      Log.info("invalid parameters")
+      this.initStatus = Constants.INIT_NEED_TO_TERMINATED
+      return
+    }
+    Log.info("request permission=" + JSON.stringify(this.reqPerms) + ", tokenId = " + this.accessTokenId)
+    Log.info("permission state=" + JSON.stringify(globalThis.abilityWant.parameters['ohos.user.grant.permission.state']));
+    this.result = new Array(this.reqPerms.length).fill(-1);
+    this.getgrantGroups(globalThis.abilityWant.parameters['ohos.user.grant.permission.state']);
+    this.getApplicationName(globalThis.abilityWant.parameters['ohos.aafwk.param.callerUid'])
+  }
+}
+
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/other-permissions.ets b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/other-permissions.ets
index 1de45de538c1eb26f07fc85971a161bbaf78d65c..3dca02a1f68eda1c8e34066914d93fc1c6a13c99 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/other-permissions.ets
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/other-permissions.ets
@@ -1,170 +1,170 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-import { backBar } from "../common/components/backBar";
-import router from '@system.router';
-import Constants from '../common/utils/constant';
-import { otherPermissionsLabel } from '../common/model/permissionGroup'
-import abilityAccessCtrl from '@ohos.abilityAccessCtrl'
-
-var TAG = 'PermissionManager_MainAbility:'
-
-let routerData = router.getParams().routerData; // Routing jump data
-let tokenId: any = router.getParams().tokenId; // tokenId for verify permission
-let backTitle = router.getParams().backTitle; // return title name
-let status = router.getParams().status; // Status: Allowed, Forbidden
-let permissions: any = router.getParams().permission; // permissions name
-let otherPermissionList = []; // otherPermission List
-for (let i = 0; i < permissions.length; i++) {
-  otherPermissionList.push({
-    permissionLabel: otherPermissionsLabel[permissions[i]],
-    permission: permissions[i]
-  })
-}
-
-@Entry
-@Component
-struct appNamePage {
-  build() {
-    GridContainer({ gutter: Constants.GUTTER, margin: Constants.GRID_MARGIN }) {
-      Row() {
-        Row()
-          .useSizeType({
-            xs: { span: Constants.LEFT_XS_SPAN, offset: Constants.LEFT_XS_OFFSET },
-            sm: { span: Constants.LEFT_SM_SPAN, offset: Constants.LEFT_SM_OFFSET },
-            md: { span: Constants.LEFT_MD_SPAN, offset: Constants.LEFT_MD_OFFSET },
-            lg: { span: Constants.LEFT_LG_SPAN, offset: Constants.LEFT_LG_OFFSET }
-          })
-          .height(Constants.FULL_HEIGHT)
-        Row() {
-          Column() {
-            Row() {
-              backBar({ title: JSON.stringify(backTitle), recordable: false })
-            }
-            Row() {
-              Column() {
-                Scroll() {
-                  appNameItem()
-                }
-              }
-            }.layoutWeight(Constants.LAYOUT_WEIGHT)
-          }
-        }
-        .useSizeType({
-          xs: { span: Constants.MIDDLE_XS_SPAN, offset: Constants.MIDDLE_XS_OFFSET },
-          sm: { span: Constants.MIDDLE_SM_SPAN, offset: Constants.MIDDLE_SM_OFFSET },
-          md: { span: Constants.MIDDLE_MD_SPAN, offset: Constants.MIDDLE_MD_OFFSET },
-          lg: { span: Constants.MIDDLE_LG_SPAN, offset: Constants.MIDDLE_LG_OFFSET }
-        })
-        .height(Constants.FULL_HEIGHT)
-        Row()
-          .useSizeType({
-            xs: { span: Constants.RIGHT_XS_SPAN, offset: Constants.RIGHT_XS_OFFSET },
-            sm: { span: Constants.RIGHT_SM_SPAN, offset: Constants.RIGHT_SM_OFFSET },
-            md: { span: Constants.RIGHT_MD_SPAN, offset: Constants.RIGHT_MD_OFFSET },
-            lg: { span: Constants.RIGHT_LG_SPAN, offset: Constants.RIGHT_LG_OFFSET }
-          })
-          .height(Constants.FULL_HEIGHT)
-      }
-      .height(Constants.FULL_HEIGHT)
-      .width(Constants.FULL_WIDTH)
-      .backgroundColor($r("sys.color.ohos_id_color_sub_background"))
-      .opacity(Constants.MANAGEMENT_TRANSPARENCY)
-    }
-  }
-
-/**
-   * Lifecycle function, triggered once when this page is displayed
-   */
-  onPageShow() {
-    console.log(TAG + 'onPageShow other-permissions')
-    let isGranted = true;
-    permissions.forEach(permission => {
-      abilityAccessCtrl.createAtManager().verifyAccessToken(tokenId, permission).then(res => {
-        status = res;
-      })
-        .catch(err => {
-          console.error(TAG + 'verifyAccessToken occure error: ' + JSON.stringify(err))
-        })
-    })
-  }
-}
-
-@Component
-struct appNameItem {
-  @State otherPermissionListItem: string[] = otherPermissionList; // Other permission interface data array
-  @Builder ListItemLayout(item, index) {
-    ListItem() {
-      Row() {
-        Column() {
-          Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
-            Row() {
-              Text(item.permissionLabel)
-                .fontSize(Constants.TEXT_MIDDLE_FONT_SIZE)
-                .fontColor($r('app.color.text_color'))
-                .flexGrow(Constants.FLEX_GROW)
-              Image($r('app.media.rightarrow'))
-                .objectFit(ImageFit.Contain)
-                .height(Constants.IMAGE_HEIGHT)
-                .width(Constants.IMAGE_WIDTH)
-            }
-            .width(Constants.FULL_WIDTH)
-            .height(Constants.LISTITEM_ROW_HEIGHT)
-          }
-          if (!index) {
-            Row() {
-              Column()
-                .backgroundColor($r('app.color.text_decoration_color'))
-                .width(Constants.FULL_WIDTH)
-                .height(Constants.TEXT_DECORATION_HEIGHT)
-            }
-          }
-        }.onClick(() => {
-            router.push({
-              uri: 'pages/application-tertiary',
-              params: {
-                routerData: routerData,
-                backTitle: item.permissionLabel,
-                permission: [item.permission],
-                status: status
-              }
-            });
-        })
-      }
-    }.padding({ left: Constants.DEFAULT_PADDING_START, right: Constants.DEFAULT_PADDING_END })
-  }
-
-  build() {
-    Row() {
-      Column() {
-        Row() {
-          List() {
-            ForEach(this.otherPermissionListItem.slice(Constants.SLICE_START, this.otherPermissionListItem.length - 1),
-            (item) => {
-              this.ListItemLayout(item, Constants.SLICE_START_INDEX)
-            }, item => item.toString())
-            ForEach(this.otherPermissionListItem.slice(Constants.SLICE_END), (item, index) => {
-              this.ListItemLayout(item, Constants.SLICE_END_INDEX)
-            }, item => item.toString())
-          }.backgroundColor($r('app.color.default_background_color')).borderRadius(Constants.BORDER_RADIUS)
-           .padding({ top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
-        }.margin({ top: Constants.ROW_MARGIN_TOP })
-         .padding({ left: Constants.LIST_PADDING_LEFT, right: Constants.LISTITEM_PADDING_RIGHT })
-      }
-      .width(Constants.FULL_WIDTH)
-      .height(Constants.FULL_HEIGHT)
-    }
-  }
-}
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+import { backBar } from "../common/components/backBar";
+import router from '@system.router';
+import Constants from '../common/utils/constant';
+import { otherPermissionsLabel } from '../common/model/permissionGroup'
+import abilityAccessCtrl from '@ohos.abilityAccessCtrl'
+
+var TAG = 'PermissionManager_MainAbility:'
+
+let routerData = router.getParams().routerData; // Routing jump data
+let tokenId: any = router.getParams().tokenId; // tokenId for verify permission
+let backTitle = router.getParams().backTitle; // return title name
+let status = router.getParams().status; // Status: Allowed, Forbidden
+let permissions: any = router.getParams().permission; // permissions name
+let otherPermissionList = []; // otherPermission List
+for (let i = 0; i < permissions.length; i++) {
+  otherPermissionList.push({
+    permissionLabel: otherPermissionsLabel[permissions[i]],
+    permission: permissions[i]
+  })
+}
+
+@Entry
+@Component
+struct appNamePage {
+  build() {
+    GridContainer({ gutter: Constants.GUTTER, margin: Constants.GRID_MARGIN }) {
+      Row() {
+        Row()
+          .useSizeType({
+            xs: { span: Constants.LEFT_XS_SPAN, offset: Constants.LEFT_XS_OFFSET },
+            sm: { span: Constants.LEFT_SM_SPAN, offset: Constants.LEFT_SM_OFFSET },
+            md: { span: Constants.LEFT_MD_SPAN, offset: Constants.LEFT_MD_OFFSET },
+            lg: { span: Constants.LEFT_LG_SPAN, offset: Constants.LEFT_LG_OFFSET }
+          })
+          .height(Constants.FULL_HEIGHT)
+        Row() {
+          Column() {
+            Row() {
+              backBar({ title: JSON.stringify(backTitle), recordable: false })
+            }
+            Row() {
+              Column() {
+                Scroll() {
+                  appNameItem()
+                }
+              }
+            }.layoutWeight(Constants.LAYOUT_WEIGHT)
+          }
+        }
+        .useSizeType({
+          xs: { span: Constants.MIDDLE_XS_SPAN, offset: Constants.MIDDLE_XS_OFFSET },
+          sm: { span: Constants.MIDDLE_SM_SPAN, offset: Constants.MIDDLE_SM_OFFSET },
+          md: { span: Constants.MIDDLE_MD_SPAN, offset: Constants.MIDDLE_MD_OFFSET },
+          lg: { span: Constants.MIDDLE_LG_SPAN, offset: Constants.MIDDLE_LG_OFFSET }
+        })
+        .height(Constants.FULL_HEIGHT)
+        Row()
+          .useSizeType({
+            xs: { span: Constants.RIGHT_XS_SPAN, offset: Constants.RIGHT_XS_OFFSET },
+            sm: { span: Constants.RIGHT_SM_SPAN, offset: Constants.RIGHT_SM_OFFSET },
+            md: { span: Constants.RIGHT_MD_SPAN, offset: Constants.RIGHT_MD_OFFSET },
+            lg: { span: Constants.RIGHT_LG_SPAN, offset: Constants.RIGHT_LG_OFFSET }
+          })
+          .height(Constants.FULL_HEIGHT)
+      }
+      .height(Constants.FULL_HEIGHT)
+      .width(Constants.FULL_WIDTH)
+      .backgroundColor($r("sys.color.ohos_id_color_sub_background"))
+      .opacity(Constants.MANAGEMENT_TRANSPARENCY)
+    }
+  }
+
+/**
+   * Lifecycle function, triggered once when this page is displayed
+   */
+  onPageShow() {
+    console.log(TAG + 'onPageShow other-permissions')
+    let isGranted = true;
+    permissions.forEach(permission => {
+      abilityAccessCtrl.createAtManager().verifyAccessToken(tokenId, permission).then(res => {
+        status = res;
+      })
+        .catch(err => {
+          console.error(TAG + 'verifyAccessToken occure error: ' + JSON.stringify(err))
+        })
+    })
+  }
+}
+
+@Component
+struct appNameItem {
+  @State otherPermissionListItem: string[] = otherPermissionList; // Other permission interface data array
+  @Builder ListItemLayout(item, index) {
+    ListItem() {
+      Row() {
+        Column() {
+          Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
+            Row() {
+              Text(item.permissionLabel)
+                .fontSize(Constants.TEXT_MIDDLE_FONT_SIZE)
+                .fontColor($r('app.color.text_color'))
+                .flexGrow(Constants.FLEX_GROW)
+              Image($r('app.media.rightarrow'))
+                .objectFit(ImageFit.Contain)
+                .height(Constants.IMAGE_HEIGHT)
+                .width(Constants.IMAGE_WIDTH)
+            }
+            .width(Constants.FULL_WIDTH)
+            .height(Constants.LISTITEM_ROW_HEIGHT)
+          }
+          if (!index) {
+            Row() {
+              Column()
+                .backgroundColor($r('app.color.text_decoration_color'))
+                .width(Constants.FULL_WIDTH)
+                .height(Constants.TEXT_DECORATION_HEIGHT)
+            }
+          }
+        }.onClick(() => {
+            router.push({
+              uri: 'pages/application-tertiary',
+              params: {
+                routerData: routerData,
+                backTitle: item.permissionLabel,
+                permission: [item.permission],
+                status: status
+              }
+            });
+        })
+      }
+    }.padding({ left: Constants.DEFAULT_PADDING_START, right: Constants.DEFAULT_PADDING_END })
+  }
+
+  build() {
+    Row() {
+      Column() {
+        Row() {
+          List() {
+            ForEach(this.otherPermissionListItem.slice(Constants.SLICE_START, this.otherPermissionListItem.length - 1),
+            (item) => {
+              this.ListItemLayout(item, Constants.SLICE_START_INDEX)
+            }, item => item.toString())
+            ForEach(this.otherPermissionListItem.slice(Constants.SLICE_END), (item, index) => {
+              this.ListItemLayout(item, Constants.SLICE_END_INDEX)
+            }, item => item.toString())
+          }.backgroundColor($r('app.color.default_background_color')).borderRadius(Constants.BORDER_RADIUS)
+           .padding({ top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
+        }.margin({ top: Constants.ROW_MARGIN_TOP })
+         .padding({ left: Constants.LIST_PADDING_LEFT, right: Constants.LISTITEM_PADDING_RIGHT })
+      }
+      .width(Constants.FULL_WIDTH)
+      .height(Constants.FULL_HEIGHT)
+    }
+  }
+}
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/permission-access-record.ets b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/permission-access-record.ets
index 529f738d3dedfe370b02364f40be1945fade07de..1430122fe084ef1f891f96e5501181329f696b05 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/permission-access-record.ets
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/ets/pages/permission-access-record.ets
@@ -1,533 +1,533 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-import bundle from '@ohos.bundle';
-import router from '@system.router';
-import Resmgr from '@ohos.resourceManager'
-import abilityAccessCtrl from '@ohos.abilityAccessCtrl';
-import privacyManager from '@ohos.privacyManager'
-import { backBar } from "../common/components/backBar";
-import Constants from '../common/utils/constant';
-import { noNeedDisplayApp, userGrantPermissions, permissionGroupIds } from "../common/model/permissionGroup";
-import { getPermissionGroup } from '../common/utils/utils'
-
-var TAG = 'PermissionManager_MainAbility:'
-
-@Extend(Image) function customizeImage(width: number, height: number) {
-  .objectFit(ImageFit.Contain)
-  .width(width)
-  .height(height)
-};
-
-@Entry
-@Component
-struct permissionRecordPage {
-  @State groups: any[] = []
-  @State applicationInfos: any[] = []
-  @State permissionApplications: any[] = []
-  @State permissionIndex: number = -1
-  @State applicationIndex: number = -1
-  @State strings: any = {}
-  @State currentIndex: number = 0
-  @Builder TabBuilder(index: number) {
-    Flex({ alignItems: ItemAlign.Center, justifyContent: FlexAlign.Center }) {
-      Text(index ? $r('app.string.application') : $r('app.string.authority'))
-        .fontColor(this.currentIndex == index ? $r('app.color.button_color') : $r('app.color.label_color'))
-        .fontWeight(this.currentIndex == index ? FontWeight.Bold : FontWeight.Regular)
-        .lineHeight(Constants.TEXT_LINE_HEIGHT)
-      if(this.currentIndex == index) {
-        Row().width(Constants.FULL_WIDTH).height(Constants.TAB_DECORATION_HEIGHT)
-          .backgroundColor($r('app.color.button_color'))
-          .position({ y: Constants.TAB_DECORATION_POSITION_Y })
-      }
-    }.height(Constants.TAB_HEIGHT)
-  }
-
-  @Builder ListItemLayout(item, index, dimension) {
-    ListItem() {
-      Column() {
-        Column() {
-          Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
-            Row() {
-              if(dimension) {
-                Image(item.icon)
-                  .customizeImage(Constants.MANAGEMENT_IMAGE_WIDTH, Constants.MANAGEMENT_IMAGE_HEIGHT)
-                  .margin({ right: Constants.MANAGEMENT_IMAGE_MARGIN_RIGHT_RECORD, left: Constants.MANAGEMENT_IMAGE_MARGIN_LEFT })
-              }else {
-                Image(item.icon)
-                  .customizeImage(Constants.APPLICATION_IMAGE_WIDTH, Constants.APPLICATION_IMAGE_HEIGHT)
-                  .margin({ right: Constants.MANAGEMENT_IMAGE_MARGIN_RIGHT })
-              }
-              Column() {
-                Text(item.groupName)
-                  .fontSize(Constants.TEXT_MIDDLE_FONT_SIZE)
-                  .fontWeight(FontWeight.Medium)
-                  .fontColor($r('app.color.label_color'))
-                  .lineHeight(Constants.TEXT_LINE_HEIGHT)
-                  .margin({ bottom: Constants.TERTIARY_LABEL_MARGIN_BOTTOM })
-                if(dimension) {
-                  Text(this.strings.visits + item.sum)
-                    .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
-                    .fontColor($r('app.color.label_color_light'))
-                    .lineHeight(Constants.TEXT_SMALL_LINE_HEIGHT)
-                }else {
-                  Row() {
-                    if (item.permissions) {
-                      ForEach(item.permissions, permission => {
-                        Image(permission.icon)
-                          .customizeImage(Constants.IMAGE_WIDTH_RECORD_APPLICATION, Constants.IMAGE_HEIGHT_RECORD_APPLICATION)
-                          .margin({ right: Constants.APPLICATION_TEXT_MARGIN_RIGHT })
-                      })
-                    }
-                  }
-                }
-              }.flexGrow(Constants.FLEX_GROW)
-              .alignItems(HorizontalAlign.Start)
-              if(dimension) {
-                if(index == this.permissionIndex) {
-                  Image($r('app.media.xiangshangjiantou'))
-                    .customizeImage(Constants.IMAGE_WIDTH_RECORD, Constants.IMAGE_HEIGHT_RECORD)
-                }else {
-                  Image($r('app.media.xiangxiajiantou'))
-                    .customizeImage(Constants.IMAGE_WIDTH_RECORD, Constants.IMAGE_HEIGHT_RECORD)
-                }
-              }else {
-                if(index == this.applicationIndex) {
-                  Image($r('app.media.xiangshangjiantou'))
-                    .customizeImage(Constants.IMAGE_WIDTH_RECORD, Constants.IMAGE_HEIGHT_RECORD)
-                }else {
-                  Image($r('app.media.xiangxiajiantou'))
-                    .customizeImage(Constants.IMAGE_WIDTH_RECORD, Constants.IMAGE_HEIGHT_RECORD)
-                }
-              }
-            }
-            .width(Constants.FULL_WIDTH)
-            .height(dimension ? Constants.LISTITEM_HEIGHT_PERMISSION : Constants.LISTITEM_HEIGHT_APPLICATION)
-          }
-        }.onClick(() => {
-          dimension ?
-            (this.permissionIndex = this.permissionIndex == index ? -1 : index) :
-            (this.applicationIndex = this.applicationIndex == index ? -1 : index)
-          if(dimension) {
-            this.permissionApplications = this.applicationInfos.filter(appInfo => {
-              return appInfo.groupNames.includes(item.groupName)
-            })
-          }
-        })
-        if(dimension && (index == this.permissionIndex)) {
-          List() {
-            ForEach(this.permissionApplications, (permissionApplication) => {
-              ListItem() {
-                Row() {
-                  Image(permissionApplication.icon)
-                    .customizeImage(Constants.APPLICATION_IMAGE_WIDTH, Constants.APPLICATION_IMAGE_HEIGHT)
-                    .margin({ right: Constants.MANAGEMENT_IMAGE_MARGIN_RIGHT })
-                  Column() {
-                    Row().width(Constants.FULL_WIDTH).height(Constants.TEXT_DECORATION_HEIGHT)
-                      .backgroundColor($r("app.color.label_color_lightest"))
-                      .margin({ bottom: Constants.LISTITEM_MARGIN_BOTTOM_PERMISSION })
-                    Text(permissionApplication.groupName)
-                      .fontSize(Constants.TEXT_MIDDLE_FONT_SIZE)
-                      .fontWeight(FontWeight.Medium)
-                      .fontColor($r('app.color.label_color'))
-                      .lineHeight(Constants.TEXT_LINE_HEIGHT)
-                      .margin({ bottom: Constants.TERTIARY_LABEL_MARGIN_BOTTOM })
-                    Text(this.strings.visits + this.getAppRecords(permissionApplication, item.groupName, true) +
-                        this.strings.recent_visit + this.getTime(this.getAppRecords(permissionApplication, item.groupName, false)))
-                      .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
-                      .fontColor($r('app.color.label_color_light'))
-                      .lineHeight(Constants.TEXT_SMALL_LINE_HEIGHT)
-                  }.alignItems(HorizontalAlign.Start)
-                  .height(Constants.FULL_HEIGHT)
-                }
-              }.height(Constants.LISTITEM_HEIGHT_APPLICATION)
-              .onClick(() => {
-                router.push({
-                  uri: 'pages/application-secondary',
-                  params: { routerData: {
-                    'bundleName': permissionApplication.name,
-                    'tokenId': permissionApplication.accessTokenId,
-                    'iconId': permissionApplication.icon,
-                    'labelId': permissionApplication.groupName,
-                    'permissions': permissionApplication.reqUserPermissions,
-                    'groupId': permissionApplication.groupIds
-                  } }
-                });
-              })
-            })
-          }
-        }
-        if(!dimension && (index == this.applicationIndex)) {
-          List() {
-            ForEach(item.permissions, (permission) => {
-              ListItem() {
-                Row() {
-                  Image(permission.icon)
-                    .customizeImage(Constants.MANAGEMENT_IMAGE_WIDTH, Constants.MANAGEMENT_IMAGE_HEIGHT)
-                    .margin({ right: Constants.MANAGEMENT_IMAGE_MARGIN_RIGHT_RECORD, left: Constants.MANAGEMENT_IMAGE_MARGIN_LEFT })
-                  Column() {
-                    Row().width(Constants.FULL_WIDTH).height(Constants.TEXT_DECORATION_HEIGHT)
-                      .backgroundColor($r("app.color.label_color_lightest"))
-                      .margin({ bottom: Constants.LISTITEM_MARGIN_BOTTOM_APPLICATION })
-                    Text(permission.groupName)
-                      .fontSize(Constants.TEXT_MIDDLE_FONT_SIZE)
-                      .fontWeight(FontWeight.Medium)
-                      .fontColor($r('app.color.label_color'))
-                      .lineHeight(Constants.TEXT_LINE_HEIGHT)
-                      .margin({ bottom: Constants.TERTIARY_LABEL_MARGIN_BOTTOM })
-                    Text(this.strings.visits + permission['count' + item.accessTokenId]
-                        + this.strings.recent_visit + this.getTime(permission['lastTime' + item.accessTokenId]))
-                      .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
-                      .fontColor($r('app.color.label_color_light'))
-                      .lineHeight(Constants.TEXT_SMALL_LINE_HEIGHT)
-                  }.alignItems(HorizontalAlign.Start)
-                  .height(Constants.FULL_HEIGHT)
-                }
-              }.height(Constants.LISTITEM_HEIGHT_PERMISSION)
-              .onClick(() => {
-                router.push({
-                  uri: 'pages/application-secondary',
-                  params: { routerData: {
-                    'bundleName': item.name,
-                    'tokenId': item.accessTokenId,
-                    'iconId': item.icon,
-                    'labelId': item.groupName,
-                    'permissions': item.reqUserPermissions,
-                    'groupId': item.groupIds
-                  } }
-                });
-              })
-            })
-          }
-        }
-      }
-    }.padding({ left: Constants.DEFAULT_PADDING_START, right: Constants.DEFAULT_PADDING_END,
-      top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
-    .margin({ bottom: Constants.LISTITEM_MARGIN_BOTTOM })
-    .backgroundColor($r('app.color.default_background_color'))
-    .borderRadius(Constants.BORDER_RADIUS)
-  }
-
-  build() {
-    GridContainer({ gutter: Constants.GUTTER, margin: Constants.GRID_MARGIN }) {
-      Row() {
-        Row()
-          .useSizeType({
-            xs: { span: Constants.LEFT_XS_SPAN, offset: Constants.LEFT_XS_OFFSET },
-            sm: { span: Constants.LEFT_SM_SPAN, offset: Constants.LEFT_SM_OFFSET },
-            md: { span: Constants.LEFT_MD_SPAN, offset: Constants.LEFT_MD_OFFSET },
-            lg: { span: Constants.LEFT_LG_SPAN, offset: Constants.LEFT_LG_OFFSET }
-          })
-          .height(Constants.FULL_HEIGHT)
-        Row() {
-          Column() {
-            Row() {
-              backBar( { title: JSON.stringify($r('app.string.permission_access_record')), recordable: false })
-            }
-            Row() {
-              Column() {
-                Column() {
-                  Flex({ justifyContent: FlexAlign.Start }) {
-                    Text($r('app.string.record_time_limit'))
-                      .margin({ left: Constants.BACKBAR_IMAGE_MARGIN_LEFT })
-                      .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
-                      .fontColor($r('app.color.label_color_light'))
-                      .lineHeight(Constants.SUBTITLE_LINE_HEIGHT)
-                  }.constraintSize({ minHeight: Constants.SUBTITLE_MIN_HEIGHT })
-                  .padding({ top: Constants.SUBTITLE_PADDING_TOP, bottom: Constants.SUBTITLE_PADDING_BOTTOM })
-                  if(this.groups.length) {
-                    Stack() {
-                      Tabs() {
-                        TabContent() {
-                          Row() {
-                            Column() {
-                              Scroll() {
-                                Row() {
-                                  List() {
-                                    ForEach(this.groups, (item, index) => {
-                                      this.ListItemLayout(item, index, Constants.PERMISSION)
-                                    }, item => item.toString())
-                                  }.padding({ top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
-                                }.padding({
-                                  left: Constants.MANAGEMENT_ROW_PADDING_LEFT,
-                                  right: Constants.MANAGEMENT_ROW_PADDING_RIGHT,
-                                  top: Constants.MANAGEMENT_ROW_PADDING_TOP
-                                })
-                              }.scrollBar(BarState.Off)
-                            }.width(Constants.FULL_WIDTH)
-                          }
-                        }.tabBar(this.TabBuilder(0))
-                        TabContent() {
-                          Row() {
-                            Column() {
-                              Scroll() {
-                                Row() {
-                                  List() {
-                                    ForEach(this.applicationInfos, (item, index) => {
-                                      this.ListItemLayout(item, index, Constants.APPLICATION)
-                                    }, item => item.toString())
-                                  }.padding({ top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
-                                }.padding({
-                                  left: Constants.MANAGEMENT_ROW_PADDING_LEFT,
-                                  right: Constants.MANAGEMENT_ROW_PADDING_RIGHT,
-                                  top: Constants.MANAGEMENT_ROW_PADDING_TOP
-                                })
-                              }.scrollBar(BarState.Off)
-                            }.width(Constants.FULL_WIDTH)
-                          }
-                        }.tabBar(this.TabBuilder(1))
-                      }
-                      .barWidth(Constants.BAR_WIDTH)
-                      .barMode(BarMode.Fixed)
-                      .onChange((index) => {
-                        this.currentIndex = index
-                      })
-                    }.height(Constants.FULL_HEIGHT)
-                  }else {
-                    Flex({ justifyContent: FlexAlign.Center, alignItems: ItemAlign.Center, direction: FlexDirection.Column }) {
-                      Image($r('app.media.noRecord'))
-                        .customizeImage(Constants.NORECORD_IMAGE_WIDTH, Constants.NORECORD_IMAGE_HEIGHT)
-                        .margin({ left: Constants.NORECORD_IMAGE_MARGIN_LEFT })
-                      Text($r('app.string.no_record')).margin({ top: Constants.DIALOG_REQ_MARGIN_TOP })
-                        .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
-                        .fontColor($r('app.color.label_color_light'))
-                    }.width(Constants.FULL_WIDTH).height(Constants.FULL_HEIGHT)
-                    .padding({ bottom: Constants.RECORD_PADDING_BOTTOM })
-                  }
-                }
-              }
-            }
-            .layoutWeight(Constants.LAYOUT_WEIGHT)
-          }
-        }
-        .useSizeType({
-          xs: { span: Constants.MIDDLE_XS_SPAN, offset: Constants.MIDDLE_XS_OFFSET },
-          sm: { span: Constants.MIDDLE_SM_SPAN, offset: Constants.MIDDLE_SM_OFFSET },
-          md: { span: Constants.MIDDLE_MD_SPAN, offset: Constants.MIDDLE_MD_OFFSET },
-          lg: { span: Constants.MIDDLE_LG_SPAN, offset: Constants.MIDDLE_LG_OFFSET }
-        })
-        .height(Constants.FULL_HEIGHT)
-        Row()
-          .useSizeType({
-            xs: { span: Constants.RIGHT_XS_SPAN, offset: Constants.RIGHT_XS_OFFSET },
-            sm: { span: Constants.RIGHT_SM_SPAN, offset: Constants.RIGHT_SM_OFFSET },
-            md: { span: Constants.RIGHT_MD_SPAN, offset: Constants.RIGHT_MD_OFFSET },
-            lg: { span: Constants.RIGHT_LG_SPAN, offset: Constants.RIGHT_LG_OFFSET }
-          })
-          .height(Constants.FULL_HEIGHT)
-      }
-      .height(Constants.FULL_HEIGHT)
-      .width(Constants.FULL_WIDTH)
-      .backgroundColor($r("sys.color.ohos_id_color_sub_background"))
-      .opacity(Constants.MANAGEMENT_TRANSPARENCY)
-    }
-  }
-
-  /**
-   * Get time
-   * @param {Number} The time stamp
-   */
-  getTime(time, format='MM月DD日 NNHH:mm') {
-    if(this.strings.morning == 'am') { format = 'MM/DD HH:mm NN' }
-    let date = new Date(time * 1000)
-    let config = {
-      MM: date.getMonth() + 1,
-      DD: date.getDate(),
-      NN: date.getHours() >= 12 ? this.strings.afternoon : this.strings.morning,
-      HH: date.getHours() >= 12 ? date.getHours() - 12 : date.getHours(),
-      mm: date.getMinutes() > 10 ? date.getMinutes() : '0' + date.getMinutes(),
-    }
-
-    for(const key in config){
-      format = format.replace(key,config[key])
-    }
-    return format
-  }
-
-  /**
-   * Get application record info
-   * @param {Object} application info
-   * @param {String} groupName
-   * @param {Boolean} true: count, false: lastTime
-   */
-  getAppRecords(appInfo, groupName, option) {
-    var record = appInfo.permissions.filter(permission => {
-      return permission.groupName == groupName
-    })
-    return option ? record[0]['count' + appInfo.accessTokenId] : record[0]['lastTime' + appInfo.accessTokenId]
-  }
-
-  getStrings() {
-    Resmgr.getResourceManager(globalThis.context, Constants.BUNDLE_NAME).then(item => {
-      item.getString($r("app.string.visits").id, (err, val) => {
-        this.strings.visits = val
-      })
-      item.getString($r("app.string.recent_visit").id, (err, val) => {
-        this.strings.recent_visit = val
-      })
-      item.getString($r("app.string.morning").id, (err, val) => {
-        this.strings.morning = val
-      })
-      item.getString($r("app.string.afternoon").id, (err, val) => {
-        this.strings.afternoon = val
-      })
-    }).catch(error => {
-      console.error(TAG + 'Resmgr.getResourceManager failed. Cause: ' + JSON.stringify(error));
-    })
-  }
-
-  getInfo(record, sortFlag) {
-    bundle.getBundleInfo(record.bundleName, Constants.PARMETER_BUNDLE_FLAG).then(async info => {
-      var reqUserPermissions: string[] = [];
-      var reqUserRecords: any[] = [];
-      var permissionGroups: any[] = [];
-      var acManager = abilityAccessCtrl.createAtManager()
-      var appInfo: any = {}
-      for (let j = 0; j < record.permissionRecords.length; j++) {
-        var permission = record.permissionRecords[j].permissionName;
-        var flag = await acManager.getPermissionFlags(info.appInfo.accessTokenId, permission)
-        if(flag == Constants.PRE_AUTHORIZATION_NOT_MODIFIED) {
-          continue
-        }
-        if (userGrantPermissions.indexOf(permission) != -1) {
-          reqUserRecords.push(record.permissionRecords[j])
-        }
-      }
-      for (let k = 0; k < info.reqPermissions.length; k++) {
-        var reqPermission = info.reqPermissions[k];
-        var reqFlag = await acManager.getPermissionFlags(info.appInfo.accessTokenId, reqPermission)
-        if(reqFlag == Constants.PRE_AUTHORIZATION_NOT_MODIFIED) {
-          continue
-        }
-        if (userGrantPermissions.indexOf(reqPermission) != -1) {
-          reqUserPermissions.push(reqPermission);
-        }
-      }
-
-      let groupNames = [];
-      let appLastTime = 0;
-      reqUserRecords.forEach(reqUserRecord => {
-        var group = getPermissionGroup(reqUserRecord.permissionName)
-        if(!group) {
-          console.info(TAG + "permission not find:" + reqUserRecord.permissionName)
-        }else {
-          var existing = permissionGroups.find(permissionGroup => permissionGroup.name == group.name)
-          var lastTime = reqUserRecord.lastAccessTime
-          lastTime > appLastTime ? appLastTime = lastTime : ''
-          if(!existing) {
-            group['count' + record.tokenId] = reqUserRecord.accessCount
-            group['lastTime' + record.tokenId] = lastTime
-            permissionGroups.push(group)
-            groupNames.push(group.groupName)
-          }else {
-            existing['count' + record.tokenId] += reqUserRecord.accessCount
-            lastTime > existing['lastTime' + record.tokenId] ? existing['lastTime' + record.tokenId] = lastTime : ''
-          }
-        }
-      })
-
-      let groupIds = [];
-      for (let i = 0; i < reqUserPermissions.length; i++) {
-        if(groupIds.indexOf(permissionGroupIds[reqUserPermissions[i]]) == -1){
-          groupIds.push(permissionGroupIds[reqUserPermissions[i]]);
-        }
-      }
-
-      await Resmgr.getResourceManager(globalThis.context, info.name).then(item => {
-        item.getString(info.appInfo['labelId'], (error, value) => {
-          if (value == undefined) {
-            appInfo['groupName'] = info.appInfo.label;
-          } else {
-            appInfo['groupName'] = value;
-          }
-        })
-
-        item.getMediaBase64(info.appInfo['iconId'], (error, value) => {
-          appInfo['icon'] = value;
-        })
-      })
-
-      appInfo.name = info.appInfo.name
-      appInfo.accessTokenId = info.appInfo.accessTokenId
-      appInfo.reqUserPermissions = reqUserPermissions
-      appInfo.permissions = permissionGroups
-      appInfo.groupNames = groupNames
-      appInfo.groupIds = groupIds
-      appInfo.appLastTime = appLastTime
-      this.applicationInfos.push(appInfo)
-      if(sortFlag) {
-        var appInfos: any[] = []
-        this.applicationInfos.forEach(item => { appInfos.push(item) })
-        appInfos.sort((a, b) => { return b.appLastTime - a.appLastTime })
-        this.applicationInfos = appInfos
-      }
-    })
-  }
-
-  getAllRecords() {
-    let request = {
-      "tokenId": 0,
-      "isRemote": false,
-      "permissionNames": [],
-      "beginTime": 0,
-      "endTime": 0,
-      "flag": 1
-    }
-    privacyManager.getPermissionUsedRecords(request).then(async records => {
-      console.info(TAG + "records: " + JSON.stringify(records.bundleRecords))
-      var groupArray: any[] = []
-      for (let i = 0; i < records.bundleRecords.length; i++) {
-        var record = records.bundleRecords[i]
-        try {
-          const ret = await bundle.queryAbilityByWant({
-            bundleName: record.bundleName,
-            action: "action.system.home",
-            entities: ["entity.system.home"]
-          }, bundle.BundleFlag.GET_ABILITY_INFO_WITH_APPLICATION, Constants.USERID);
-        } catch(e) {
-          continue;
-        }
-        if (noNeedDisplayApp.indexOf(record.bundleName) != -1) {
-          continue;
-        }
-        console.info(TAG + "record: " + JSON.stringify(record))
-        this.getInfo(record, (i + 1) == records.bundleRecords.length)
-
-        record.permissionRecords.forEach(permissionRecord => {
-          var group = getPermissionGroup(permissionRecord.permissionName)
-          if(group) {
-            var exist = groupArray.find(permissionGroup => permissionGroup.name == group.name)
-            var lastTime = permissionRecord.lastAccessTime
-            if(!exist) {
-              group.sum = permissionRecord.accessCount
-              group.recentVisit = lastTime
-              groupArray.push(group)
-            }else {
-              exist.sum += permissionRecord.accessCount
-              lastTime > exist.recentVisit ? exist.recentVisit = lastTime : ''
-            }
-          }
-        })
-      }
-      groupArray.sort((a, b) => { return b.recentVisit - a.recentVisit })
-      this.groups = groupArray
-    })
-  }
-
-  aboutToAppear() {
-    this.getStrings()
-    this.getAllRecords()
-  }
-}
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+import bundle from '@ohos.bundle';
+import router from '@system.router';
+import Resmgr from '@ohos.resourceManager'
+import abilityAccessCtrl from '@ohos.abilityAccessCtrl';
+import privacyManager from '@ohos.privacyManager'
+import { backBar } from "../common/components/backBar";
+import Constants from '../common/utils/constant';
+import { noNeedDisplayApp, userGrantPermissions, permissionGroupIds } from "../common/model/permissionGroup";
+import { getPermissionGroup } from '../common/utils/utils'
+
+var TAG = 'PermissionManager_MainAbility:'
+
+@Extend(Image) function customizeImage(width: number, height: number) {
+  .objectFit(ImageFit.Contain)
+  .width(width)
+  .height(height)
+};
+
+@Entry
+@Component
+struct permissionRecordPage {
+  @State groups: any[] = []
+  @State applicationInfos: any[] = []
+  @State permissionApplications: any[] = []
+  @State permissionIndex: number = -1
+  @State applicationIndex: number = -1
+  @State strings: any = {}
+  @State currentIndex: number = 0
+  @Builder TabBuilder(index: number) {
+    Flex({ alignItems: ItemAlign.Center, justifyContent: FlexAlign.Center }) {
+      Text(index ? $r('app.string.application') : $r('app.string.authority'))
+        .fontColor(this.currentIndex == index ? $r('app.color.button_color') : $r('app.color.label_color'))
+        .fontWeight(this.currentIndex == index ? FontWeight.Bold : FontWeight.Regular)
+        .lineHeight(Constants.TEXT_LINE_HEIGHT)
+      if(this.currentIndex == index) {
+        Row().width(Constants.FULL_WIDTH).height(Constants.TAB_DECORATION_HEIGHT)
+          .backgroundColor($r('app.color.button_color'))
+          .position({ y: Constants.TAB_DECORATION_POSITION_Y })
+      }
+    }.height(Constants.TAB_HEIGHT)
+  }
+
+  @Builder ListItemLayout(item, index, dimension) {
+    ListItem() {
+      Column() {
+        Column() {
+          Flex({ justifyContent: FlexAlign.Start, alignItems: ItemAlign.Center }) {
+            Row() {
+              if(dimension) {
+                Image(item.icon)
+                  .customizeImage(Constants.MANAGEMENT_IMAGE_WIDTH, Constants.MANAGEMENT_IMAGE_HEIGHT)
+                  .margin({ right: Constants.MANAGEMENT_IMAGE_MARGIN_RIGHT_RECORD, left: Constants.MANAGEMENT_IMAGE_MARGIN_LEFT })
+              }else {
+                Image(item.icon)
+                  .customizeImage(Constants.APPLICATION_IMAGE_WIDTH, Constants.APPLICATION_IMAGE_HEIGHT)
+                  .margin({ right: Constants.MANAGEMENT_IMAGE_MARGIN_RIGHT })
+              }
+              Column() {
+                Text(item.groupName)
+                  .fontSize(Constants.TEXT_MIDDLE_FONT_SIZE)
+                  .fontWeight(FontWeight.Medium)
+                  .fontColor($r('app.color.label_color'))
+                  .lineHeight(Constants.TEXT_LINE_HEIGHT)
+                  .margin({ bottom: Constants.TERTIARY_LABEL_MARGIN_BOTTOM })
+                if(dimension) {
+                  Text(this.strings.visits + item.sum)
+                    .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
+                    .fontColor($r('app.color.label_color_light'))
+                    .lineHeight(Constants.TEXT_SMALL_LINE_HEIGHT)
+                }else {
+                  Row() {
+                    if (item.permissions) {
+                      ForEach(item.permissions, permission => {
+                        Image(permission.icon)
+                          .customizeImage(Constants.IMAGE_WIDTH_RECORD_APPLICATION, Constants.IMAGE_HEIGHT_RECORD_APPLICATION)
+                          .margin({ right: Constants.APPLICATION_TEXT_MARGIN_RIGHT })
+                      })
+                    }
+                  }
+                }
+              }.flexGrow(Constants.FLEX_GROW)
+              .alignItems(HorizontalAlign.Start)
+              if(dimension) {
+                if(index == this.permissionIndex) {
+                  Image($r('app.media.xiangshangjiantou'))
+                    .customizeImage(Constants.IMAGE_WIDTH_RECORD, Constants.IMAGE_HEIGHT_RECORD)
+                }else {
+                  Image($r('app.media.xiangxiajiantou'))
+                    .customizeImage(Constants.IMAGE_WIDTH_RECORD, Constants.IMAGE_HEIGHT_RECORD)
+                }
+              }else {
+                if(index == this.applicationIndex) {
+                  Image($r('app.media.xiangshangjiantou'))
+                    .customizeImage(Constants.IMAGE_WIDTH_RECORD, Constants.IMAGE_HEIGHT_RECORD)
+                }else {
+                  Image($r('app.media.xiangxiajiantou'))
+                    .customizeImage(Constants.IMAGE_WIDTH_RECORD, Constants.IMAGE_HEIGHT_RECORD)
+                }
+              }
+            }
+            .width(Constants.FULL_WIDTH)
+            .height(dimension ? Constants.LISTITEM_HEIGHT_PERMISSION : Constants.LISTITEM_HEIGHT_APPLICATION)
+          }
+        }.onClick(() => {
+          dimension ?
+            (this.permissionIndex = this.permissionIndex == index ? -1 : index) :
+            (this.applicationIndex = this.applicationIndex == index ? -1 : index)
+          if(dimension) {
+            this.permissionApplications = this.applicationInfos.filter(appInfo => {
+              return appInfo.groupNames.includes(item.groupName)
+            })
+          }
+        })
+        if(dimension && (index == this.permissionIndex)) {
+          List() {
+            ForEach(this.permissionApplications, (permissionApplication) => {
+              ListItem() {
+                Row() {
+                  Image(permissionApplication.icon)
+                    .customizeImage(Constants.APPLICATION_IMAGE_WIDTH, Constants.APPLICATION_IMAGE_HEIGHT)
+                    .margin({ right: Constants.MANAGEMENT_IMAGE_MARGIN_RIGHT })
+                  Column() {
+                    Row().width(Constants.FULL_WIDTH).height(Constants.TEXT_DECORATION_HEIGHT)
+                      .backgroundColor($r("app.color.label_color_lightest"))
+                      .margin({ bottom: Constants.LISTITEM_MARGIN_BOTTOM_PERMISSION })
+                    Text(permissionApplication.groupName)
+                      .fontSize(Constants.TEXT_MIDDLE_FONT_SIZE)
+                      .fontWeight(FontWeight.Medium)
+                      .fontColor($r('app.color.label_color'))
+                      .lineHeight(Constants.TEXT_LINE_HEIGHT)
+                      .margin({ bottom: Constants.TERTIARY_LABEL_MARGIN_BOTTOM })
+                    Text(this.strings.visits + this.getAppRecords(permissionApplication, item.groupName, true) +
+                        this.strings.recent_visit + this.getTime(this.getAppRecords(permissionApplication, item.groupName, false)))
+                      .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
+                      .fontColor($r('app.color.label_color_light'))
+                      .lineHeight(Constants.TEXT_SMALL_LINE_HEIGHT)
+                  }.alignItems(HorizontalAlign.Start)
+                  .height(Constants.FULL_HEIGHT)
+                }
+              }.height(Constants.LISTITEM_HEIGHT_APPLICATION)
+              .onClick(() => {
+                router.push({
+                  uri: 'pages/application-secondary',
+                  params: { routerData: {
+                    'bundleName': permissionApplication.name,
+                    'tokenId': permissionApplication.accessTokenId,
+                    'iconId': permissionApplication.icon,
+                    'labelId': permissionApplication.groupName,
+                    'permissions': permissionApplication.reqUserPermissions,
+                    'groupId': permissionApplication.groupIds
+                  } }
+                });
+              })
+            })
+          }
+        }
+        if(!dimension && (index == this.applicationIndex)) {
+          List() {
+            ForEach(item.permissions, (permission) => {
+              ListItem() {
+                Row() {
+                  Image(permission.icon)
+                    .customizeImage(Constants.MANAGEMENT_IMAGE_WIDTH, Constants.MANAGEMENT_IMAGE_HEIGHT)
+                    .margin({ right: Constants.MANAGEMENT_IMAGE_MARGIN_RIGHT_RECORD, left: Constants.MANAGEMENT_IMAGE_MARGIN_LEFT })
+                  Column() {
+                    Row().width(Constants.FULL_WIDTH).height(Constants.TEXT_DECORATION_HEIGHT)
+                      .backgroundColor($r("app.color.label_color_lightest"))
+                      .margin({ bottom: Constants.LISTITEM_MARGIN_BOTTOM_APPLICATION })
+                    Text(permission.groupName)
+                      .fontSize(Constants.TEXT_MIDDLE_FONT_SIZE)
+                      .fontWeight(FontWeight.Medium)
+                      .fontColor($r('app.color.label_color'))
+                      .lineHeight(Constants.TEXT_LINE_HEIGHT)
+                      .margin({ bottom: Constants.TERTIARY_LABEL_MARGIN_BOTTOM })
+                    Text(this.strings.visits + permission['count' + item.accessTokenId]
+                        + this.strings.recent_visit + this.getTime(permission['lastTime' + item.accessTokenId]))
+                      .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
+                      .fontColor($r('app.color.label_color_light'))
+                      .lineHeight(Constants.TEXT_SMALL_LINE_HEIGHT)
+                  }.alignItems(HorizontalAlign.Start)
+                  .height(Constants.FULL_HEIGHT)
+                }
+              }.height(Constants.LISTITEM_HEIGHT_PERMISSION)
+              .onClick(() => {
+                router.push({
+                  uri: 'pages/application-secondary',
+                  params: { routerData: {
+                    'bundleName': item.name,
+                    'tokenId': item.accessTokenId,
+                    'iconId': item.icon,
+                    'labelId': item.groupName,
+                    'permissions': item.reqUserPermissions,
+                    'groupId': item.groupIds
+                  } }
+                });
+              })
+            })
+          }
+        }
+      }
+    }.padding({ left: Constants.DEFAULT_PADDING_START, right: Constants.DEFAULT_PADDING_END,
+      top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
+    .margin({ bottom: Constants.LISTITEM_MARGIN_BOTTOM })
+    .backgroundColor($r('app.color.default_background_color'))
+    .borderRadius(Constants.BORDER_RADIUS)
+  }
+
+  build() {
+    GridContainer({ gutter: Constants.GUTTER, margin: Constants.GRID_MARGIN }) {
+      Row() {
+        Row()
+          .useSizeType({
+            xs: { span: Constants.LEFT_XS_SPAN, offset: Constants.LEFT_XS_OFFSET },
+            sm: { span: Constants.LEFT_SM_SPAN, offset: Constants.LEFT_SM_OFFSET },
+            md: { span: Constants.LEFT_MD_SPAN, offset: Constants.LEFT_MD_OFFSET },
+            lg: { span: Constants.LEFT_LG_SPAN, offset: Constants.LEFT_LG_OFFSET }
+          })
+          .height(Constants.FULL_HEIGHT)
+        Row() {
+          Column() {
+            Row() {
+              backBar( { title: JSON.stringify($r('app.string.permission_access_record')), recordable: false })
+            }
+            Row() {
+              Column() {
+                Column() {
+                  Flex({ justifyContent: FlexAlign.Start }) {
+                    Text($r('app.string.record_time_limit'))
+                      .margin({ left: Constants.BACKBAR_IMAGE_MARGIN_LEFT })
+                      .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
+                      .fontColor($r('app.color.label_color_light'))
+                      .lineHeight(Constants.SUBTITLE_LINE_HEIGHT)
+                  }.constraintSize({ minHeight: Constants.SUBTITLE_MIN_HEIGHT })
+                  .padding({ top: Constants.SUBTITLE_PADDING_TOP, bottom: Constants.SUBTITLE_PADDING_BOTTOM })
+                  if(this.groups.length) {
+                    Stack() {
+                      Tabs() {
+                        TabContent() {
+                          Row() {
+                            Column() {
+                              Scroll() {
+                                Row() {
+                                  List() {
+                                    ForEach(this.groups, (item, index) => {
+                                      this.ListItemLayout(item, index, Constants.PERMISSION)
+                                    }, item => item.toString())
+                                  }.padding({ top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
+                                }.padding({
+                                  left: Constants.MANAGEMENT_ROW_PADDING_LEFT,
+                                  right: Constants.MANAGEMENT_ROW_PADDING_RIGHT,
+                                  top: Constants.MANAGEMENT_ROW_PADDING_TOP
+                                })
+                              }.scrollBar(BarState.Off)
+                            }.width(Constants.FULL_WIDTH)
+                          }
+                        }.tabBar(this.TabBuilder(0))
+                        TabContent() {
+                          Row() {
+                            Column() {
+                              Scroll() {
+                                Row() {
+                                  List() {
+                                    ForEach(this.applicationInfos, (item, index) => {
+                                      this.ListItemLayout(item, index, Constants.APPLICATION)
+                                    }, item => item.toString())
+                                  }.padding({ top: Constants.LIST_PADDING_TOP, bottom: Constants.LIST_PADDING_BOTTOM })
+                                }.padding({
+                                  left: Constants.MANAGEMENT_ROW_PADDING_LEFT,
+                                  right: Constants.MANAGEMENT_ROW_PADDING_RIGHT,
+                                  top: Constants.MANAGEMENT_ROW_PADDING_TOP
+                                })
+                              }.scrollBar(BarState.Off)
+                            }.width(Constants.FULL_WIDTH)
+                          }
+                        }.tabBar(this.TabBuilder(1))
+                      }
+                      .barWidth(Constants.BAR_WIDTH)
+                      .barMode(BarMode.Fixed)
+                      .onChange((index) => {
+                        this.currentIndex = index
+                      })
+                    }.height(Constants.FULL_HEIGHT)
+                  }else {
+                    Flex({ justifyContent: FlexAlign.Center, alignItems: ItemAlign.Center, direction: FlexDirection.Column }) {
+                      Image($r('app.media.noRecord'))
+                        .customizeImage(Constants.NORECORD_IMAGE_WIDTH, Constants.NORECORD_IMAGE_HEIGHT)
+                        .margin({ left: Constants.NORECORD_IMAGE_MARGIN_LEFT })
+                      Text($r('app.string.no_record')).margin({ top: Constants.DIALOG_REQ_MARGIN_TOP })
+                        .fontSize(Constants.TEXT_SMAL_FONT_SIZE)
+                        .fontColor($r('app.color.label_color_light'))
+                    }.width(Constants.FULL_WIDTH).height(Constants.FULL_HEIGHT)
+                    .padding({ bottom: Constants.RECORD_PADDING_BOTTOM })
+                  }
+                }
+              }
+            }
+            .layoutWeight(Constants.LAYOUT_WEIGHT)
+          }
+        }
+        .useSizeType({
+          xs: { span: Constants.MIDDLE_XS_SPAN, offset: Constants.MIDDLE_XS_OFFSET },
+          sm: { span: Constants.MIDDLE_SM_SPAN, offset: Constants.MIDDLE_SM_OFFSET },
+          md: { span: Constants.MIDDLE_MD_SPAN, offset: Constants.MIDDLE_MD_OFFSET },
+          lg: { span: Constants.MIDDLE_LG_SPAN, offset: Constants.MIDDLE_LG_OFFSET }
+        })
+        .height(Constants.FULL_HEIGHT)
+        Row()
+          .useSizeType({
+            xs: { span: Constants.RIGHT_XS_SPAN, offset: Constants.RIGHT_XS_OFFSET },
+            sm: { span: Constants.RIGHT_SM_SPAN, offset: Constants.RIGHT_SM_OFFSET },
+            md: { span: Constants.RIGHT_MD_SPAN, offset: Constants.RIGHT_MD_OFFSET },
+            lg: { span: Constants.RIGHT_LG_SPAN, offset: Constants.RIGHT_LG_OFFSET }
+          })
+          .height(Constants.FULL_HEIGHT)
+      }
+      .height(Constants.FULL_HEIGHT)
+      .width(Constants.FULL_WIDTH)
+      .backgroundColor($r("sys.color.ohos_id_color_sub_background"))
+      .opacity(Constants.MANAGEMENT_TRANSPARENCY)
+    }
+  }
+
+  /**
+   * Get time
+   * @param {Number} The time stamp
+   */
+  getTime(time, format='MM月DD日 NNHH:mm') {
+    if(this.strings.morning == 'am') { format = 'MM/DD HH:mm NN' }
+    let date = new Date(time * 1000)
+    let config = {
+      MM: date.getMonth() + 1,
+      DD: date.getDate(),
+      NN: date.getHours() >= 12 ? this.strings.afternoon : this.strings.morning,
+      HH: date.getHours() >= 12 ? date.getHours() - 12 : date.getHours(),
+      mm: date.getMinutes() > 10 ? date.getMinutes() : '0' + date.getMinutes(),
+    }
+
+    for(const key in config){
+      format = format.replace(key,config[key])
+    }
+    return format
+  }
+
+  /**
+   * Get application record info
+   * @param {Object} application info
+   * @param {String} groupName
+   * @param {Boolean} true: count, false: lastTime
+   */
+  getAppRecords(appInfo, groupName, option) {
+    var record = appInfo.permissions.filter(permission => {
+      return permission.groupName == groupName
+    })
+    return option ? record[0]['count' + appInfo.accessTokenId] : record[0]['lastTime' + appInfo.accessTokenId]
+  }
+
+  getStrings() {
+    Resmgr.getResourceManager(globalThis.context, Constants.BUNDLE_NAME).then(item => {
+      item.getString($r("app.string.visits").id, (err, val) => {
+        this.strings.visits = val
+      })
+      item.getString($r("app.string.recent_visit").id, (err, val) => {
+        this.strings.recent_visit = val
+      })
+      item.getString($r("app.string.morning").id, (err, val) => {
+        this.strings.morning = val
+      })
+      item.getString($r("app.string.afternoon").id, (err, val) => {
+        this.strings.afternoon = val
+      })
+    }).catch(error => {
+      console.error(TAG + 'Resmgr.getResourceManager failed. Cause: ' + JSON.stringify(error));
+    })
+  }
+
+  getInfo(record, sortFlag) {
+    bundle.getBundleInfo(record.bundleName, Constants.PARMETER_BUNDLE_FLAG).then(async info => {
+      var reqUserPermissions: string[] = [];
+      var reqUserRecords: any[] = [];
+      var permissionGroups: any[] = [];
+      var acManager = abilityAccessCtrl.createAtManager()
+      var appInfo: any = {}
+      for (let j = 0; j < record.permissionRecords.length; j++) {
+        var permission = record.permissionRecords[j].permissionName;
+        var flag = await acManager.getPermissionFlags(info.appInfo.accessTokenId, permission)
+        if(flag == Constants.PRE_AUTHORIZATION_NOT_MODIFIED) {
+          continue
+        }
+        if (userGrantPermissions.indexOf(permission) != -1) {
+          reqUserRecords.push(record.permissionRecords[j])
+        }
+      }
+      for (let k = 0; k < info.reqPermissions.length; k++) {
+        var reqPermission = info.reqPermissions[k];
+        var reqFlag = await acManager.getPermissionFlags(info.appInfo.accessTokenId, reqPermission)
+        if(reqFlag == Constants.PRE_AUTHORIZATION_NOT_MODIFIED) {
+          continue
+        }
+        if (userGrantPermissions.indexOf(reqPermission) != -1) {
+          reqUserPermissions.push(reqPermission);
+        }
+      }
+
+      let groupNames = [];
+      let appLastTime = 0;
+      reqUserRecords.forEach(reqUserRecord => {
+        var group = getPermissionGroup(reqUserRecord.permissionName)
+        if(!group) {
+          console.info(TAG + "permission not find:" + reqUserRecord.permissionName)
+        }else {
+          var existing = permissionGroups.find(permissionGroup => permissionGroup.name == group.name)
+          var lastTime = reqUserRecord.lastAccessTime
+          lastTime > appLastTime ? appLastTime = lastTime : ''
+          if(!existing) {
+            group['count' + record.tokenId] = reqUserRecord.accessCount
+            group['lastTime' + record.tokenId] = lastTime
+            permissionGroups.push(group)
+            groupNames.push(group.groupName)
+          }else {
+            existing['count' + record.tokenId] += reqUserRecord.accessCount
+            lastTime > existing['lastTime' + record.tokenId] ? existing['lastTime' + record.tokenId] = lastTime : ''
+          }
+        }
+      })
+
+      let groupIds = [];
+      for (let i = 0; i < reqUserPermissions.length; i++) {
+        if(groupIds.indexOf(permissionGroupIds[reqUserPermissions[i]]) == -1){
+          groupIds.push(permissionGroupIds[reqUserPermissions[i]]);
+        }
+      }
+
+      await Resmgr.getResourceManager(globalThis.context, info.name).then(item => {
+        item.getString(info.appInfo['labelId'], (error, value) => {
+          if (value == undefined) {
+            appInfo['groupName'] = info.appInfo.label;
+          } else {
+            appInfo['groupName'] = value;
+          }
+        })
+
+        item.getMediaBase64(info.appInfo['iconId'], (error, value) => {
+          appInfo['icon'] = value;
+        })
+      })
+
+      appInfo.name = info.appInfo.name
+      appInfo.accessTokenId = info.appInfo.accessTokenId
+      appInfo.reqUserPermissions = reqUserPermissions
+      appInfo.permissions = permissionGroups
+      appInfo.groupNames = groupNames
+      appInfo.groupIds = groupIds
+      appInfo.appLastTime = appLastTime
+      this.applicationInfos.push(appInfo)
+      if(sortFlag) {
+        var appInfos: any[] = []
+        this.applicationInfos.forEach(item => { appInfos.push(item) })
+        appInfos.sort((a, b) => { return b.appLastTime - a.appLastTime })
+        this.applicationInfos = appInfos
+      }
+    })
+  }
+
+  getAllRecords() {
+    let request = {
+      "tokenId": 0,
+      "isRemote": false,
+      "permissionNames": [],
+      "beginTime": 0,
+      "endTime": 0,
+      "flag": 1
+    }
+    privacyManager.getPermissionUsedRecords(request).then(async records => {
+      console.info(TAG + "records: " + JSON.stringify(records.bundleRecords))
+      var groupArray: any[] = []
+      for (let i = 0; i < records.bundleRecords.length; i++) {
+        var record = records.bundleRecords[i]
+        try {
+          const ret = await bundle.queryAbilityByWant({
+            bundleName: record.bundleName,
+            action: "action.system.home",
+            entities: ["entity.system.home"]
+          }, bundle.BundleFlag.GET_ABILITY_INFO_WITH_APPLICATION, Constants.USERID);
+        } catch(e) {
+          continue;
+        }
+        if (noNeedDisplayApp.indexOf(record.bundleName) != -1) {
+          continue;
+        }
+        console.info(TAG + "record: " + JSON.stringify(record))
+        this.getInfo(record, (i + 1) == records.bundleRecords.length)
+
+        record.permissionRecords.forEach(permissionRecord => {
+          var group = getPermissionGroup(permissionRecord.permissionName)
+          if(group) {
+            var exist = groupArray.find(permissionGroup => permissionGroup.name == group.name)
+            var lastTime = permissionRecord.lastAccessTime
+            if(!exist) {
+              group.sum = permissionRecord.accessCount
+              group.recentVisit = lastTime
+              groupArray.push(group)
+            }else {
+              exist.sum += permissionRecord.accessCount
+              lastTime > exist.recentVisit ? exist.recentVisit = lastTime : ''
+            }
+          }
+        })
+      }
+      groupArray.sort((a, b) => { return b.recentVisit - a.recentVisit })
+      this.groups = groupArray
+    })
+  }
+
+  aboutToAppear() {
+    this.getStrings()
+    this.getAllRecords()
+  }
+}
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/module.json5 b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/module.json5
index 321012a87b49e95d14594c2c1bad781d16e7e044..a94e682c0be8c9b9b4318e482118b39e131fc70f 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/module.json5
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/module.json5
@@ -1,71 +1,71 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-{
-    "module": {
-        "name": "permissionmanager",
-        "type": "feature",
-        "srcEntrance": "./ets/Application/AbilityStage.ts",
-        "description": "$string:permissionmanager_desc",
-        "mainElement": "MainAbility",
-        "deviceTypes": [
-            "phone"
-        ],
-        "deliveryWithInstall": true,
-        "installationFree": false,
-        "pages": "$profile:main_pages",
-        "uiSyntax": "ets",
-        "abilities": [
-            {
-                "name": "com.ohos.permissionmanager.MainAbility",
-                "srcEntrance": "./ets/MainAbility/MainAbility.ts",
-                "description": "$string:MainAbility_desc",
-                "icon": "$media:icon",
-                "label": "$string:MainAbility_label",
-                "visible": true,
-                "launchType": "standard"
-            }
-        ],
-        "extensionAbilities": [
-            {
-                "icon": "$media:icon",
-                "name": "com.ohos.permissionmanager.GrantAbility",
-                "srcEntrance": "./ets/ServiceExtAbility/ServiceExtAbility.ts",
-                "type": "service",
-                "visible": true
-            }
-        ],
-        "requestPermissions": [
-            {
-                "name": "ohos.permission.GET_SENSITIVE_PERMISSIONS",
-            },
-            {
-                "name": "ohos.permission.GRANT_SENSITIVE_PERMISSIONS"
-            },
-            {
-                "name": "ohos.permission.REVOKE_SENSITIVE_PERMISSIONS"
-            },
-            {
-                "name": "ohos.permission.GET_BUNDLE_INFO_PRIVILEGED"
-            },
-            {
-                "name": "ohos.permission.GET_BUNDLE_INFO"
-            },
-            {
-                "name": "ohos.permission.PERMISSION_USED_STATS"
-            }
-        ]
-    }
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+{
+    "module": {
+        "name": "permissionmanager",
+        "type": "feature",
+        "srcEntrance": "./ets/Application/AbilityStage.ts",
+        "description": "$string:permissionmanager_desc",
+        "mainElement": "MainAbility",
+        "deviceTypes": [
+            "phone"
+        ],
+        "deliveryWithInstall": true,
+        "installationFree": false,
+        "pages": "$profile:main_pages",
+        "uiSyntax": "ets",
+        "abilities": [
+            {
+                "name": "com.ohos.permissionmanager.MainAbility",
+                "srcEntrance": "./ets/MainAbility/MainAbility.ts",
+                "description": "$string:MainAbility_desc",
+                "icon": "$media:icon",
+                "label": "$string:MainAbility_label",
+                "visible": true,
+                "launchType": "standard"
+            }
+        ],
+        "extensionAbilities": [
+            {
+                "icon": "$media:icon",
+                "name": "com.ohos.permissionmanager.GrantAbility",
+                "srcEntrance": "./ets/ServiceExtAbility/ServiceExtAbility.ts",
+                "type": "service",
+                "visible": true
+            }
+        ],
+        "requestPermissions": [
+            {
+                "name": "ohos.permission.GET_SENSITIVE_PERMISSIONS",
+            },
+            {
+                "name": "ohos.permission.GRANT_SENSITIVE_PERMISSIONS"
+            },
+            {
+                "name": "ohos.permission.REVOKE_SENSITIVE_PERMISSIONS"
+            },
+            {
+                "name": "ohos.permission.GET_BUNDLE_INFO_PRIVILEGED"
+            },
+            {
+                "name": "ohos.permission.GET_BUNDLE_INFO"
+            },
+            {
+                "name": "ohos.permission.PERMISSION_USED_STATS"
+            }
+        ]
+    }
 }
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/ar/profile/string.json b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/ar/profile/string.json
index c3a6df19ca632072f943b0fba85ac22aec902416..4dff0010889f0b4a72670ec7eff9e07b70343ca8 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/ar/profile/string.json
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/ar/profile/string.json
@@ -1,14 +1,14 @@
-{
-  "strings": {
-    "app_name": "CategoryPage",
-    "describe": "describe",
-    "category": "Category",
-    "itemChild": "ItemChild",
-    "item": "Item",
-    "search": "search...",
-    "you_search": "You search ",
-    "you_clicked": "You clicked ",
-    "tab": "Tab",
-    "more": "< more"
-  }
+{
+  "strings": {
+    "app_name": "CategoryPage",
+    "describe": "describe",
+    "category": "Category",
+    "itemChild": "ItemChild",
+    "item": "Item",
+    "search": "search...",
+    "you_search": "You search ",
+    "you_clicked": "You clicked ",
+    "tab": "Tab",
+    "more": "< more"
+  }
 }
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/element/color.json b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/element/color.json
index d9c648ab678d07802b9a9470d730d98fa6b30ab1..84c9609ba04d5ab2c7c16b01a73e16f54f26e042 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/element/color.json
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/element/color.json
@@ -1,112 +1,112 @@
-{
-  "color": [
-    {
-      "name": "text_color",
-      "value": "#E5000000"
-    },
-    {
-      "name": "label_color",
-      "value": "#182431"
-    },
-    {
-      "name": "label_color_light",
-      "value": "#99182431"
-    },
-    {
-      "name": "label_color_lighter",
-      "value": "#66182431"
-    },
-    {
-      "name": "label_color_20",
-      "value": "#33182431"
-    },
-    {
-      "name": "label_color_lightest",
-      "value": "#0D182431"
-    },
-    {
-      "name": "background_color",
-      "value": "#F4F5F7"
-    },
-    {
-      "name": "list_background_color",
-      "value": "#FDFDFD"
-    },
-    {
-      "name": "text_secondary_color",
-      "value": "#99000000"
-    },
-    {
-      "name": "active_background_color",
-      "value": "#e5f3ff"
-    },
-    {
-      "name": "divider_color",
-      "value": "#f3f4f6"
-    },
-    {
-      "name": "text_decoration_color",
-      "value": "#f3f4f6"
-    },
-    {
-      "name": "default_background_color",
-      "value": "#ffffff"
-    },
-    {
-      "name": "button_color",
-      "value": "#007DFF"
-    },
-    {
-      "name": "shape_allow_color",
-      "value": "#1856D4"
-    },
-    {
-      "name": "shape_ban_color",
-      "value": "#000000"
-    },
-    {
-      "name": "first_font_color",
-      "value": "#E6000000"
-    },
-    {
-      "name": "secondary_font_color",
-      "value": "#66000000"
-    },
-    {
-      "name": "toggle_color",
-      "value": "#409eff"
-    },
-    {
-      "name": "color_Primary",
-      "value": "#E5000000"
-    },
-    {
-      "name": "color_Secondary",
-      "value": "#99000000"
-    },
-    {
-      "name": "color_Tertiary",
-      "value": "#66000000"
-    },
-    {
-      "name": "color_Fourth",
-      "value": "#33000000"
-    },
-    {
-      "name": "selected_Color",
-      "value": "#ffffff"
-    },
-    {
-      "name": "popup_Color",
-      "value": "#FFFAF0"
-    },
-    {
-      "name": "selected_Background_Color",
-      "value": "#CCCCCC"
-    },
-    {
-      "name": "popup_Background_Color",
-      "value": "#D2B48C"
-    }
-  ]
+{
+  "color": [
+    {
+      "name": "text_color",
+      "value": "#E5000000"
+    },
+    {
+      "name": "label_color",
+      "value": "#182431"
+    },
+    {
+      "name": "label_color_light",
+      "value": "#99182431"
+    },
+    {
+      "name": "label_color_lighter",
+      "value": "#66182431"
+    },
+    {
+      "name": "label_color_20",
+      "value": "#33182431"
+    },
+    {
+      "name": "label_color_lightest",
+      "value": "#0D182431"
+    },
+    {
+      "name": "background_color",
+      "value": "#F4F5F7"
+    },
+    {
+      "name": "list_background_color",
+      "value": "#FDFDFD"
+    },
+    {
+      "name": "text_secondary_color",
+      "value": "#99000000"
+    },
+    {
+      "name": "active_background_color",
+      "value": "#e5f3ff"
+    },
+    {
+      "name": "divider_color",
+      "value": "#f3f4f6"
+    },
+    {
+      "name": "text_decoration_color",
+      "value": "#f3f4f6"
+    },
+    {
+      "name": "default_background_color",
+      "value": "#ffffff"
+    },
+    {
+      "name": "button_color",
+      "value": "#007DFF"
+    },
+    {
+      "name": "shape_allow_color",
+      "value": "#1856D4"
+    },
+    {
+      "name": "shape_ban_color",
+      "value": "#000000"
+    },
+    {
+      "name": "first_font_color",
+      "value": "#E6000000"
+    },
+    {
+      "name": "secondary_font_color",
+      "value": "#66000000"
+    },
+    {
+      "name": "toggle_color",
+      "value": "#409eff"
+    },
+    {
+      "name": "color_Primary",
+      "value": "#E5000000"
+    },
+    {
+      "name": "color_Secondary",
+      "value": "#99000000"
+    },
+    {
+      "name": "color_Tertiary",
+      "value": "#66000000"
+    },
+    {
+      "name": "color_Fourth",
+      "value": "#33000000"
+    },
+    {
+      "name": "selected_Color",
+      "value": "#ffffff"
+    },
+    {
+      "name": "popup_Color",
+      "value": "#FFFAF0"
+    },
+    {
+      "name": "selected_Background_Color",
+      "value": "#CCCCCC"
+    },
+    {
+      "name": "popup_Background_Color",
+      "value": "#D2B48C"
+    }
+  ]
 }
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/element/string.json b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/element/string.json
index a1b07a9814be99a34db87663861cb91508d60029..58fe2e88a06c43134dfdb23c1786a71b4f3c74bd 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/element/string.json
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/element/string.json
@@ -1,92 +1,92 @@
-{
-  "string": [
-    {
-      "name": "permissionmanager_desc",
-      "value": "permissionmanager"
-    },
-    {
-      "name": "MainAbility_desc",
-      "value": "manage the permissions of all applications from the permission and application dimensions"
-    },
-    {
-      "name": "MainAbility_label",
-      "value": "permission manage"
-    },
-    {
-      "name": "no_permission",
-      "value": "no permission"
-    },
-    {
-      "name": "access_permission",
-      "value": "access permission"
-    },
-    {
-      "name": "permission_access_record",
-      "value": "permission access record"
-    },
-    {
-      "name": "authority_management",
-      "value": "authority management"
-    },
-    {
-      "name": "other_permissions",
-      "value": "other permissions"
-    },
-    {
-      "name": "application",
-      "value": "application"
-    },
-    {
-      "name": "authority",
-      "value": "authority"
-    },
-    {
-      "name": "textInput_placeholder",
-      "value": "search application"
-    },
-    {
-      "name": "allowed",
-      "value": "allowed"
-    },
-    {
-      "name": "banned",
-      "value": "banned"
-    },
-    {
-      "name": "Authorization_failed",
-      "value": "Authorization failure！"
-    },
-    {
-      "name": "reason_suffix",
-      "value": " and other permissions."
-    },
-    {
-      "name": "separator",
-      "value": ","
-    },
-    {
-      "name": "visits",
-      "value": "Number of visits:"
-    },
-    {
-      "name": "recent_visit",
-      "value": ";Recent visits:"
-    },
-    {
-      "name": "morning",
-      "value": "am"
-    },
-    {
-      "name": "afternoon",
-      "value": "pm"
-    },
-    {
-      "name": "no_record",
-      "value": "No permission access record"
-    },
-    {
-      "name": "record_time_limit",
-      "value": "Access records in the last 7 days"
-    }
-  ]
+{
+  "string": [
+    {
+      "name": "permissionmanager_desc",
+      "value": "permissionmanager"
+    },
+    {
+      "name": "MainAbility_desc",
+      "value": "manage the permissions of all applications from the permission and application dimensions"
+    },
+    {
+      "name": "MainAbility_label",
+      "value": "permission manage"
+    },
+    {
+      "name": "no_permission",
+      "value": "no permission"
+    },
+    {
+      "name": "access_permission",
+      "value": "access permission"
+    },
+    {
+      "name": "permission_access_record",
+      "value": "permission access record"
+    },
+    {
+      "name": "authority_management",
+      "value": "authority management"
+    },
+    {
+      "name": "other_permissions",
+      "value": "other permissions"
+    },
+    {
+      "name": "application",
+      "value": "application"
+    },
+    {
+      "name": "authority",
+      "value": "authority"
+    },
+    {
+      "name": "textInput_placeholder",
+      "value": "search application"
+    },
+    {
+      "name": "allowed",
+      "value": "allowed"
+    },
+    {
+      "name": "banned",
+      "value": "banned"
+    },
+    {
+      "name": "Authorization_failed",
+      "value": "Authorization failure！"
+    },
+    {
+      "name": "reason_suffix",
+      "value": " and other permissions."
+    },
+    {
+      "name": "separator",
+      "value": ","
+    },
+    {
+      "name": "visits",
+      "value": "Number of visits:"
+    },
+    {
+      "name": "recent_visit",
+      "value": ";Recent visits:"
+    },
+    {
+      "name": "morning",
+      "value": "am"
+    },
+    {
+      "name": "afternoon",
+      "value": "pm"
+    },
+    {
+      "name": "no_record",
+      "value": "No permission access record"
+    },
+    {
+      "name": "record_time_limit",
+      "value": "Access records in the last 7 days"
+    }
+  ]
 }
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_call_logs.svg b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_call_logs.svg
index 8826af67d0e4851e4e05dee9af0e815b36ca8715..ecc0e208f4fd8f0766901e9191c3a9a55c5aac8f 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_call_logs.svg
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_call_logs.svg
@@ -1,15 +1,15 @@
-<?xml version="1.0" encoding="utf-8"?>
-<svg version="1.1" id="图层_1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink" x="0px" y="0px"
-	 viewBox="0 0 96 96" style="enable-background:new 0 0 96 96;" xml:space="preserve" fill="#99000000">
-<path d="M88.7,14.6c0-1.7-1.3-3-3-3H50.1c-1.7,0-3,1.3-3,3s1.3,3,3,3h35.6C87.4,17.6,88.7,16.3,88.7,14.6z"/>
-<path d="M85.7,26.2H58.5c-1.7,0-3,1.3-3,3s1.3,3,3,3h27.2c1.7,0,3-1.3,3-3S87.4,26.2,85.7,26.2z"/>
-<path d="M85.7,40.7H66.9c-1.7,0-3,1.3-3,3s1.3,3,3,3h18.8c1.7,0,3-1.3,3-3S87.4,40.7,85.7,40.7z"/>
-<path d="M9.4,29.1C7,22.9,9.6,15.3,15.1,11.4l2.2-1.5c0.2-0.1,0.3-0.2,0.5-0.3c4-2.4,9.2-1.1,11.7,2.9l10.2,16.9
-	c1.7,2.8,1.6,6.3-0.1,9l-2.3,4.2c-1.1,1.7-0.9,3.4,0.8,5.9c1.3,1.9,2.9,3.8,4.6,5.5c1.7,1.7,3.7,3.5,6.1,5.1c2,1.5,4.2,1.8,5.8,0.8
-	l4.2-2.3c2.7-1.8,6.2-1.8,9-0.1l16.9,10.2c4,2.4,5.3,7.6,2.9,11.7c-0.1,0.2-0.2,0.3-0.3,0.5l-1.5,2.2C81.7,87.4,74.1,90,68,87.6
-	c-8-3.1-14.2-6-18.6-8.7c-5.9-3.6-11.7-8.3-17.2-14c-5.7-5.6-10.3-11.4-14-17.3C15.5,43.2,12.5,37,9.4,29.1z M45.2,63.9
-	c-2.6-1.9-4.9-3.8-6.9-5.8c-1.9-2-3.7-4.1-5.2-6.3c-2.9-4.3-3.5-8.4-1-12.4l2.3-4.2l0.1-0.2c0.5-0.8,0.5-1.8,0-2.6L24.3,15.5
-	c-0.7-1.2-2.2-1.6-3.4-0.8l-0.1,0.1l-2.2,1.5c-3.4,2.4-4.9,7.1-3.6,10.6c3,7.7,5.8,13.6,8.3,17.6C26.7,50,31,55.3,36.4,60.7
-	c5.3,5.3,10.7,9.7,16.1,13.1c4,2.5,9.9,5.3,17.6,8.3c3.5,1.4,8.2-0.2,10.6-3.6l1.5-2.2l0.1-0.1c0.7-1.2,0.3-2.7-0.8-3.4L64.6,62.5
-	c-0.8-0.5-1.8-0.5-2.6,0l-0.2,0.1L57.6,65C53.7,67.4,49,66.7,45.2,63.9z"/>
-</svg>
+<?xml version="1.0" encoding="utf-8"?>
+<svg version="1.1" id="图层_1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink" x="0px" y="0px"
+	 viewBox="0 0 96 96" style="enable-background:new 0 0 96 96;" xml:space="preserve" fill="#99000000">
+<path d="M88.7,14.6c0-1.7-1.3-3-3-3H50.1c-1.7,0-3,1.3-3,3s1.3,3,3,3h35.6C87.4,17.6,88.7,16.3,88.7,14.6z"/>
+<path d="M85.7,26.2H58.5c-1.7,0-3,1.3-3,3s1.3,3,3,3h27.2c1.7,0,3-1.3,3-3S87.4,26.2,85.7,26.2z"/>
+<path d="M85.7,40.7H66.9c-1.7,0-3,1.3-3,3s1.3,3,3,3h18.8c1.7,0,3-1.3,3-3S87.4,40.7,85.7,40.7z"/>
+<path d="M9.4,29.1C7,22.9,9.6,15.3,15.1,11.4l2.2-1.5c0.2-0.1,0.3-0.2,0.5-0.3c4-2.4,9.2-1.1,11.7,2.9l10.2,16.9
+	c1.7,2.8,1.6,6.3-0.1,9l-2.3,4.2c-1.1,1.7-0.9,3.4,0.8,5.9c1.3,1.9,2.9,3.8,4.6,5.5c1.7,1.7,3.7,3.5,6.1,5.1c2,1.5,4.2,1.8,5.8,0.8
+	l4.2-2.3c2.7-1.8,6.2-1.8,9-0.1l16.9,10.2c4,2.4,5.3,7.6,2.9,11.7c-0.1,0.2-0.2,0.3-0.3,0.5l-1.5,2.2C81.7,87.4,74.1,90,68,87.6
+	c-8-3.1-14.2-6-18.6-8.7c-5.9-3.6-11.7-8.3-17.2-14c-5.7-5.6-10.3-11.4-14-17.3C15.5,43.2,12.5,37,9.4,29.1z M45.2,63.9
+	c-2.6-1.9-4.9-3.8-6.9-5.8c-1.9-2-3.7-4.1-5.2-6.3c-2.9-4.3-3.5-8.4-1-12.4l2.3-4.2l0.1-0.2c0.5-0.8,0.5-1.8,0-2.6L24.3,15.5
+	c-0.7-1.2-2.2-1.6-3.4-0.8l-0.1,0.1l-2.2,1.5c-3.4,2.4-4.9,7.1-3.6,10.6c3,7.7,5.8,13.6,8.3,17.6C26.7,50,31,55.3,36.4,60.7
+	c5.3,5.3,10.7,9.7,16.1,13.1c4,2.5,9.9,5.3,17.6,8.3c3.5,1.4,8.2-0.2,10.6-3.6l1.5-2.2l0.1-0.1c0.7-1.2,0.3-2.7-0.8-3.4L64.6,62.5
+	c-0.8-0.5-1.8-0.5-2.6,0l-0.2,0.1L57.6,65C53.7,67.4,49,66.7,45.2,63.9z"/>
+</svg>
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_dropzone.svg b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_dropzone.svg
index 960483f7f3398245eafe7c9d6182419a32ebeb05..15ca115db85ae3d092c7249a3425482f97e2c37f 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_dropzone.svg
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_dropzone.svg
@@ -1,19 +1,19 @@
-<?xml version="1.0" encoding="UTF-8"?>
-<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
-    <title>IC/ic_floatingwindow</title>
-    <defs>
-        <path d="M12,3.5 L12,5 L9.32305804,5.001658 L8.89267325,5.01171091 C8.03615135,5.04387413 7.64900152,5.14557932 7.25370688,5.3569852 C6.86325774,5.56579969 6.56579969,5.86325774 6.3569852,6.25370688 C6.09290159,6.74750032 6,7.22858421 6,8.6277704 L6.001658,16.676942 L6.01171091,17.1073267 C6.04387413,17.9638487 6.14557932,18.3509985 6.3569852,18.7462931 C6.56579969,19.1367423 6.86325774,19.4342003 7.25370688,19.6430148 C7.69153706,19.8771689 8.11937528,19.9767436 9.18606965,19.9963062 L9.6277704,20 L13.8722296,20 L14.3557064,19.9954923 C15.3918853,19.9740999 15.8142239,19.874088 16.2462931,19.6430148 C16.6367423,19.4342003 16.9342003,19.1367423 17.1430148,18.7462931 C17.3771689,18.3084629 17.4767436,17.8806247 17.4963062,16.8139303 L17.5,16.3722296 L17.5,14 L19,14 L18.9989932,16.5937657 C18.9859758,17.9884263 18.8469417,18.6407938 18.5946788,19.1943859 L18.4657346,19.4536914 C18.1337211,20.0745027 17.6538954,20.5680807 17.0458564,20.9148264 L16.9536914,20.9657346 C16.3018396,21.3143488 15.6552671,21.5 13.8722296,21.5 L9.6277704,21.5 L9.40623426,21.4989932 C8.01157373,21.4859758 7.35920618,21.3469417 6.80561415,21.0946788 L6.54630859,20.9657346 C5.92549731,20.6337211 5.43191931,20.1538954 5.08517358,19.5458564 L5.03426541,19.4536914 C4.68565122,18.8018396 4.5,18.1552671 4.5,16.3722296 L4.5,8.6277704 C4.5,6.97961992 4.65862462,6.30249093 4.957955,5.69465027 L5.03426541,5.54630859 C5.36627892,4.92549731 5.84610464,4.43191931 6.4541436,4.08517358 L6.54630859,4.03426541 C7.16385245,3.70399934 7.77665804,3.51999365 9.35551601,3.5015395 L12,3.5 Z M17.9361148,2 C18.8276335,2 19.1509198,2.09282561 19.4768457,2.2671327 C19.8027716,2.4414398 20.0585602,2.69722837 20.2328673,3.0231543 C20.4071744,3.34908022 20.5,3.67236646 20.5,4.5638852 L20.5,10.4361148 C20.5,11.3276335 20.4071744,11.6509198 20.2328673,11.9768457 C20.0585602,12.3027716 19.8027716,12.5585602 19.4768457,12.7328673 C19.1509198,12.9071744 18.8276335,13 17.9361148,13 L15.5638852,13 C14.6723665,13 14.3490802,12.9071744 14.0231543,12.7328673 C13.6972284,12.5585602 13.4414398,12.3027716 13.2671327,11.9768457 C13.0928256,11.6509198 13,11.3276335 13,10.4361148 L13,4.5638852 C13,3.67236646 13.0928256,3.34908022 13.2671327,3.0231543 C13.4414398,2.69722837 13.6972284,2.4414398 14.0231543,2.2671327 C14.3490802,2.09282561 14.6723665,2 15.5638852,2 L17.9361148,2 Z" id="path-1"></path>
-    </defs>
-    <g id="IC/ic_floatingwindow" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
-        <g id="symbol/frame/symbol_grid24"></g>
-        <mask id="mask-2" fill="white">
-            <use xlink:href="#path-1"></use>
-        </mask>
-        <g id="形状结合" fill-rule="nonzero"></g>
-        <g id="编组" mask="url(#mask-2)" fill="#000000" fill-opacity="0.9">
-            <g id="color/#000000">
-                <rect x="0" y="0" width="24" height="24"></rect>
-            </g>
-        </g>
-    </g>
+<?xml version="1.0" encoding="UTF-8"?>
+<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
+    <title>IC/ic_floatingwindow</title>
+    <defs>
+        <path d="M12,3.5 L12,5 L9.32305804,5.001658 L8.89267325,5.01171091 C8.03615135,5.04387413 7.64900152,5.14557932 7.25370688,5.3569852 C6.86325774,5.56579969 6.56579969,5.86325774 6.3569852,6.25370688 C6.09290159,6.74750032 6,7.22858421 6,8.6277704 L6.001658,16.676942 L6.01171091,17.1073267 C6.04387413,17.9638487 6.14557932,18.3509985 6.3569852,18.7462931 C6.56579969,19.1367423 6.86325774,19.4342003 7.25370688,19.6430148 C7.69153706,19.8771689 8.11937528,19.9767436 9.18606965,19.9963062 L9.6277704,20 L13.8722296,20 L14.3557064,19.9954923 C15.3918853,19.9740999 15.8142239,19.874088 16.2462931,19.6430148 C16.6367423,19.4342003 16.9342003,19.1367423 17.1430148,18.7462931 C17.3771689,18.3084629 17.4767436,17.8806247 17.4963062,16.8139303 L17.5,16.3722296 L17.5,14 L19,14 L18.9989932,16.5937657 C18.9859758,17.9884263 18.8469417,18.6407938 18.5946788,19.1943859 L18.4657346,19.4536914 C18.1337211,20.0745027 17.6538954,20.5680807 17.0458564,20.9148264 L16.9536914,20.9657346 C16.3018396,21.3143488 15.6552671,21.5 13.8722296,21.5 L9.6277704,21.5 L9.40623426,21.4989932 C8.01157373,21.4859758 7.35920618,21.3469417 6.80561415,21.0946788 L6.54630859,20.9657346 C5.92549731,20.6337211 5.43191931,20.1538954 5.08517358,19.5458564 L5.03426541,19.4536914 C4.68565122,18.8018396 4.5,18.1552671 4.5,16.3722296 L4.5,8.6277704 C4.5,6.97961992 4.65862462,6.30249093 4.957955,5.69465027 L5.03426541,5.54630859 C5.36627892,4.92549731 5.84610464,4.43191931 6.4541436,4.08517358 L6.54630859,4.03426541 C7.16385245,3.70399934 7.77665804,3.51999365 9.35551601,3.5015395 L12,3.5 Z M17.9361148,2 C18.8276335,2 19.1509198,2.09282561 19.4768457,2.2671327 C19.8027716,2.4414398 20.0585602,2.69722837 20.2328673,3.0231543 C20.4071744,3.34908022 20.5,3.67236646 20.5,4.5638852 L20.5,10.4361148 C20.5,11.3276335 20.4071744,11.6509198 20.2328673,11.9768457 C20.0585602,12.3027716 19.8027716,12.5585602 19.4768457,12.7328673 C19.1509198,12.9071744 18.8276335,13 17.9361148,13 L15.5638852,13 C14.6723665,13 14.3490802,12.9071744 14.0231543,12.7328673 C13.6972284,12.5585602 13.4414398,12.3027716 13.2671327,11.9768457 C13.0928256,11.6509198 13,11.3276335 13,10.4361148 L13,4.5638852 C13,3.67236646 13.0928256,3.34908022 13.2671327,3.0231543 C13.4414398,2.69722837 13.6972284,2.4414398 14.0231543,2.2671327 C14.3490802,2.09282561 14.6723665,2 15.5638852,2 L17.9361148,2 Z" id="path-1"></path>
+    </defs>
+    <g id="IC/ic_floatingwindow" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
+        <g id="symbol/frame/symbol_grid24"></g>
+        <mask id="mask-2" fill="white">
+            <use xlink:href="#path-1"></use>
+        </mask>
+        <g id="形状结合" fill-rule="nonzero"></g>
+        <g id="编组" mask="url(#mask-2)" fill="#000000" fill-opacity="0.9">
+            <g id="color/#000000">
+                <rect x="0" y="0" width="24" height="24"></rect>
+            </g>
+        </g>
+    </g>
 </svg>
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_exercise.svg b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_exercise.svg
index e31feee74b4025b3e79e1a9484b07c7c1e427a3f..8a40c789c8a8770f4b491d5011b7de17936eed76 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_exercise.svg
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_exercise.svg
@@ -1,15 +1,15 @@
-<?xml version="1.0" encoding="utf-8"?>
-<svg version="1.1" id="图层_1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink" x="0px" y="0px"
-	 viewBox="0 0 96 96" style="enable-background:new 0 0 96 96;" xml:space="preserve">
-<path d="M78.2,10.6c-1.5,3.7-5.6,5.4-9.3,3.9C65.3,13,63.5,8.8,65,5.2c1.5-3.7,5.6-5.4,9.3-3.9C77.9,2.8,79.6,7,78.2,10.6z
-	 M5.3,68.8L5.3,68.8l25-3.4c0,0,0.1,0,0.1-0.1L38.2,54c0.6,1.6,1.6,3.1,3.2,4.4c0.7,0.6,3,2.2,5.7,4.2l-8.5,10.6
-	c-0.7,1-1.8,1.8-3.2,2.2c-0.6,0.2-1.2,0.2-1.8,0.2l-28.1-1l0,0c-0.2,0-0.4,0-0.5-0.1c-1.5-0.4-2.5-1.9-2.1-3.4
-	C3.2,69.8,4.1,68.9,5.3,68.8z M91.7,45.6C91.6,45.7,91.6,45.7,91.7,45.6l-18.4,4.3l0,0c-0.1,0-0.2,0-0.3,0c-1.7,0.1-3.3-0.8-4.1-2.3
-	l0,0l-2-4.5c2.2-3.3,4.5-6.9,6-9.8l2.3,8.3l15.9-0.3c0.3,0,0.7,0,1,0.2c1.1,0.5,1.6,1.7,1.2,2.8C92.8,45,92.3,45.5,91.7,45.6z
-	 M32.4,49.8c-0.1,0.3-0.3,0.6-0.6,0.9c-0.9,0.8-2.2,0.7-3-0.1c-0.5-0.5-0.6-1.2-0.5-1.8l0,0l5.2-21l0,0c0-0.2,0.1-0.3,0.1-0.5
-	c0.4-1.1,1.2-2,2.2-2.4v-0.1l21.2-8l0,0c2.2-0.7,4.6-0.7,6.9,0.2c5.1,2.1,7.5,7.9,5.5,13.1c0,0.1-0.3,0.7-0.4,0.9
-	c-2.8,6.2-11.5,18-11.5,18L72,61l0.1,0.1c0.7,0.6,1.3,1.4,1.6,2.3v0.1l0.1,0.4c0,0.1,0,0.1,0,0.2L81,91.8l0,0c0,0.1,0,0.2,0,0.4
-	c0.1,1.6-1.1,2.9-2.6,3.1c-1.2,0.1-2.3-0.6-2.8-1.7l0,0c-1.8-3.8-11.7-24.4-11.7-24.4S46.2,56.8,44.1,55c-0.3-0.2-0.5-0.4-0.7-0.7
-	c-1.9-2-2.5-5-1.4-7.7c0.1-0.2,0.1-0.3,0.2-0.5c0-0.1,0-0.1,0-0.1l4.4-11.6c0.9-0.6,1.7-1.1,2.3-1.4c1.8-0.7,5.4-2.9,5-4
-	c-0.5-1.1-11.4,3-12.9,3.6l-0.3,0.1L32.4,49.8L32.4,49.8z"/>
-</svg>
+<?xml version="1.0" encoding="utf-8"?>
+<svg version="1.1" id="图层_1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink" x="0px" y="0px"
+	 viewBox="0 0 96 96" style="enable-background:new 0 0 96 96;" xml:space="preserve">
+<path d="M78.2,10.6c-1.5,3.7-5.6,5.4-9.3,3.9C65.3,13,63.5,8.8,65,5.2c1.5-3.7,5.6-5.4,9.3-3.9C77.9,2.8,79.6,7,78.2,10.6z
+	 M5.3,68.8L5.3,68.8l25-3.4c0,0,0.1,0,0.1-0.1L38.2,54c0.6,1.6,1.6,3.1,3.2,4.4c0.7,0.6,3,2.2,5.7,4.2l-8.5,10.6
+	c-0.7,1-1.8,1.8-3.2,2.2c-0.6,0.2-1.2,0.2-1.8,0.2l-28.1-1l0,0c-0.2,0-0.4,0-0.5-0.1c-1.5-0.4-2.5-1.9-2.1-3.4
+	C3.2,69.8,4.1,68.9,5.3,68.8z M91.7,45.6C91.6,45.7,91.6,45.7,91.7,45.6l-18.4,4.3l0,0c-0.1,0-0.2,0-0.3,0c-1.7,0.1-3.3-0.8-4.1-2.3
+	l0,0l-2-4.5c2.2-3.3,4.5-6.9,6-9.8l2.3,8.3l15.9-0.3c0.3,0,0.7,0,1,0.2c1.1,0.5,1.6,1.7,1.2,2.8C92.8,45,92.3,45.5,91.7,45.6z
+	 M32.4,49.8c-0.1,0.3-0.3,0.6-0.6,0.9c-0.9,0.8-2.2,0.7-3-0.1c-0.5-0.5-0.6-1.2-0.5-1.8l0,0l5.2-21l0,0c0-0.2,0.1-0.3,0.1-0.5
+	c0.4-1.1,1.2-2,2.2-2.4v-0.1l21.2-8l0,0c2.2-0.7,4.6-0.7,6.9,0.2c5.1,2.1,7.5,7.9,5.5,13.1c0,0.1-0.3,0.7-0.4,0.9
+	c-2.8,6.2-11.5,18-11.5,18L72,61l0.1,0.1c0.7,0.6,1.3,1.4,1.6,2.3v0.1l0.1,0.4c0,0.1,0,0.1,0,0.2L81,91.8l0,0c0,0.1,0,0.2,0,0.4
+	c0.1,1.6-1.1,2.9-2.6,3.1c-1.2,0.1-2.3-0.6-2.8-1.7l0,0c-1.8-3.8-11.7-24.4-11.7-24.4S46.2,56.8,44.1,55c-0.3-0.2-0.5-0.4-0.7-0.7
+	c-1.9-2-2.5-5-1.4-7.7c0.1-0.2,0.1-0.3,0.2-0.5c0-0.1,0-0.1,0-0.1l4.4-11.6c0.9-0.6,1.7-1.1,2.3-1.4c1.8-0.7,5.4-2.9,5-4
+	c-0.5-1.1-11.4,3-12.9,3.6l-0.3,0.1L32.4,49.8L32.4,49.8z"/>
+</svg>
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_forward.svg b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_forward.svg
index ddf503e7c61949920511d3a53d4cffd0c120cf5d..2ee2264b584edcd8da27c2c5cb1c1cd8fbdf34b7 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_forward.svg
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_forward.svg
@@ -1,13 +1,13 @@
-<?xml version="1.0" encoding="utf-8"?>
-<svg version="1.1" id="图层_1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink" x="0px" y="0px"
-	 viewBox="0 0 96 96" style="enable-background:new 0 0 96 96;" xml:space="preserve">
-<g>
-	<path d="M26.7,49.7c-0.4,1-0.8,2.1-1.1,3.2c-0.4,1.4,0.2,2.9,1.5,3.5c0.4,0.2,0.9,0.3,1.4,0.3c0.9,0,1.8-0.4,2.4-1.1
-		c0.6-0.7,1.1-1.4,1.7-2c2.8-3,6-5.6,9.4-7.6c5.7-3.4,12-4.8,22.5-5.2v8.7c0,1.2,0.7,2.3,1.8,2.7c1.1,0.5,2.3,0.3,3.2-0.5L90.6,33
-		c0.6-0.6,1-1.4,1-2.2s-0.4-1.7-1-2.2l-21.3-19c-0.9-0.8-2.1-1-3.2-0.5s-1.8,1.6-1.8,2.7v9.7C47.5,23.1,32.7,34.2,26.7,49.7z
-		 M64.9,27.5l2.7-0.3c1.5-0.1,2.7-1.4,2.7-3v-5.8l13.8,12.2L70.3,43v-5.1c0-0.8-0.3-1.6-0.9-2.2c-0.6-0.5-1.3-0.8-2.1-0.8h-0.1
-		L64.1,35c-11.4,0.4-18.7,2.2-25.2,6C45.4,33.4,54.7,28.5,64.9,27.5z"/>
-	<path d="M89,45c-1.7,0-3,1.3-3,3v23c0,3.9-3.1,7-7,7H17c-3.9,0-7-3.1-7-7V25c0-3.9,3.1-7,7-7h35.3c1.7,0,3-1.3,3-3s-1.3-3-3-3H17
-		C9.8,12,4,17.8,4,25v46c0,7.2,5.8,13,13,13h62c7.2,0,13-5.8,13-13V48C92,46.4,90.7,45,89,45z"/>
-</g>
-</svg>
+<?xml version="1.0" encoding="utf-8"?>
+<svg version="1.1" id="图层_1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink" x="0px" y="0px"
+	 viewBox="0 0 96 96" style="enable-background:new 0 0 96 96;" xml:space="preserve">
+<g>
+	<path d="M26.7,49.7c-0.4,1-0.8,2.1-1.1,3.2c-0.4,1.4,0.2,2.9,1.5,3.5c0.4,0.2,0.9,0.3,1.4,0.3c0.9,0,1.8-0.4,2.4-1.1
+		c0.6-0.7,1.1-1.4,1.7-2c2.8-3,6-5.6,9.4-7.6c5.7-3.4,12-4.8,22.5-5.2v8.7c0,1.2,0.7,2.3,1.8,2.7c1.1,0.5,2.3,0.3,3.2-0.5L90.6,33
+		c0.6-0.6,1-1.4,1-2.2s-0.4-1.7-1-2.2l-21.3-19c-0.9-0.8-2.1-1-3.2-0.5s-1.8,1.6-1.8,2.7v9.7C47.5,23.1,32.7,34.2,26.7,49.7z
+		 M64.9,27.5l2.7-0.3c1.5-0.1,2.7-1.4,2.7-3v-5.8l13.8,12.2L70.3,43v-5.1c0-0.8-0.3-1.6-0.9-2.2c-0.6-0.5-1.3-0.8-2.1-0.8h-0.1
+		L64.1,35c-11.4,0.4-18.7,2.2-25.2,6C45.4,33.4,54.7,28.5,64.9,27.5z"/>
+	<path d="M89,45c-1.7,0-3,1.3-3,3v23c0,3.9-3.1,7-7,7H17c-3.9,0-7-3.1-7-7V25c0-3.9,3.1-7,7-7h35.3c1.7,0,3-1.3,3-3s-1.3-3-3-3H17
+		C9.8,12,4,17.8,4,25v46c0,7.2,5.8,13,13,13h62c7.2,0,13-5.8,13-13V48C92,46.4,90.7,45,89,45z"/>
+</g>
+</svg>
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_more.svg b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_more.svg
index 73ab2493876c2c2770b0329aa1652b9c5b72f946..87c4bafe0c7a4a4538de279d43dce64247aac765 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_more.svg
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_more.svg
@@ -1,7 +1,7 @@
-<?xml version="1.0" encoding="UTF-8"?>
-<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
-    <title>HM/ic/24x24/more1.5</title>
-    <g id="HM/ic/24x24/more1.5" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
-        <path d="M14.97495,2.5 C18.6252,2.5 21.57495,5.45 21.57495,9.075 C21.57495,12.7 18.6252,15.65 15.0002,15.65 C13.72495,15.65 12.54995,15.3 11.54995,14.675 L11.54995,14.675 L10.94995,15.275 L11.04995,16.125 C11.04995,16.5 10.89995,16.825 10.64995,17.05 L10.64995,17.05 L9.94995,17.75 C9.6762,18.02375 9.3687,18.15 9.04995,18.15 L9.04995,18.15 L8.97495,18.15 L8.19995,18.05 L7.59995,18.65 L7.67495,19.225 C7.69995,19.325 7.69995,19.4 7.69995,19.5 C7.69995,19.8 7.59995,20.05 7.42495,20.275 L7.42495,20.275 L6.54995,21.175 C6.29995,21.45 6.02495,21.55 5.49995,21.55 L5.49995,21.55 L3.77495,21.55 C2.99995,21.55 2.49995,20.9 2.49995,20.325 L2.49995,20.325 L2.49995,17.9 L8.87495,11.5 C8.57495,10.75 8.39995,9.925 8.39995,9.075 C8.39995,5.45 11.34995,2.5 14.97495,2.5 Z M14.97495,4 C12.17495,4 9.89995,6.275 9.89995,9.075 C9.89995,10.075 10.19995,11 10.69995,11.8 L10.69995,11.8 L3.97495,18.5 L3.97495,20.05 L5.54995,20.05 L6.17495,19.425 C6.17495,19.425 6.09995,19 6.07495,18.725 C6.02495,18.35 6.14995,17.975 6.39995,17.725 C6.54995,17.575 7.14995,16.95 7.24995,16.875 C7.39995,16.7 7.79995,16.5 8.19995,16.55 C8.54995,16.6 8.94995,16.65 8.94995,16.65 L8.94995,16.65 L9.54995,16.05 C9.54995,16.05 9.47495,15.55 9.42495,15.325 C9.37495,14.925 9.54995,14.525 9.79995,14.3 C9.89995,14.2 11.42495,12.7 11.42495,12.7 C12.32495,13.6 13.57495,14.15 14.97495,14.15 C17.79995,14.15 20.04995,11.875 20.04995,9.075 C20.04995,6.275 17.77495,4 14.97495,4 Z M15.07505,7.374975 C16.0138,7.374975 16.77505,8.135975 16.77505,9.074975 C16.77505,10.013975 16.0138,10.774975 15.07505,10.774975 C14.13605,10.774975 13.37505,10.013975 13.37505,9.074975 C13.37505,8.135975 14.13605,7.374975 15.07505,7.374975 Z" id="Combined-Shape" fill="#99000000"></path>
-    </g>
+<?xml version="1.0" encoding="UTF-8"?>
+<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
+    <title>HM/ic/24x24/more1.5</title>
+    <g id="HM/ic/24x24/more1.5" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
+        <path d="M14.97495,2.5 C18.6252,2.5 21.57495,5.45 21.57495,9.075 C21.57495,12.7 18.6252,15.65 15.0002,15.65 C13.72495,15.65 12.54995,15.3 11.54995,14.675 L11.54995,14.675 L10.94995,15.275 L11.04995,16.125 C11.04995,16.5 10.89995,16.825 10.64995,17.05 L10.64995,17.05 L9.94995,17.75 C9.6762,18.02375 9.3687,18.15 9.04995,18.15 L9.04995,18.15 L8.97495,18.15 L8.19995,18.05 L7.59995,18.65 L7.67495,19.225 C7.69995,19.325 7.69995,19.4 7.69995,19.5 C7.69995,19.8 7.59995,20.05 7.42495,20.275 L7.42495,20.275 L6.54995,21.175 C6.29995,21.45 6.02495,21.55 5.49995,21.55 L5.49995,21.55 L3.77495,21.55 C2.99995,21.55 2.49995,20.9 2.49995,20.325 L2.49995,20.325 L2.49995,17.9 L8.87495,11.5 C8.57495,10.75 8.39995,9.925 8.39995,9.075 C8.39995,5.45 11.34995,2.5 14.97495,2.5 Z M14.97495,4 C12.17495,4 9.89995,6.275 9.89995,9.075 C9.89995,10.075 10.19995,11 10.69995,11.8 L10.69995,11.8 L3.97495,18.5 L3.97495,20.05 L5.54995,20.05 L6.17495,19.425 C6.17495,19.425 6.09995,19 6.07495,18.725 C6.02495,18.35 6.14995,17.975 6.39995,17.725 C6.54995,17.575 7.14995,16.95 7.24995,16.875 C7.39995,16.7 7.79995,16.5 8.19995,16.55 C8.54995,16.6 8.94995,16.65 8.94995,16.65 L8.94995,16.65 L9.54995,16.05 C9.54995,16.05 9.47495,15.55 9.42495,15.325 C9.37495,14.925 9.54995,14.525 9.79995,14.3 C9.89995,14.2 11.42495,12.7 11.42495,12.7 C12.32495,13.6 13.57495,14.15 14.97495,14.15 C17.79995,14.15 20.04995,11.875 20.04995,9.075 C20.04995,6.275 17.77495,4 14.97495,4 Z M15.07505,7.374975 C16.0138,7.374975 16.77505,8.135975 16.77505,9.074975 C16.77505,10.013975 16.0138,10.774975 15.07505,10.774975 C14.13605,10.774975 13.37505,10.013975 13.37505,9.074975 C13.37505,8.135975 14.13605,7.374975 15.07505,7.374975 Z" id="Combined-Shape" fill="#99000000"></path>
+    </g>
 </svg>
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_multi_device_vector.svg b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_multi_device_vector.svg
index b85bdf10aa90c6406df61166bd13ca9392785729..82a186f7f0e04f4d8ca6e310c05c575d50963ad5 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_multi_device_vector.svg
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_multi_device_vector.svg
@@ -1,7 +1,7 @@
-<?xml version="1.0" encoding="UTF-8"?>
-<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
-    <title>HM/ic/24x24/Multi-device vector</title>
-    <g id="HM/ic/24x24/Multi-device-vector" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
-        <path d="M19.6588576,7.3125 C20.4946564,7.3125 20.7977373,7.39952401 21.1032928,7.56293691 C21.4088484,7.72634981 21.6486502,7.9661516 21.8120631,8.27170715 L21.8372288,8.32001023 C21.9843953,8.61064163 22.0625,8.92433297 22.0625,9.71614237 L22.0625,11.84375 C22.235089,11.84375 22.375,11.983661 22.375,12.15625 L22.375,13.40625 C22.375,13.578839 22.235089,13.71875 22.0625,13.71875 L22.0617784,19.4114769 C22.053128,20.1515665 21.9668753,20.4388192 21.8120631,20.7282928 C21.6486502,21.0338484 21.4088484,21.2736502 21.1032928,21.4370631 L21.0549898,21.4622288 C20.7643584,21.6093953 20.450667,21.6875 19.6588576,21.6875 L16.2135231,21.6867784 C15.4734335,21.678128 15.1861808,21.5918753 14.8967072,21.4370631 C14.5911516,21.2736502 14.3513498,21.0338484 14.1879369,20.7282928 L14.1627712,20.6799898 C14.0156047,20.3893584 13.9375,20.075667 13.9375,19.2838576 L13.9375,9.71614237 C13.9375,8.88034356 14.024524,8.57726271 14.1879369,8.27170715 C14.3513498,7.9661516 14.5911516,7.72634981 14.8967072,7.56293691 L14.9450102,7.53777123 C15.2356416,7.39060465 15.549333,7.3125 16.3411424,7.3125 L19.6588576,7.3125 Z M16.3411424,8.8125 C15.9303677,8.8125 15.7697305,8.82642519 15.687621,8.8492988 L15.6380813,8.86805408 L15.6041054,8.88565671 C15.5599526,8.90926991 15.5342699,8.9349526 15.5106567,8.97910544 C15.494721,9.00890257 15.4877579,9.02331282 15.4822764,9.04312475 L15.474229,9.07949249 C15.4554896,9.17653291 15.4424763,9.33186667 15.4386591,9.56602452 L15.4375,19.2838576 C15.4375,19.6946323 15.4514252,19.8552695 15.4742988,19.937379 L15.4930541,19.9869187 L15.5106567,20.0208946 C15.5342699,20.0650474 15.5599526,20.0907301 15.6041054,20.1143433 L15.6688856,20.1430773 C15.7282488,20.1633475 15.8095538,20.1749073 15.9764945,20.1813308 L16.3411424,20.1875 L19.6588576,20.1875 C20.0696323,20.1875 20.2302695,20.1735748 20.312379,20.1507012 L20.3619187,20.1319459 L20.3958946,20.1143433 C20.4400474,20.0907301 20.4657301,20.0650474 20.4893433,20.0208946 L20.5180773,19.9561144 C20.5383475,19.8967512 20.5499073,19.8154462 20.5563308,19.6485055 L20.5625,19.2838576 L20.5625,9.71614237 C20.5625,9.30536767 20.5485748,9.14473053 20.5257012,9.06262098 L20.5069459,9.01308133 L20.4893433,8.97910544 C20.4657301,8.9349526 20.4400474,8.90926991 20.3958946,8.88565671 C20.3660974,8.86972103 20.3516872,8.8627579 20.3318752,8.8572764 L20.2955075,8.84922901 C20.1984671,8.83048964 20.0431333,8.8174763 19.8089755,8.81365905 L16.3411424,8.8125 Z M17.2291667,2.46875 C18.3792596,2.46875 19.321062,3.36054828 19.4007837,4.49035493 L19.40625,4.64583333 L19.40575,5.81175 L17.90575,5.81175 L17.90625,4.64583333 C17.90625,4.30588533 17.6557206,4.0244516 17.3292211,3.97609132 L17.2291667,3.96875 L3.77083333,3.96875 C3.43088533,3.96875 3.1494516,4.21927937 3.10109132,4.54577892 L3.09375,4.64583333 L3.09375,13.3541667 C3.09375,13.6941147 3.34427937,13.9755484 3.67077892,14.0239087 L3.77083333,14.03125 L12.43675,14.03075 L12.43675,15.53075 L3.77083333,15.53125 C2.62074036,15.53125 1.67893804,14.6394517 1.59921628,13.5096451 L1.59375,13.3541667 L1.59375,4.64583333 C1.59375,3.49574036 2.48554828,2.55393804 3.61535493,2.47421628 L3.77083333,2.46875 L17.2291667,2.46875 Z" id="形状结合" fill="#99000000"></path>
-    </g>
+<?xml version="1.0" encoding="UTF-8"?>
+<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
+    <title>HM/ic/24x24/Multi-device vector</title>
+    <g id="HM/ic/24x24/Multi-device-vector" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
+        <path d="M19.6588576,7.3125 C20.4946564,7.3125 20.7977373,7.39952401 21.1032928,7.56293691 C21.4088484,7.72634981 21.6486502,7.9661516 21.8120631,8.27170715 L21.8372288,8.32001023 C21.9843953,8.61064163 22.0625,8.92433297 22.0625,9.71614237 L22.0625,11.84375 C22.235089,11.84375 22.375,11.983661 22.375,12.15625 L22.375,13.40625 C22.375,13.578839 22.235089,13.71875 22.0625,13.71875 L22.0617784,19.4114769 C22.053128,20.1515665 21.9668753,20.4388192 21.8120631,20.7282928 C21.6486502,21.0338484 21.4088484,21.2736502 21.1032928,21.4370631 L21.0549898,21.4622288 C20.7643584,21.6093953 20.450667,21.6875 19.6588576,21.6875 L16.2135231,21.6867784 C15.4734335,21.678128 15.1861808,21.5918753 14.8967072,21.4370631 C14.5911516,21.2736502 14.3513498,21.0338484 14.1879369,20.7282928 L14.1627712,20.6799898 C14.0156047,20.3893584 13.9375,20.075667 13.9375,19.2838576 L13.9375,9.71614237 C13.9375,8.88034356 14.024524,8.57726271 14.1879369,8.27170715 C14.3513498,7.9661516 14.5911516,7.72634981 14.8967072,7.56293691 L14.9450102,7.53777123 C15.2356416,7.39060465 15.549333,7.3125 16.3411424,7.3125 L19.6588576,7.3125 Z M16.3411424,8.8125 C15.9303677,8.8125 15.7697305,8.82642519 15.687621,8.8492988 L15.6380813,8.86805408 L15.6041054,8.88565671 C15.5599526,8.90926991 15.5342699,8.9349526 15.5106567,8.97910544 C15.494721,9.00890257 15.4877579,9.02331282 15.4822764,9.04312475 L15.474229,9.07949249 C15.4554896,9.17653291 15.4424763,9.33186667 15.4386591,9.56602452 L15.4375,19.2838576 C15.4375,19.6946323 15.4514252,19.8552695 15.4742988,19.937379 L15.4930541,19.9869187 L15.5106567,20.0208946 C15.5342699,20.0650474 15.5599526,20.0907301 15.6041054,20.1143433 L15.6688856,20.1430773 C15.7282488,20.1633475 15.8095538,20.1749073 15.9764945,20.1813308 L16.3411424,20.1875 L19.6588576,20.1875 C20.0696323,20.1875 20.2302695,20.1735748 20.312379,20.1507012 L20.3619187,20.1319459 L20.3958946,20.1143433 C20.4400474,20.0907301 20.4657301,20.0650474 20.4893433,20.0208946 L20.5180773,19.9561144 C20.5383475,19.8967512 20.5499073,19.8154462 20.5563308,19.6485055 L20.5625,19.2838576 L20.5625,9.71614237 C20.5625,9.30536767 20.5485748,9.14473053 20.5257012,9.06262098 L20.5069459,9.01308133 L20.4893433,8.97910544 C20.4657301,8.9349526 20.4400474,8.90926991 20.3958946,8.88565671 C20.3660974,8.86972103 20.3516872,8.8627579 20.3318752,8.8572764 L20.2955075,8.84922901 C20.1984671,8.83048964 20.0431333,8.8174763 19.8089755,8.81365905 L16.3411424,8.8125 Z M17.2291667,2.46875 C18.3792596,2.46875 19.321062,3.36054828 19.4007837,4.49035493 L19.40625,4.64583333 L19.40575,5.81175 L17.90575,5.81175 L17.90625,4.64583333 C17.90625,4.30588533 17.6557206,4.0244516 17.3292211,3.97609132 L17.2291667,3.96875 L3.77083333,3.96875 C3.43088533,3.96875 3.1494516,4.21927937 3.10109132,4.54577892 L3.09375,4.64583333 L3.09375,13.3541667 C3.09375,13.6941147 3.34427937,13.9755484 3.67077892,14.0239087 L3.77083333,14.03125 L12.43675,14.03075 L12.43675,15.53075 L3.77083333,15.53125 C2.62074036,15.53125 1.67893804,14.6394517 1.59921628,13.5096451 L1.59375,13.3541667 L1.59375,4.64583333 C1.59375,3.49574036 2.48554828,2.55393804 3.61535493,2.47421628 L3.77083333,2.46875 L17.2291667,2.46875 Z" id="形状结合" fill="#99000000"></path>
+    </g>
 </svg>
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_nearby.svg b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_nearby.svg
index 4b201c865105325c085d7c761baef6087e4e57d3..37c6c67449bfeb1ed404c5c90453e043206b2afa 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_nearby.svg
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_nearby.svg
@@ -1,7 +1,7 @@
-<?xml version="1.0" encoding="UTF-8"?>
-<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
-    <title>HM/ic/24x24/ic_nearby</title>
-    <g id="HM/ic/24x24/ic_nearby" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd" fill-opacity="0.9">
-        <path d="M12,1 C14.9437925,1 17.7055736,2.16266222 19.752529,4.19626361 C20.0202839,4.46227172 20.0452692,4.88001852 19.8270348,5.17433848 L19.7542674,5.25865649 L16.5608852,8.45349449 C16.5258891,8.52237714 16.4795684,8.58698148 16.4219251,8.64453927 C16.3642819,8.70209706 16.2996089,8.74832189 16.2306744,8.78321581 L13.8275423,11.1863159 C13.9383848,11.4348944 14,11.7102517 14,12 C14,13.1045695 13.1045695,14 12,14 C10.8954305,14 10,13.1045695 10,12 C10,10.8954305 10.8954305,10 12,10 C12.2640695,10 12.5161858,10.0511779 12.7469714,10.1441562 L14.7579106,8.13187506 C13.9642117,7.56455608 13.0076029,7.25 12,7.25 C9.37664744,7.25 7.25,9.37664744 7.25,12 C7.25,14.6233526 9.37664744,16.75 12,16.75 C14.6233526,16.75 16.75,14.6233526 16.75,12 C16.75,11.733302 16.7280951,11.4696976 16.6848687,11.2108711 C16.6166361,10.8023161 16.892522,10.4158034 17.301077,10.3475709 C17.709632,10.2793383 18.0961447,10.5552242 18.1643772,10.9637792 C18.2212276,11.3041811 18.25,11.6504302 18.25,12 C18.25,15.4517797 15.4517797,18.25 12,18.25 C8.54822031,18.25 5.75,15.4517797 5.75,12 C5.75,8.54822031 8.54822031,5.75 12,5.75 C13.4102831,5.75 14.7474594,6.21997228 15.8290828,7.05978622 L18.139,4.751 L17.9728918,4.61183304 C16.3857713,3.32623459 14.4198236,2.57734388 12.3308269,2.5056688 L12,2.5 C6.75329488,2.5 2.5,6.75329488 2.5,12 C2.5,17.2467051 6.75329488,21.5 12,21.5 C17.2467051,21.5 21.5,17.2467051 21.5,12 C21.5,10.438282 21.1233622,8.9324315 20.4124178,7.58178142 C20.2194832,7.21524478 20.3602155,6.76170371 20.7267521,6.56876909 C21.0932887,6.37583447 21.5468298,6.51656672 21.7397644,6.88310336 C22.5634355,8.44791126 23,10.1933572 23,12 C23,18.0751322 18.0751322,23 12,23 C5.92486775,23 1,18.0751322 1,12 C1,5.92486775 5.92486775,1 12,1 Z" id="形状结合" fill="#000000"></path>
-    </g>
+<?xml version="1.0" encoding="UTF-8"?>
+<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
+    <title>HM/ic/24x24/ic_nearby</title>
+    <g id="HM/ic/24x24/ic_nearby" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd" fill-opacity="0.9">
+        <path d="M12,1 C14.9437925,1 17.7055736,2.16266222 19.752529,4.19626361 C20.0202839,4.46227172 20.0452692,4.88001852 19.8270348,5.17433848 L19.7542674,5.25865649 L16.5608852,8.45349449 C16.5258891,8.52237714 16.4795684,8.58698148 16.4219251,8.64453927 C16.3642819,8.70209706 16.2996089,8.74832189 16.2306744,8.78321581 L13.8275423,11.1863159 C13.9383848,11.4348944 14,11.7102517 14,12 C14,13.1045695 13.1045695,14 12,14 C10.8954305,14 10,13.1045695 10,12 C10,10.8954305 10.8954305,10 12,10 C12.2640695,10 12.5161858,10.0511779 12.7469714,10.1441562 L14.7579106,8.13187506 C13.9642117,7.56455608 13.0076029,7.25 12,7.25 C9.37664744,7.25 7.25,9.37664744 7.25,12 C7.25,14.6233526 9.37664744,16.75 12,16.75 C14.6233526,16.75 16.75,14.6233526 16.75,12 C16.75,11.733302 16.7280951,11.4696976 16.6848687,11.2108711 C16.6166361,10.8023161 16.892522,10.4158034 17.301077,10.3475709 C17.709632,10.2793383 18.0961447,10.5552242 18.1643772,10.9637792 C18.2212276,11.3041811 18.25,11.6504302 18.25,12 C18.25,15.4517797 15.4517797,18.25 12,18.25 C8.54822031,18.25 5.75,15.4517797 5.75,12 C5.75,8.54822031 8.54822031,5.75 12,5.75 C13.4102831,5.75 14.7474594,6.21997228 15.8290828,7.05978622 L18.139,4.751 L17.9728918,4.61183304 C16.3857713,3.32623459 14.4198236,2.57734388 12.3308269,2.5056688 L12,2.5 C6.75329488,2.5 2.5,6.75329488 2.5,12 C2.5,17.2467051 6.75329488,21.5 12,21.5 C17.2467051,21.5 21.5,17.2467051 21.5,12 C21.5,10.438282 21.1233622,8.9324315 20.4124178,7.58178142 C20.2194832,7.21524478 20.3602155,6.76170371 20.7267521,6.56876909 C21.0932887,6.37583447 21.5468298,6.51656672 21.7397644,6.88310336 C22.5634355,8.44791126 23,10.1933572 23,12 C23,18.0751322 18.0751322,23 12,23 C5.92486775,23 1,18.0751322 1,12 C1,5.92486775 5.92486775,1 12,1 Z" id="形状结合" fill="#000000"></path>
+    </g>
 </svg>
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_calendar.svg b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_calendar.svg
index bfb163637ada7dffff34bdc44ada22a1dbb7537b..af519b323a5a2d24edf1c56c2263ce9fa48a3cda 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_calendar.svg
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_calendar.svg
@@ -1,13 +1,13 @@
-<?xml version="1.0" encoding="UTF-8"?>
-<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
-    <title>Public/ic_public_calendar</title>
-    <defs>
-        <path d="M16.25,1 C16.7628358,1 17.1855072,1.38604019 17.2432723,1.88337887 L17.25,2 L17.25,4 C17.25,4.55228475 16.8022847,5 16.25,5 C15.6977153,5 15.25,4.55228475 15.25,4 L15.25,3.5 L8.75,3.5 L8.75,4 C8.75,4.55228475 8.30228475,5 7.75,5 C7.19771525,5 6.75,4.55228475 6.75,4 L6.75,3.5 L6,3.5 C4.64269002,3.5 3.53801707,4.5816677 3.50096045,5.93002379 L3.5,7.5 L20.5,7.5 L20.5,6 C20.5,4.70385488 19.5136228,3.6380905 18.250561,3.51239958 L18.2509202,2.00774235 C20.3431683,2.13724416 22,3.87513518 22,6 L22,18 C22,20.209139 20.209139,22 18,22 L6,22 C3.790861,22 2,20.209139 2,18 L2,6 C2,3.790861 3.790861,2 6,2 L6.75,2 C6.75,1.44771525 7.19771525,1 7.75,1 C8.30228475,1 8.75,1.44771525 8.75,2 L15.25,2 C15.25,1.44771525 15.6977153,1 16.25,1 Z M20.5,9 L3.5,9 L3.5,18 C3.5,19.35731 4.5816677,20.4619829 5.93002379,20.4990396 L6,20.5 L18,20.5 C19.35731,20.5 20.4619829,19.4183323 20.4990396,18.0699762 L20.5,18 L20.5,9 Z" id="path-1"></path>
-    </defs>
-    <g id="Public/ic_public_calendar" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
-        <mask id="mask-2" fill="white">
-            <use xlink:href="#path-1"></use>
-        </mask>
-        <use id="形状结合" fill="#99000000" fill-rule="nonzero" xlink:href="#path-1"></use>
-    </g>
+<?xml version="1.0" encoding="UTF-8"?>
+<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
+    <title>Public/ic_public_calendar</title>
+    <defs>
+        <path d="M16.25,1 C16.7628358,1 17.1855072,1.38604019 17.2432723,1.88337887 L17.25,2 L17.25,4 C17.25,4.55228475 16.8022847,5 16.25,5 C15.6977153,5 15.25,4.55228475 15.25,4 L15.25,3.5 L8.75,3.5 L8.75,4 C8.75,4.55228475 8.30228475,5 7.75,5 C7.19771525,5 6.75,4.55228475 6.75,4 L6.75,3.5 L6,3.5 C4.64269002,3.5 3.53801707,4.5816677 3.50096045,5.93002379 L3.5,7.5 L20.5,7.5 L20.5,6 C20.5,4.70385488 19.5136228,3.6380905 18.250561,3.51239958 L18.2509202,2.00774235 C20.3431683,2.13724416 22,3.87513518 22,6 L22,18 C22,20.209139 20.209139,22 18,22 L6,22 C3.790861,22 2,20.209139 2,18 L2,6 C2,3.790861 3.790861,2 6,2 L6.75,2 C6.75,1.44771525 7.19771525,1 7.75,1 C8.30228475,1 8.75,1.44771525 8.75,2 L15.25,2 C15.25,1.44771525 15.6977153,1 16.25,1 Z M20.5,9 L3.5,9 L3.5,18 C3.5,19.35731 4.5816677,20.4619829 5.93002379,20.4990396 L6,20.5 L18,20.5 C19.35731,20.5 20.4619829,19.4183323 20.4990396,18.0699762 L20.5,18 L20.5,9 Z" id="path-1"></path>
+    </defs>
+    <g id="Public/ic_public_calendar" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
+        <mask id="mask-2" fill="white">
+            <use xlink:href="#path-1"></use>
+        </mask>
+        <use id="形状结合" fill="#99000000" fill-rule="nonzero" xlink:href="#path-1"></use>
+    </g>
 </svg>
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_camera.svg b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_camera.svg
index 535b7a305c97bdf9b89f721677b258440eadb8ca..56a0c74330c32eb3028298a223ab9705af436b91 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_camera.svg
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_camera.svg
@@ -1,13 +1,13 @@
-<?xml version="1.0" encoding="UTF-8"?>
-<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
-    <title>Public/ic_public_camera</title>
-    <defs>
-        <path d="M15.1205992,3 C15.7758689,3 16.3895761,3.32098956 16.7633392,3.85920838 L17.9027778,5.5 L20,5.5 C21.6568542,5.5 23,6.84314575 23,8.5 L23,17.5 C23,19.1568542 21.6568542,20.5 20,20.5 L4,20.5 C2.34314575,20.5 1,19.1568542 1,17.5 L1,8.5 C1,6.84314575 2.34314575,5.5 4,5.5 L6.09722222,5.5 L7.23666085,3.85920838 C7.61042392,3.32098956 8.22413111,3 8.87940078,3 L15.1205992,3 Z M15.1205992,4.5 L8.87940078,4.5 C8.71558336,4.5 8.56215656,4.58024739 8.4687158,4.7148021 L6.88177281,7 L4,7 C3.17157288,7 2.5,7.67157288 2.5,8.5 L2.5,17.5 C2.5,18.3284271 3.17157288,19 4,19 L20,19 C20.8284271,19 21.5,18.3284271 21.5,17.5 L21.5,8.5 C21.5,7.67157288 20.8284271,7 20,7 L17.1182272,7 L15.5312842,4.7148021 C15.4378434,4.58024739 15.2844166,4.5 15.1205992,4.5 Z M12,7.75 C14.6233526,7.75 16.75,9.87664744 16.75,12.5 C16.75,15.1233526 14.6233526,17.25 12,17.25 C9.37664744,17.25 7.25,15.1233526 7.25,12.5 C7.25,9.87664744 9.37664744,7.75 12,7.75 Z M12,9.25 C10.2050746,9.25 8.75,10.7050746 8.75,12.5 C8.75,14.2949254 10.2050746,15.75 12,15.75 C13.7949254,15.75 15.25,14.2949254 15.25,12.5 C15.25,10.7050746 13.7949254,9.25 12,9.25 Z" id="path-1"></path>
-    </defs>
-    <g id="Public/ic_public_camera" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
-        <mask id="mask-2" fill="white">
-            <use xlink:href="#path-1"></use>
-        </mask>
-        <use id="合并形状" fill="#99000000" fill-rule="nonzero" xlink:href="#path-1"></use>
-    </g>
+<?xml version="1.0" encoding="UTF-8"?>
+<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
+    <title>Public/ic_public_camera</title>
+    <defs>
+        <path d="M15.1205992,3 C15.7758689,3 16.3895761,3.32098956 16.7633392,3.85920838 L17.9027778,5.5 L20,5.5 C21.6568542,5.5 23,6.84314575 23,8.5 L23,17.5 C23,19.1568542 21.6568542,20.5 20,20.5 L4,20.5 C2.34314575,20.5 1,19.1568542 1,17.5 L1,8.5 C1,6.84314575 2.34314575,5.5 4,5.5 L6.09722222,5.5 L7.23666085,3.85920838 C7.61042392,3.32098956 8.22413111,3 8.87940078,3 L15.1205992,3 Z M15.1205992,4.5 L8.87940078,4.5 C8.71558336,4.5 8.56215656,4.58024739 8.4687158,4.7148021 L6.88177281,7 L4,7 C3.17157288,7 2.5,7.67157288 2.5,8.5 L2.5,17.5 C2.5,18.3284271 3.17157288,19 4,19 L20,19 C20.8284271,19 21.5,18.3284271 21.5,17.5 L21.5,8.5 C21.5,7.67157288 20.8284271,7 20,7 L17.1182272,7 L15.5312842,4.7148021 C15.4378434,4.58024739 15.2844166,4.5 15.1205992,4.5 Z M12,7.75 C14.6233526,7.75 16.75,9.87664744 16.75,12.5 C16.75,15.1233526 14.6233526,17.25 12,17.25 C9.37664744,17.25 7.25,15.1233526 7.25,12.5 C7.25,9.87664744 9.37664744,7.75 12,7.75 Z M12,9.25 C10.2050746,9.25 8.75,10.7050746 8.75,12.5 C8.75,14.2949254 10.2050746,15.75 12,15.75 C13.7949254,15.75 15.25,14.2949254 15.25,12.5 C15.25,10.7050746 13.7949254,9.25 12,9.25 Z" id="path-1"></path>
+    </defs>
+    <g id="Public/ic_public_camera" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
+        <mask id="mask-2" fill="white">
+            <use xlink:href="#path-1"></use>
+        </mask>
+        <use id="合并形状" fill="#99000000" fill-rule="nonzero" xlink:href="#path-1"></use>
+    </g>
 </svg>
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_contacts_group.svg b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_contacts_group.svg
index e01910786672f291f336e87ef79ea34ff1a6841f..35329fd29f42732c0c5b59d3550fa4d835a089b1 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_contacts_group.svg
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_contacts_group.svg
@@ -1,13 +1,13 @@
-<?xml version="1.0" encoding="UTF-8"?>
-<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
-    <title>Public/ic_public_contacts_group</title>
-    <defs>
-        <path d="M11,2.5 C13.8994949,2.5 16.25,4.85050506 16.25,7.75 C16.25,9.51473805 15.3792831,11.0761093 14.0440228,12.0279401 C17.516287,13.2752612 20,16.5975795 20,20.5 C20,20.9142136 19.6642136,21.25 19.25,21.25 C18.8357864,21.25 18.5,20.9142136 18.5,20.5 C18.5,16.3578644 15.1421356,13 11,13 C6.85786438,13 3.5,16.3578644 3.5,20.5 C3.5,20.8796958 3.21784612,21.193491 2.85177056,21.2431534 L2.75,21.25 L2.75,21.25 C2.33578644,21.25 2,20.9142136 2,20.5 C2,16.5975795 4.48371302,13.2752612 7.95660209,12.0275821 C6.62071692,11.0761093 5.75,9.51473805 5.75,7.75 C5.75,4.85050506 8.10050506,2.5 11,2.5 Z M16.8455126,11.990365 L16.9001786,11.9998698 L16.9001786,11.9998698 C20.1151694,13.1058156 21.5244976,15.7436283 21.9852941,16.7777778 C22.1978509,17.2548115 22.3699793,17.8850275 22.5016794,18.6684258 C22.6803621,19.731297 21.9852991,20.7391431 20.939535,20.957517 C20.9790064,20.8115098 21,20.6582066 21,20.5 L20.9991975,20.3725581 C20.9583277,17.1285533 19.3592048,14.1922682 16.8371835,12.3780488 C16.8267847,12.3705684 16.8087299,12.357267 16.7830192,12.3381447 L16.7386575,12.3051674 C16.6613354,12.2473649 16.6455116,12.1378247 16.7033141,12.0605026 C16.7374229,12.0148754 16.790703,11.989685 16.8455126,11.990365 Z M11,4 C8.92893219,4 7.25,5.67893219 7.25,7.75 C7.25,9.82106781 8.92893219,11.5 11,11.5 C13.0710678,11.5 14.75,9.82106781 14.75,7.75 C14.75,5.67893219 13.0710678,4 11,4 Z M14.3933827,2.26605683 C16.8326968,2.46603293 18.75,4.50911139 18.75,7 C18.75,8.63466202 17.9242699,10.0764644 16.6671636,10.9310533 L16.6534314,10.9403132 L16.6534314,10.9403132 L16.6390036,10.9498595 C16.582224,10.9872983 16.505845,10.9716194 16.4684062,10.9148398 C16.4515547,10.8892829 16.445116,10.8588907 16.4493121,10.8295803 L16.4636103,10.7871659 L16.4636103,10.7871659 C16.9705014,9.8763586 17.25,8.83638014 17.25,7.75 C17.25,5.54150753 16.1045197,3.60055631 14.3752757,2.48882859 C14.3740147,2.48801791 14.3670156,2.48382955 14.3542783,2.4762635 L14.3308634,2.4623901 C14.2806258,2.43263244 14.2640236,2.36778346 14.2937812,2.31754587 C14.3143973,2.28274139 14.3530659,2.26275164 14.3933827,2.26605683 Z" id="path-1"></path>
-    </defs>
-    <g id="Public/ic_public_contacts_group" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
-        <mask id="mask-2" fill="white">
-            <use xlink:href="#path-1"></use>
-        </mask>
-        <use id="蒙版" fill="#99000000" fill-rule="nonzero" xlink:href="#path-1"></use>
-    </g>
+<?xml version="1.0" encoding="UTF-8"?>
+<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
+    <title>Public/ic_public_contacts_group</title>
+    <defs>
+        <path d="M11,2.5 C13.8994949,2.5 16.25,4.85050506 16.25,7.75 C16.25,9.51473805 15.3792831,11.0761093 14.0440228,12.0279401 C17.516287,13.2752612 20,16.5975795 20,20.5 C20,20.9142136 19.6642136,21.25 19.25,21.25 C18.8357864,21.25 18.5,20.9142136 18.5,20.5 C18.5,16.3578644 15.1421356,13 11,13 C6.85786438,13 3.5,16.3578644 3.5,20.5 C3.5,20.8796958 3.21784612,21.193491 2.85177056,21.2431534 L2.75,21.25 L2.75,21.25 C2.33578644,21.25 2,20.9142136 2,20.5 C2,16.5975795 4.48371302,13.2752612 7.95660209,12.0275821 C6.62071692,11.0761093 5.75,9.51473805 5.75,7.75 C5.75,4.85050506 8.10050506,2.5 11,2.5 Z M16.8455126,11.990365 L16.9001786,11.9998698 L16.9001786,11.9998698 C20.1151694,13.1058156 21.5244976,15.7436283 21.9852941,16.7777778 C22.1978509,17.2548115 22.3699793,17.8850275 22.5016794,18.6684258 C22.6803621,19.731297 21.9852991,20.7391431 20.939535,20.957517 C20.9790064,20.8115098 21,20.6582066 21,20.5 L20.9991975,20.3725581 C20.9583277,17.1285533 19.3592048,14.1922682 16.8371835,12.3780488 C16.8267847,12.3705684 16.8087299,12.357267 16.7830192,12.3381447 L16.7386575,12.3051674 C16.6613354,12.2473649 16.6455116,12.1378247 16.7033141,12.0605026 C16.7374229,12.0148754 16.790703,11.989685 16.8455126,11.990365 Z M11,4 C8.92893219,4 7.25,5.67893219 7.25,7.75 C7.25,9.82106781 8.92893219,11.5 11,11.5 C13.0710678,11.5 14.75,9.82106781 14.75,7.75 C14.75,5.67893219 13.0710678,4 11,4 Z M14.3933827,2.26605683 C16.8326968,2.46603293 18.75,4.50911139 18.75,7 C18.75,8.63466202 17.9242699,10.0764644 16.6671636,10.9310533 L16.6534314,10.9403132 L16.6534314,10.9403132 L16.6390036,10.9498595 C16.582224,10.9872983 16.505845,10.9716194 16.4684062,10.9148398 C16.4515547,10.8892829 16.445116,10.8588907 16.4493121,10.8295803 L16.4636103,10.7871659 L16.4636103,10.7871659 C16.9705014,9.8763586 17.25,8.83638014 17.25,7.75 C17.25,5.54150753 16.1045197,3.60055631 14.3752757,2.48882859 C14.3740147,2.48801791 14.3670156,2.48382955 14.3542783,2.4762635 L14.3308634,2.4623901 C14.2806258,2.43263244 14.2640236,2.36778346 14.2937812,2.31754587 C14.3143973,2.28274139 14.3530659,2.26275164 14.3933827,2.26605683 Z" id="path-1"></path>
+    </defs>
+    <g id="Public/ic_public_contacts_group" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
+        <mask id="mask-2" fill="white">
+            <use xlink:href="#path-1"></use>
+        </mask>
+        <use id="蒙版" fill="#99000000" fill-rule="nonzero" xlink:href="#path-1"></use>
+    </g>
 </svg>
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_folder.svg b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_folder.svg
index 01a9fae004cf330b53f98d2b72c294fa1465c88e..fb107a15a2553d3996d793155869dbaad9af7738 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_folder.svg
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_folder.svg
@@ -1,13 +1,13 @@
-<?xml version="1.0" encoding="UTF-8"?>
-<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
-    <title>Public/ic_public_folder</title>
-    <defs>
-        <path d="M7.37867966,3 C7.77650439,3 8.15803526,3.15803526 8.43933983,3.43933983 L11.7071068,6.70710678 C11.8946432,6.89464316 12.1489971,7 12.4142136,7 L19,7 C19.149679,7 19.2974379,7.00822125 19.4428497,7.02423682 C19.2349828,6.16929644 18.4757047,5.5288976 17.5622948,5.50095171 L17.5,5.5 L11.957,5.49986632 L10.45675,3.99986632 L17.5,4 C19.4329966,4 21,5.56700338 21,7.5 L21.0001204,7.53519846 C22.1956568,8.22683444 23,9.51948501 23,11 L23,17 C23,19.209139 21.209139,21 19,21 L5,21 C2.790861,21 1,19.209139 1,17 L1,7 C1,4.790861 2.790861,3 5,3 L7.37867966,3 Z M7.37867966,4.5 L5,4.5 C3.64269002,4.5 2.53801707,5.5816677 2.50096045,6.93002379 L2.5,17 C2.5,18.35731 3.5816677,19.4619829 4.93002379,19.4990396 L5,19.5 L19,19.5 C20.35731,19.5 21.4619829,18.4183323 21.4990396,17.0699762 L21.5,17 L21.5,11 C21.5,9.64269002 20.4183323,8.53801707 19.0699762,8.50096045 L12.4142136,8.5 C11.7787991,8.5 11.1683251,8.25809996 10.7059116,7.82529783 L10.6464466,7.76776695 L7.37867966,4.5 Z" id="path-1"></path>
-    </defs>
-    <g id="Public/ic_public_folder" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
-        <mask id="mask-2" fill="white">
-            <use xlink:href="#path-1"></use>
-        </mask>
-        <use id="形状结合" fill="#99000000" fill-rule="nonzero" xlink:href="#path-1"></use>
-    </g>
+<?xml version="1.0" encoding="UTF-8"?>
+<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
+    <title>Public/ic_public_folder</title>
+    <defs>
+        <path d="M7.37867966,3 C7.77650439,3 8.15803526,3.15803526 8.43933983,3.43933983 L11.7071068,6.70710678 C11.8946432,6.89464316 12.1489971,7 12.4142136,7 L19,7 C19.149679,7 19.2974379,7.00822125 19.4428497,7.02423682 C19.2349828,6.16929644 18.4757047,5.5288976 17.5622948,5.50095171 L17.5,5.5 L11.957,5.49986632 L10.45675,3.99986632 L17.5,4 C19.4329966,4 21,5.56700338 21,7.5 L21.0001204,7.53519846 C22.1956568,8.22683444 23,9.51948501 23,11 L23,17 C23,19.209139 21.209139,21 19,21 L5,21 C2.790861,21 1,19.209139 1,17 L1,7 C1,4.790861 2.790861,3 5,3 L7.37867966,3 Z M7.37867966,4.5 L5,4.5 C3.64269002,4.5 2.53801707,5.5816677 2.50096045,6.93002379 L2.5,17 C2.5,18.35731 3.5816677,19.4619829 4.93002379,19.4990396 L5,19.5 L19,19.5 C20.35731,19.5 21.4619829,18.4183323 21.4990396,17.0699762 L21.5,17 L21.5,11 C21.5,9.64269002 20.4183323,8.53801707 19.0699762,8.50096045 L12.4142136,8.5 C11.7787991,8.5 11.1683251,8.25809996 10.7059116,7.82529783 L10.6464466,7.76776695 L7.37867966,4.5 Z" id="path-1"></path>
+    </defs>
+    <g id="Public/ic_public_folder" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
+        <mask id="mask-2" fill="white">
+            <use xlink:href="#path-1"></use>
+        </mask>
+        <use id="形状结合" fill="#99000000" fill-rule="nonzero" xlink:href="#path-1"></use>
+    </g>
 </svg>
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_gps.svg b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_gps.svg
index 738516f856e056c84f33287f5e00ac34b6234b49..c78bc694da7bbc3a596d92bffabadfa6c0682989 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_gps.svg
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_gps.svg
@@ -1,13 +1,13 @@
-<?xml version="1.0" encoding="UTF-8"?>
-<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
-    <title>Public/ic_public_gps</title>
-    <defs>
-        <path d="M12,0.890443665 C17.1054507,0.890443665 21.25,4.95664638 21.25,9.97979602 C21.25,11.9360332 20.6574499,13.8475128 19.5576286,15.7794054 C18.8729064,16.982155 18.0501448,18.1145504 16.9608635,19.4075471 L16.9608635,19.4075471 L16.694253,19.7210681 L16.4170134,20.0414657 C16.3227849,20.1494899 16.226719,20.2587783 16.1287501,20.3694494 C15.9102985,20.6162244 15.6650022,20.8755327 15.3927717,21.1475453 L15.3927717,21.1475453 L15.1835472,21.3539395 C15.0406956,21.4931272 14.8911049,21.6355018 14.7347638,21.7810844 L14.7347638,21.7810844 L14.495188,22.0018672 L14.495188,22.0018672 L14.3716004,22.1140683 L14.1168206,22.3420995 C14.0302033,22.4189177 13.941895,22.4965447 13.8518942,22.5749831 L13.8518942,22.5749831 L13.576813,22.812735 C12.7041229,23.5609204 11.420977,23.5841619 10.509368,22.8615879 L10.509368,22.8615879 L10.4382537,22.8023123 L10.1073598,22.5137335 L9.90321903,22.3340223 L9.61389638,22.0766955 L9.34473731,21.8339368 L9.09562633,21.6056114 L8.86644795,21.3915843 L8.724679,21.2567766 L8.59168343,21.1282238 L8.46742704,21.005886 L8.35187559,20.8897232 L8.24499487,20.7796955 C8.22790207,20.7618666 8.21116914,20.7442916 8.19479534,20.7269698 L8.19479534,20.7269698 L8.10085655,20.6260697 L7.86894106,20.3672896 L7.61273271,20.0767393 C7.57055128,20.0285012 7.5286302,19.9803553 7.48697003,19.9322997 L7.48697003,19.9322997 L7.24014438,19.6450348 L6.99960722,19.3598463 L6.99960722,19.3598463 L6.88170517,19.2180024 L6.65065082,18.9357582 L6.42595171,18.6553632 C4.02623205,15.6274382 2.75,12.9090303 2.75,9.97979602 C2.75,4.99342455 6.70791088,0.971543045 11.7334486,0.891584596 L11.7334486,0.891584596 L11.8799375,0.890443665 Z M12,2.39041996 L11.8859001,2.39041996 L11.751346,2.39146593 C7.55083692,2.4583177 4.25,5.81250514 4.25,9.97979602 C4.25,12.896509 5.7991974,15.7221073 8.73645395,19.0830958 L8.73645395,19.0830958 L8.98797346,19.3684114 L9.21242661,19.6189224 C9.22500367,19.6326529 9.23793618,19.6466487 9.25122371,19.6609093 L9.25122371,19.6609093 L9.33520518,19.7496461 L9.42768459,19.8447124 L9.52863979,19.9460825 L9.69591626,20.1099012 L9.88213873,20.2877593 L10.0872325,20.4795705 L10.2344088,20.6151536 L10.4707886,20.8300276 L10.7258404,21.058624 L10.9994895,21.3008564 L11.4099685,21.659761 L11.4539143,21.6964471 C11.7903355,21.963019 12.2735456,21.9542667 12.6005016,21.6739567 L12.6005016,21.6739567 L12.8630218,21.4470837 L13.1154007,21.2252993 C13.1978358,21.152221 13.2785793,21.0799935 13.3576298,21.0086194 L13.3576298,21.0086194 L13.5897008,20.7970601 L13.8116053,20.5906375 L14.0233349,20.3893676 L14.2248812,20.1932664 C14.5195589,19.9029991 14.7798395,19.6302305 15.0055957,19.3752039 C15.0481588,19.3271223 15.0904304,19.279197 15.1324106,19.2314252 L15.1324106,19.2314252 L15.3807972,18.9466135 C15.4216128,18.8994442 15.4621375,18.8524226 15.5023714,18.8055459 L15.5023714,18.8055459 L15.7402879,18.5260009 L15.9712367,18.2497939 C16.1228823,18.066738 16.2698895,17.8858152 16.4122716,17.7068412 L16.4122716,17.7068412 L16.6223776,17.4398186 C18.723223,14.739479 19.75,12.4708886 19.75,9.97979602 C19.75,5.7915486 16.2833634,2.39041996 12,2.39041996 L12,2.39041996 Z M12,7.75 C13.2426407,7.75 14.25,8.75735931 14.25,10 C14.25,11.2426407 13.2426407,12.25 12,12.25 C10.7573593,12.25 9.75,11.2426407 9.75,10 C9.75,8.75735931 10.7573593,7.75 12,7.75 Z" id="path-1"></path>
-    </defs>
-    <g id="Public/ic_public_gps" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
-        <mask id="mask-2" fill="white">
-            <use xlink:href="#path-1"></use>
-        </mask>
-        <use id="蒙版" fill="#99000000" fill-rule="nonzero" xlink:href="#path-1"></use>
-    </g>
+<?xml version="1.0" encoding="UTF-8"?>
+<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
+    <title>Public/ic_public_gps</title>
+    <defs>
+        <path d="M12,0.890443665 C17.1054507,0.890443665 21.25,4.95664638 21.25,9.97979602 C21.25,11.9360332 20.6574499,13.8475128 19.5576286,15.7794054 C18.8729064,16.982155 18.0501448,18.1145504 16.9608635,19.4075471 L16.9608635,19.4075471 L16.694253,19.7210681 L16.4170134,20.0414657 C16.3227849,20.1494899 16.226719,20.2587783 16.1287501,20.3694494 C15.9102985,20.6162244 15.6650022,20.8755327 15.3927717,21.1475453 L15.3927717,21.1475453 L15.1835472,21.3539395 C15.0406956,21.4931272 14.8911049,21.6355018 14.7347638,21.7810844 L14.7347638,21.7810844 L14.495188,22.0018672 L14.495188,22.0018672 L14.3716004,22.1140683 L14.1168206,22.3420995 C14.0302033,22.4189177 13.941895,22.4965447 13.8518942,22.5749831 L13.8518942,22.5749831 L13.576813,22.812735 C12.7041229,23.5609204 11.420977,23.5841619 10.509368,22.8615879 L10.509368,22.8615879 L10.4382537,22.8023123 L10.1073598,22.5137335 L9.90321903,22.3340223 L9.61389638,22.0766955 L9.34473731,21.8339368 L9.09562633,21.6056114 L8.86644795,21.3915843 L8.724679,21.2567766 L8.59168343,21.1282238 L8.46742704,21.005886 L8.35187559,20.8897232 L8.24499487,20.7796955 C8.22790207,20.7618666 8.21116914,20.7442916 8.19479534,20.7269698 L8.19479534,20.7269698 L8.10085655,20.6260697 L7.86894106,20.3672896 L7.61273271,20.0767393 C7.57055128,20.0285012 7.5286302,19.9803553 7.48697003,19.9322997 L7.48697003,19.9322997 L7.24014438,19.6450348 L6.99960722,19.3598463 L6.99960722,19.3598463 L6.88170517,19.2180024 L6.65065082,18.9357582 L6.42595171,18.6553632 C4.02623205,15.6274382 2.75,12.9090303 2.75,9.97979602 C2.75,4.99342455 6.70791088,0.971543045 11.7334486,0.891584596 L11.7334486,0.891584596 L11.8799375,0.890443665 Z M12,2.39041996 L11.8859001,2.39041996 L11.751346,2.39146593 C7.55083692,2.4583177 4.25,5.81250514 4.25,9.97979602 C4.25,12.896509 5.7991974,15.7221073 8.73645395,19.0830958 L8.73645395,19.0830958 L8.98797346,19.3684114 L9.21242661,19.6189224 C9.22500367,19.6326529 9.23793618,19.6466487 9.25122371,19.6609093 L9.25122371,19.6609093 L9.33520518,19.7496461 L9.42768459,19.8447124 L9.52863979,19.9460825 L9.69591626,20.1099012 L9.88213873,20.2877593 L10.0872325,20.4795705 L10.2344088,20.6151536 L10.4707886,20.8300276 L10.7258404,21.058624 L10.9994895,21.3008564 L11.4099685,21.659761 L11.4539143,21.6964471 C11.7903355,21.963019 12.2735456,21.9542667 12.6005016,21.6739567 L12.6005016,21.6739567 L12.8630218,21.4470837 L13.1154007,21.2252993 C13.1978358,21.152221 13.2785793,21.0799935 13.3576298,21.0086194 L13.3576298,21.0086194 L13.5897008,20.7970601 L13.8116053,20.5906375 L14.0233349,20.3893676 L14.2248812,20.1932664 C14.5195589,19.9029991 14.7798395,19.6302305 15.0055957,19.3752039 C15.0481588,19.3271223 15.0904304,19.279197 15.1324106,19.2314252 L15.1324106,19.2314252 L15.3807972,18.9466135 C15.4216128,18.8994442 15.4621375,18.8524226 15.5023714,18.8055459 L15.5023714,18.8055459 L15.7402879,18.5260009 L15.9712367,18.2497939 C16.1228823,18.066738 16.2698895,17.8858152 16.4122716,17.7068412 L16.4122716,17.7068412 L16.6223776,17.4398186 C18.723223,14.739479 19.75,12.4708886 19.75,9.97979602 C19.75,5.7915486 16.2833634,2.39041996 12,2.39041996 L12,2.39041996 Z M12,7.75 C13.2426407,7.75 14.25,8.75735931 14.25,10 C14.25,11.2426407 13.2426407,12.25 12,12.25 C10.7573593,12.25 9.75,11.2426407 9.75,10 C9.75,8.75735931 10.7573593,7.75 12,7.75 Z" id="path-1"></path>
+    </defs>
+    <g id="Public/ic_public_gps" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
+        <mask id="mask-2" fill="white">
+            <use xlink:href="#path-1"></use>
+        </mask>
+        <use id="蒙版" fill="#99000000" fill-rule="nonzero" xlink:href="#path-1"></use>
+    </g>
 </svg>
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_message.svg b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_message.svg
index 79f77f671e5db7a338aaa32dd37bc3e83dd4e647..be86b32981900198aca0a184b24d5999d955eda4 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_message.svg
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_message.svg
@@ -1,13 +1,13 @@
-<?xml version="1.0" encoding="UTF-8"?>
-<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
-    <title>Public/ic_public_message</title>
-    <defs>
-        <path d="M15.75,3 C19.7140238,3 22.9350055,6.18134145 22.9990287,10.130108 L23,10.25 L23,10.5 C23,14.4640238 19.8186586,17.6850055 15.869892,17.7490287 L15.75,17.75 L13.8105,17.75 L9.78033009,21.7803301 C9.4991526,22.0615076 9.05026186,22.0727547 8.75566731,21.8140714 L8.71966991,21.7803301 C8.43849242,21.4991526 8.42724532,21.0502619 8.68592862,20.7556673 L8.71966991,20.7196699 L12.9696699,16.4696699 C13.0986012,16.3407387 13.2696414,16.2635976 13.4504659,16.2516361 L13.5,16.25 L15.75,16.25 C18.8938809,16.25 21.4484526,13.7268671 21.4992297,10.5950868 L21.5,10.5 L21.5,10.25 C21.5,7.10611906 18.9768671,4.55154738 15.8450868,4.50077034 L15.75,4.5 L8.25,4.5 C5.10611906,4.5 2.55154738,7.02313287 2.50077034,10.1549132 L2.5,10.25 L2.5,10.5 C2.5,13.6438809 5.02313287,16.1984526 8.15491324,16.2492297 L8.25,16.25 L9.25,16.25 C9.66421356,16.25 10,16.5857864 10,17 C10,17.3994202 9.68777001,17.7259152 9.2940682,17.7487268 L9.25,17.75 L8.25,17.75 C4.28597621,17.75 1.06499452,14.5686586 1.00097129,10.619892 L1,10.5 L1,10.25 C1,6.28597621 4.18134145,3.06499452 8.13010799,3.00097129 L8.25,3 L15.75,3 Z" id="path-1"></path>
-    </defs>
-    <g id="Public/ic_public_message" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
-        <mask id="mask-2" fill="white">
-            <use xlink:href="#path-1"></use>
-        </mask>
-        <use id="路径" fill="#99000000" fill-rule="nonzero" xlink:href="#path-1"></use>
-    </g>
+<?xml version="1.0" encoding="UTF-8"?>
+<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
+    <title>Public/ic_public_message</title>
+    <defs>
+        <path d="M15.75,3 C19.7140238,3 22.9350055,6.18134145 22.9990287,10.130108 L23,10.25 L23,10.5 C23,14.4640238 19.8186586,17.6850055 15.869892,17.7490287 L15.75,17.75 L13.8105,17.75 L9.78033009,21.7803301 C9.4991526,22.0615076 9.05026186,22.0727547 8.75566731,21.8140714 L8.71966991,21.7803301 C8.43849242,21.4991526 8.42724532,21.0502619 8.68592862,20.7556673 L8.71966991,20.7196699 L12.9696699,16.4696699 C13.0986012,16.3407387 13.2696414,16.2635976 13.4504659,16.2516361 L13.5,16.25 L15.75,16.25 C18.8938809,16.25 21.4484526,13.7268671 21.4992297,10.5950868 L21.5,10.5 L21.5,10.25 C21.5,7.10611906 18.9768671,4.55154738 15.8450868,4.50077034 L15.75,4.5 L8.25,4.5 C5.10611906,4.5 2.55154738,7.02313287 2.50077034,10.1549132 L2.5,10.25 L2.5,10.5 C2.5,13.6438809 5.02313287,16.1984526 8.15491324,16.2492297 L8.25,16.25 L9.25,16.25 C9.66421356,16.25 10,16.5857864 10,17 C10,17.3994202 9.68777001,17.7259152 9.2940682,17.7487268 L9.25,17.75 L8.25,17.75 C4.28597621,17.75 1.06499452,14.5686586 1.00097129,10.619892 L1,10.5 L1,10.25 C1,6.28597621 4.18134145,3.06499452 8.13010799,3.00097129 L8.25,3 L15.75,3 Z" id="path-1"></path>
+    </defs>
+    <g id="Public/ic_public_message" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
+        <mask id="mask-2" fill="white">
+            <use xlink:href="#path-1"></use>
+        </mask>
+        <use id="路径" fill="#99000000" fill-rule="nonzero" xlink:href="#path-1"></use>
+    </g>
 </svg>
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_phone.svg b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_phone.svg
index df52fe39ccfecf5ac9f7ece40bb50377e79dffd1..755c8b7c8b04c3895f8b990c8026b2f87206185e 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_phone.svg
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_phone.svg
@@ -1,13 +1,13 @@
-<?xml version="1.0" encoding="UTF-8"?>
-<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
-    <title>Public/ic_public_phone</title>
-    <defs>
-        <path d="M5.16720725,2.15694972 C4.57981912,2.29147814 4.01663811,2.67469617 3.45795888,3.28222699 L3.40000863,3.34652585 L3.41706088,3.3290245 C2.31983567,4.41733995 1.86268744,5.99225358 2.20824887,7.49585665 C2.84070426,10.2182299 4.91223973,13.4662736 7.70579392,16.2883966 C10.5332577,19.0872915 13.7813017,21.1588206 16.5019346,21.7908739 L16.5941801,21.8110531 C18.0405745,22.1115169 19.5405408,21.676154 20.6032636,20.6488379 L20.6530605,20.5992242 L20.6367826,20.6144113 C21.3182937,20.0075363 21.7360372,19.3963547 21.858708,18.7555609 C22.0403569,17.8066839 21.6727677,16.8312994 20.9172668,16.2234479 L18.8910284,14.5810212 L18.8910284,14.5810212 C17.9729968,13.7661146 16.5931939,13.7836376 15.699312,14.6157694 L15.6477052,14.665379 L15.6228063,14.690554 L14.686639,15.6828975 C14.5546026,15.8149102 14.3280746,15.8409839 14.1527582,15.7314508 C13.3172557,15.2120891 12.1303644,14.1987708 10.9802683,13.0284399 L10.7611357,12.8108428 C9.67601351,11.7221684 8.75502696,10.6301338 8.26897505,9.84821364 C8.15853902,9.67144831 8.18461264,9.44492031 8.33152313,9.29843477 L9.30896885,8.37671655 L9.33414385,8.35181763 L9.37464007,8.30982875 C10.2003067,7.42306041 10.2324768,6.07746659 9.46508279,5.162393 L9.3537796,5.03091264 L8.22723777,3.64204688 C8.07133397,3.44889272 7.91700627,3.25742016 7.77607494,3.08225607 C7.16822347,2.32675513 6.19283903,1.95916594 5.243962,2.14081487 L5.16720725,2.15694972 Z M20.3854606,18.4735287 C20.3347566,18.7383909 20.0964509,19.087045 19.6392388,19.4941853 L19.6055231,19.5261346 C18.8823263,20.255252 17.8371496,20.5586342 16.839641,20.3293845 C14.4293391,19.7694247 11.4077574,17.8423281 8.7664403,15.2277501 C6.15720291,12.5917737 4.23009995,9.57019147 3.66973827,7.15815029 C3.44742729,6.19082408 3.72736923,5.17688065 4.41193762,4.45676796 L4.50533759,4.36028407 C4.91247789,3.90307193 5.26113202,3.66476633 5.52599414,3.61406226 C5.92515246,3.53764911 6.34435194,3.69563113 6.60738014,4.02254988 L8.02359877,5.77349596 L8.33190757,6.14585543 C8.59711542,6.47956509 8.58061124,6.96151558 8.28584937,7.27815087 L8.26649427,7.29801532 L7.28729807,8.22179031 C6.630534,8.87624912 6.51580142,9.8730476 6.99594523,10.641556 C7.58651914,11.5916262 8.67168241,12.862672 9.91964876,14.08906 L10.1558071,14.3268132 C11.2995201,15.4658 12.4692794,16.45116 13.3594158,17.0044806 L13.4145885,17.0377028 C14.1737396,17.4779592 15.1385121,17.3537064 15.7632834,16.7271225 L16.7010407,15.7332689 L16.7309899,15.7045601 C17.0383508,15.4185862 17.5199701,15.4023958 17.8559701,15.669668 L18.0404137,15.8240228 C18.3872561,16.1094041 19.2522673,16.8090681 19.976973,17.3921427 C20.3038918,17.6551709 20.4618738,18.0743704 20.3854606,18.4735287 Z" id="path-1"></path>
-    </defs>
-    <g id="Public/ic_public_phone" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
-        <mask id="mask-2" fill="white">
-            <use xlink:href="#path-1"></use>
-        </mask>
-        <use id="形状" fill="#99000000" fill-rule="nonzero" xlink:href="#path-1"></use>
-    </g>
+<?xml version="1.0" encoding="UTF-8"?>
+<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
+    <title>Public/ic_public_phone</title>
+    <defs>
+        <path d="M5.16720725,2.15694972 C4.57981912,2.29147814 4.01663811,2.67469617 3.45795888,3.28222699 L3.40000863,3.34652585 L3.41706088,3.3290245 C2.31983567,4.41733995 1.86268744,5.99225358 2.20824887,7.49585665 C2.84070426,10.2182299 4.91223973,13.4662736 7.70579392,16.2883966 C10.5332577,19.0872915 13.7813017,21.1588206 16.5019346,21.7908739 L16.5941801,21.8110531 C18.0405745,22.1115169 19.5405408,21.676154 20.6032636,20.6488379 L20.6530605,20.5992242 L20.6367826,20.6144113 C21.3182937,20.0075363 21.7360372,19.3963547 21.858708,18.7555609 C22.0403569,17.8066839 21.6727677,16.8312994 20.9172668,16.2234479 L18.8910284,14.5810212 L18.8910284,14.5810212 C17.9729968,13.7661146 16.5931939,13.7836376 15.699312,14.6157694 L15.6477052,14.665379 L15.6228063,14.690554 L14.686639,15.6828975 C14.5546026,15.8149102 14.3280746,15.8409839 14.1527582,15.7314508 C13.3172557,15.2120891 12.1303644,14.1987708 10.9802683,13.0284399 L10.7611357,12.8108428 C9.67601351,11.7221684 8.75502696,10.6301338 8.26897505,9.84821364 C8.15853902,9.67144831 8.18461264,9.44492031 8.33152313,9.29843477 L9.30896885,8.37671655 L9.33414385,8.35181763 L9.37464007,8.30982875 C10.2003067,7.42306041 10.2324768,6.07746659 9.46508279,5.162393 L9.3537796,5.03091264 L8.22723777,3.64204688 C8.07133397,3.44889272 7.91700627,3.25742016 7.77607494,3.08225607 C7.16822347,2.32675513 6.19283903,1.95916594 5.243962,2.14081487 L5.16720725,2.15694972 Z M20.3854606,18.4735287 C20.3347566,18.7383909 20.0964509,19.087045 19.6392388,19.4941853 L19.6055231,19.5261346 C18.8823263,20.255252 17.8371496,20.5586342 16.839641,20.3293845 C14.4293391,19.7694247 11.4077574,17.8423281 8.7664403,15.2277501 C6.15720291,12.5917737 4.23009995,9.57019147 3.66973827,7.15815029 C3.44742729,6.19082408 3.72736923,5.17688065 4.41193762,4.45676796 L4.50533759,4.36028407 C4.91247789,3.90307193 5.26113202,3.66476633 5.52599414,3.61406226 C5.92515246,3.53764911 6.34435194,3.69563113 6.60738014,4.02254988 L8.02359877,5.77349596 L8.33190757,6.14585543 C8.59711542,6.47956509 8.58061124,6.96151558 8.28584937,7.27815087 L8.26649427,7.29801532 L7.28729807,8.22179031 C6.630534,8.87624912 6.51580142,9.8730476 6.99594523,10.641556 C7.58651914,11.5916262 8.67168241,12.862672 9.91964876,14.08906 L10.1558071,14.3268132 C11.2995201,15.4658 12.4692794,16.45116 13.3594158,17.0044806 L13.4145885,17.0377028 C14.1737396,17.4779592 15.1385121,17.3537064 15.7632834,16.7271225 L16.7010407,15.7332689 L16.7309899,15.7045601 C17.0383508,15.4185862 17.5199701,15.4023958 17.8559701,15.669668 L18.0404137,15.8240228 C18.3872561,16.1094041 19.2522673,16.8090681 19.976973,17.3921427 C20.3038918,17.6551709 20.4618738,18.0743704 20.3854606,18.4735287 Z" id="path-1"></path>
+    </defs>
+    <g id="Public/ic_public_phone" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
+        <mask id="mask-2" fill="white">
+            <use xlink:href="#path-1"></use>
+        </mask>
+        <use id="形状" fill="#99000000" fill-rule="nonzero" xlink:href="#path-1"></use>
+    </g>
 </svg>
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_voice.svg b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_voice.svg
index 257ae0605e3c1fbb5370efec92c502f3a6e77157..10e4ce3e3e9a47305d119fbedaadad8d9153619d 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_voice.svg
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_public_voice.svg
@@ -1,13 +1,13 @@
-<?xml version="1.0" encoding="UTF-8"?>
-<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
-    <title>Public/ic_public_voice</title>
-    <defs>
-        <path d="M18.75,10.5 C19.1642136,10.5 19.5,10.8357864 19.5,11.25 C19.5,15.1388445 16.5402456,18.3364013 12.750487,18.7129202 L12.75,21.25 C12.75,21.6642136 12.4142136,22 12,22 C11.6005798,22 11.2740848,21.68777 11.2512732,21.2940682 L11.25,21.25 L11.2505192,18.7130201 C7.46027831,18.3369673 4.5,15.1391887 4.5,11.25 C4.5,10.8357864 4.83578644,10.5 5.25,10.5 C5.66421356,10.5 6,10.8357864 6,11.25 C6,14.5637085 8.6862915,17.25 12,17.25 C15.3137085,17.25 18,14.5637085 18,11.25 C18,10.8357864 18.3357864,10.5 18.75,10.5 Z M12,2 C14.209139,2 16,3.790861 16,6 L16,6 L16,11.25 C16,13.459139 14.209139,15.25 12,15.25 C9.790861,15.25 8,13.459139 8,11.25 L8,11.25 L8,6 C8,3.790861 9.790861,2 12,2 Z M12,3.5 C10.6192881,3.5 9.5,4.61928813 9.5,6 L9.5,6 L9.5,11.25 C9.5,12.6307119 10.6192881,13.75 12,13.75 C13.3807119,13.75 14.5,12.6307119 14.5,11.25 L14.5,11.25 L14.5,6 C14.5,4.61928813 13.3807119,3.5 12,3.5 Z" id="path-1"></path>
-    </defs>
-    <g id="Public/ic_public_voice" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
-        <mask id="mask-2" fill="white">
-            <use xlink:href="#path-1"></use>
-        </mask>
-        <use id="形状结合" fill="#99000000" fill-rule="nonzero" xlink:href="#path-1"></use>
-    </g>
+<?xml version="1.0" encoding="UTF-8"?>
+<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
+    <title>Public/ic_public_voice</title>
+    <defs>
+        <path d="M18.75,10.5 C19.1642136,10.5 19.5,10.8357864 19.5,11.25 C19.5,15.1388445 16.5402456,18.3364013 12.750487,18.7129202 L12.75,21.25 C12.75,21.6642136 12.4142136,22 12,22 C11.6005798,22 11.2740848,21.68777 11.2512732,21.2940682 L11.25,21.25 L11.2505192,18.7130201 C7.46027831,18.3369673 4.5,15.1391887 4.5,11.25 C4.5,10.8357864 4.83578644,10.5 5.25,10.5 C5.66421356,10.5 6,10.8357864 6,11.25 C6,14.5637085 8.6862915,17.25 12,17.25 C15.3137085,17.25 18,14.5637085 18,11.25 C18,10.8357864 18.3357864,10.5 18.75,10.5 Z M12,2 C14.209139,2 16,3.790861 16,6 L16,6 L16,11.25 C16,13.459139 14.209139,15.25 12,15.25 C9.790861,15.25 8,13.459139 8,11.25 L8,11.25 L8,6 C8,3.790861 9.790861,2 12,2 Z M12,3.5 C10.6192881,3.5 9.5,4.61928813 9.5,6 L9.5,6 L9.5,11.25 C9.5,12.6307119 10.6192881,13.75 12,13.75 C13.3807119,13.75 14.5,12.6307119 14.5,11.25 L14.5,11.25 L14.5,6 C14.5,4.61928813 13.3807119,3.5 12,3.5 Z" id="path-1"></path>
+    </defs>
+    <g id="Public/ic_public_voice" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
+        <mask id="mask-2" fill="white">
+            <use xlink:href="#path-1"></use>
+        </mask>
+        <use id="形状结合" fill="#99000000" fill-rule="nonzero" xlink:href="#path-1"></use>
+    </g>
 </svg>
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_sport.svg b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_sport.svg
index e9ed5719d253468323a09b2ff0ea6ca4dfc6d3a0..4cac184ae9c9102ea615a0b1d6fd096f7f8985de 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_sport.svg
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_sport.svg
@@ -1,7 +1,7 @@
-<?xml version="1.0" encoding="UTF-8"?>
-<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
-    <title>HM/ic/24x24/s0324ok</title>
-    <g id="HM/ic/24x24/s0324ok" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd" fill-opacity="0.9">
-        <path d="M15.9245185,0.25 C17.5105444,0.25 18.7969136,1.53654694 18.7969136,3.12324444 C18.7969136,4.65316228 17.6006976,5.90459674 16.0932487,5.99203349 L15.99657,5.99426609 C16.3470757,6.47249865 16.5126301,7.01636525 16.5006989,7.62452853 L17.835,9.603 L19.1881247,9.60398148 C19.8646738,9.60398148 20.4683305,9.98844537 20.7711336,10.6003637 L20.8355669,10.7455418 L20.8886964,10.8983664 L20.9290487,11.0782696 L20.9420904,11.1725015 L20.9513454,11.2961327 L20.9532432,11.3688611 C20.9532432,12.1164745 20.485728,12.7754325 19.7659,13.0395697 L19.6186339,13.0870422 L19.4437664,13.1229535 L19.3592128,13.1332867 L19.2546465,13.1413972 L16.8742216,13.2433024 L16.8133302,13.2443463 C16.2899688,13.2443463 15.7899351,13.0416735 15.3966968,12.6615562 L15.2696873,12.5283131 L15.1603839,12.3882868 L14.7348392,11.7861435 L14.29,12.585 L16.7223217,14.9246876 C16.7670742,14.9677475 16.8061292,15.0160278 16.8387379,15.0683273 L16.8827226,15.149641 L16.9164761,15.2360828 L18.9440586,21.5578042 C19.1911388,22.329138 18.8839454,23.1619137 18.1956493,23.6013469 L18.06217,23.6790201 L17.9929516,23.7123281 L17.8768982,23.7610363 C17.1412384,24.0370983 16.3194614,23.7986624 15.8332523,23.1734194 L15.7406097,23.0432512 L15.7025051,22.9797038 L15.6426141,22.8673645 L13.287,18.004 L12.4785608,17.3624302 L11.2508392,16.3971435 L8.51339809,18.772026 C8.10306125,19.1162575 7.57585313,19.2817412 7.01892964,19.2328324 L6.83230746,19.2085401 L6.65628508,19.1673024 L2.82698351,18.0727713 C1.90332987,17.8022274 1.37342926,16.8349198 1.64495811,15.9112942 C1.86604436,15.1585884 2.55400503,14.6515606 3.35779829,14.6510503 L3.51999736,14.6577791 L3.68106742,14.6818428 L6.514,15.252 L7.59179919,13.9843819 C7.74557417,14.4933851 8.0114086,14.964341 8.37877532,15.3738832 L7.37091451,16.5600992 C7.21953654,16.7381567 6.99555136,16.8337734 6.76631401,16.8235902 L6.65156949,16.8095737 L3.42805704,16.1597111 L3.35370753,16.1478799 C3.23249092,16.1379529 3.11900552,16.2153867 3.0841099,16.3341915 C3.05283094,16.4405892 3.09845942,16.5511311 3.18637451,16.606074 L3.24392099,16.6318899 L7.02898725,17.7149155 L7.12502429,17.7379568 C7.24582133,17.7585651 7.36938413,17.7358901 7.46958038,17.6794186 L7.53993801,17.6308764 L10.0408392,15.4591435 L9.58842627,15.1272156 C8.82541394,14.5635741 8.4213468,13.7615291 8.43724661,12.8741035 L8.44710401,12.6826898 C8.4865744,12.2171432 8.61990092,11.8016113 8.85357409,11.3626351 L8.97880294,11.1408532 L9.0022946,11.1011549 L9.869,9.423 L9.803,9.434 L7.99289438,11.6884507 C7.75487419,11.9847414 7.43365865,12.1972108 7.0654969,12.3030366 L6.90494472,12.3417948 L6.73927813,12.3670954 L6.67516374,12.3721074 L6.55783025,12.3762241 C6.2775803,12.3762241 5.99785412,12.3121925 5.7520196,12.1915195 L5.60885283,12.1123778 L5.53690192,12.0672082 C4.82724545,11.5931224 4.55475188,10.6916012 4.87234403,9.89491866 L4.93884496,9.74689922 L4.97410238,9.68249073 L5.03972026,9.57544815 L7.13843238,6.4304198 C7.51380181,5.91652787 8.01970713,5.69332617 9.41085943,5.34284765 L10.2532106,5.13856067 L10.8992,4.99083604 L11.5636839,4.84588248 L12.2368723,4.70737302 L12.4940485,4.66098612 L12.7210738,4.63548702 C12.8445779,4.62372301 12.9672061,4.6150542 13.0816373,4.61028117 L13.246221,4.60614353 L13.3574584,4.60709436 L13.4667812,4.61428898 C13.2023167,4.1795817 13.05,3.6691801 13.05,3.12324444 C13.05,1.53616433 14.336964,0.25 15.9245185,0.25 Z M13.3333701,6.10685861 L13.1365766,6.1092792 L12.9346567,6.12223866 L12.7265745,6.14315657 L12.3267597,6.21890757 L11.6178558,6.36851113 L11.3574044,6.42559527 L10.6001127,6.59789196 L9.81583558,6.78774742 L9.30258509,6.92213642 L9.00812047,7.00695767 C8.70382107,7.09925518 8.53193548,7.16920895 8.44064105,7.22698756 L8.409314,7.24869142 L8.36799648,7.28899509 L6.30011019,10.3883948 L6.26906715,10.4396879 C6.21333756,10.5509156 6.23401982,10.6829243 6.30255593,10.7642716 L6.34919159,10.8064291 L6.39942341,10.8376239 C6.42275237,10.8520726 6.45790629,10.864412 6.49096004,10.8711167 L6.53722488,10.8765072 L6.59530664,10.8741626 C6.66260351,10.8667391 6.72543957,10.8397396 6.77659601,10.7968975 L6.82359187,10.7489127 L8.81321814,8.27324483 C8.90499456,8.15904855 9.02765935,8.07487215 9.16547648,8.02996892 L9.27143452,8.00379979 L11.0848666,7.6937751 C11.6584627,7.59571301 12.1064364,8.15418457 11.9199617,8.67961543 L11.8803649,8.77185519 L10.8344444,10.8321029 L10.3641663,11.7363785 L10.1755958,12.0715365 C10.0333594,12.3399005 9.9624651,12.5649817 9.9417418,12.8094095 C9.90861754,13.2001047 10.0417455,13.5396248 10.3481694,13.8145153 L10.4712154,13.9145434 L10.7801037,14.1382836 L11.2531924,14.4978323 L12.5003047,15.4694808 L14.3533908,16.9348871 C14.4123018,16.9816104 14.4636819,17.0367904 14.505956,17.0984617 L14.5623408,17.1955915 L16.9939786,22.2161395 L17.0105158,22.245269 C17.0688345,22.3348984 17.1707133,22.3825576 17.2623283,22.3782706 L17.3282741,22.3651596 L17.3827387,22.3419456 C17.480447,22.2902623 17.535778,22.1860857 17.5280279,22.0794972 L17.5156425,22.0156553 L15.546,15.874 L12.8361983,13.2671306 C12.6459346,13.0840628 12.5697629,12.8193495 12.6224955,12.5709058 L12.6530304,12.4657116 L12.6996087,12.3642223 L13.5179134,10.8859195 L13.9429849,10.1330734 L14.3602004,9.41807004 C15.2196408,7.9196048 15.2052734,7.11897571 14.4108374,6.51083074 L14.2163996,6.37290999 C14.012686,6.23587076 13.7630888,6.14790187 13.4957079,6.11786095 L13.3333701,6.10685861 Z M15.986,9.544 L15.9329693,9.65715389 L15.8028738,9.9092693 L15.6594497,10.1676942 L15.554,10.346 L16.3613848,11.4905423 L16.4204928,11.5670542 C16.4998521,11.6570282 16.607369,11.7165107 16.716749,11.7367776 L16.7987225,11.7444886 L19.1980507,11.6424205 L19.1827173,11.6472489 L19.2536733,11.632717 C19.3473262,11.6064244 19.4188592,11.5320187 19.4439115,11.4522845 L19.453605,11.3921533 L19.453812,11.3547313 L19.4568392,11.362 L19.4417621,11.2912844 C19.4149709,11.2031013 19.3437361,11.1361373 19.2562991,11.112879 L19.1881247,11.1039815 L17.4372284,11.1039815 C17.2235729,11.1039815 17.0218838,11.0129966 16.8808103,10.8568866 L16.8155501,10.7735243 L15.986,9.544 Z M15.9245185,1.75 C15.1651825,1.75 14.55,2.36480024 14.55,3.12324444 C14.55,3.88168867 15.1653949,4.49691358 15.9245185,4.49691358 C16.6818586,4.49691358 17.2969136,3.8815611 17.2969136,3.12324444 C17.2969136,2.36492767 16.6820709,1.75 15.9245185,1.75 Z" id="形状" fill="#99000000"></path>
-    </g>
+<?xml version="1.0" encoding="UTF-8"?>
+<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
+    <title>HM/ic/24x24/s0324ok</title>
+    <g id="HM/ic/24x24/s0324ok" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd" fill-opacity="0.9">
+        <path d="M15.9245185,0.25 C17.5105444,0.25 18.7969136,1.53654694 18.7969136,3.12324444 C18.7969136,4.65316228 17.6006976,5.90459674 16.0932487,5.99203349 L15.99657,5.99426609 C16.3470757,6.47249865 16.5126301,7.01636525 16.5006989,7.62452853 L17.835,9.603 L19.1881247,9.60398148 C19.8646738,9.60398148 20.4683305,9.98844537 20.7711336,10.6003637 L20.8355669,10.7455418 L20.8886964,10.8983664 L20.9290487,11.0782696 L20.9420904,11.1725015 L20.9513454,11.2961327 L20.9532432,11.3688611 C20.9532432,12.1164745 20.485728,12.7754325 19.7659,13.0395697 L19.6186339,13.0870422 L19.4437664,13.1229535 L19.3592128,13.1332867 L19.2546465,13.1413972 L16.8742216,13.2433024 L16.8133302,13.2443463 C16.2899688,13.2443463 15.7899351,13.0416735 15.3966968,12.6615562 L15.2696873,12.5283131 L15.1603839,12.3882868 L14.7348392,11.7861435 L14.29,12.585 L16.7223217,14.9246876 C16.7670742,14.9677475 16.8061292,15.0160278 16.8387379,15.0683273 L16.8827226,15.149641 L16.9164761,15.2360828 L18.9440586,21.5578042 C19.1911388,22.329138 18.8839454,23.1619137 18.1956493,23.6013469 L18.06217,23.6790201 L17.9929516,23.7123281 L17.8768982,23.7610363 C17.1412384,24.0370983 16.3194614,23.7986624 15.8332523,23.1734194 L15.7406097,23.0432512 L15.7025051,22.9797038 L15.6426141,22.8673645 L13.287,18.004 L12.4785608,17.3624302 L11.2508392,16.3971435 L8.51339809,18.772026 C8.10306125,19.1162575 7.57585313,19.2817412 7.01892964,19.2328324 L6.83230746,19.2085401 L6.65628508,19.1673024 L2.82698351,18.0727713 C1.90332987,17.8022274 1.37342926,16.8349198 1.64495811,15.9112942 C1.86604436,15.1585884 2.55400503,14.6515606 3.35779829,14.6510503 L3.51999736,14.6577791 L3.68106742,14.6818428 L6.514,15.252 L7.59179919,13.9843819 C7.74557417,14.4933851 8.0114086,14.964341 8.37877532,15.3738832 L7.37091451,16.5600992 C7.21953654,16.7381567 6.99555136,16.8337734 6.76631401,16.8235902 L6.65156949,16.8095737 L3.42805704,16.1597111 L3.35370753,16.1478799 C3.23249092,16.1379529 3.11900552,16.2153867 3.0841099,16.3341915 C3.05283094,16.4405892 3.09845942,16.5511311 3.18637451,16.606074 L3.24392099,16.6318899 L7.02898725,17.7149155 L7.12502429,17.7379568 C7.24582133,17.7585651 7.36938413,17.7358901 7.46958038,17.6794186 L7.53993801,17.6308764 L10.0408392,15.4591435 L9.58842627,15.1272156 C8.82541394,14.5635741 8.4213468,13.7615291 8.43724661,12.8741035 L8.44710401,12.6826898 C8.4865744,12.2171432 8.61990092,11.8016113 8.85357409,11.3626351 L8.97880294,11.1408532 L9.0022946,11.1011549 L9.869,9.423 L9.803,9.434 L7.99289438,11.6884507 C7.75487419,11.9847414 7.43365865,12.1972108 7.0654969,12.3030366 L6.90494472,12.3417948 L6.73927813,12.3670954 L6.67516374,12.3721074 L6.55783025,12.3762241 C6.2775803,12.3762241 5.99785412,12.3121925 5.7520196,12.1915195 L5.60885283,12.1123778 L5.53690192,12.0672082 C4.82724545,11.5931224 4.55475188,10.6916012 4.87234403,9.89491866 L4.93884496,9.74689922 L4.97410238,9.68249073 L5.03972026,9.57544815 L7.13843238,6.4304198 C7.51380181,5.91652787 8.01970713,5.69332617 9.41085943,5.34284765 L10.2532106,5.13856067 L10.8992,4.99083604 L11.5636839,4.84588248 L12.2368723,4.70737302 L12.4940485,4.66098612 L12.7210738,4.63548702 C12.8445779,4.62372301 12.9672061,4.6150542 13.0816373,4.61028117 L13.246221,4.60614353 L13.3574584,4.60709436 L13.4667812,4.61428898 C13.2023167,4.1795817 13.05,3.6691801 13.05,3.12324444 C13.05,1.53616433 14.336964,0.25 15.9245185,0.25 Z M13.3333701,6.10685861 L13.1365766,6.1092792 L12.9346567,6.12223866 L12.7265745,6.14315657 L12.3267597,6.21890757 L11.6178558,6.36851113 L11.3574044,6.42559527 L10.6001127,6.59789196 L9.81583558,6.78774742 L9.30258509,6.92213642 L9.00812047,7.00695767 C8.70382107,7.09925518 8.53193548,7.16920895 8.44064105,7.22698756 L8.409314,7.24869142 L8.36799648,7.28899509 L6.30011019,10.3883948 L6.26906715,10.4396879 C6.21333756,10.5509156 6.23401982,10.6829243 6.30255593,10.7642716 L6.34919159,10.8064291 L6.39942341,10.8376239 C6.42275237,10.8520726 6.45790629,10.864412 6.49096004,10.8711167 L6.53722488,10.8765072 L6.59530664,10.8741626 C6.66260351,10.8667391 6.72543957,10.8397396 6.77659601,10.7968975 L6.82359187,10.7489127 L8.81321814,8.27324483 C8.90499456,8.15904855 9.02765935,8.07487215 9.16547648,8.02996892 L9.27143452,8.00379979 L11.0848666,7.6937751 C11.6584627,7.59571301 12.1064364,8.15418457 11.9199617,8.67961543 L11.8803649,8.77185519 L10.8344444,10.8321029 L10.3641663,11.7363785 L10.1755958,12.0715365 C10.0333594,12.3399005 9.9624651,12.5649817 9.9417418,12.8094095 C9.90861754,13.2001047 10.0417455,13.5396248 10.3481694,13.8145153 L10.4712154,13.9145434 L10.7801037,14.1382836 L11.2531924,14.4978323 L12.5003047,15.4694808 L14.3533908,16.9348871 C14.4123018,16.9816104 14.4636819,17.0367904 14.505956,17.0984617 L14.5623408,17.1955915 L16.9939786,22.2161395 L17.0105158,22.245269 C17.0688345,22.3348984 17.1707133,22.3825576 17.2623283,22.3782706 L17.3282741,22.3651596 L17.3827387,22.3419456 C17.480447,22.2902623 17.535778,22.1860857 17.5280279,22.0794972 L17.5156425,22.0156553 L15.546,15.874 L12.8361983,13.2671306 C12.6459346,13.0840628 12.5697629,12.8193495 12.6224955,12.5709058 L12.6530304,12.4657116 L12.6996087,12.3642223 L13.5179134,10.8859195 L13.9429849,10.1330734 L14.3602004,9.41807004 C15.2196408,7.9196048 15.2052734,7.11897571 14.4108374,6.51083074 L14.2163996,6.37290999 C14.012686,6.23587076 13.7630888,6.14790187 13.4957079,6.11786095 L13.3333701,6.10685861 Z M15.986,9.544 L15.9329693,9.65715389 L15.8028738,9.9092693 L15.6594497,10.1676942 L15.554,10.346 L16.3613848,11.4905423 L16.4204928,11.5670542 C16.4998521,11.6570282 16.607369,11.7165107 16.716749,11.7367776 L16.7987225,11.7444886 L19.1980507,11.6424205 L19.1827173,11.6472489 L19.2536733,11.632717 C19.3473262,11.6064244 19.4188592,11.5320187 19.4439115,11.4522845 L19.453605,11.3921533 L19.453812,11.3547313 L19.4568392,11.362 L19.4417621,11.2912844 C19.4149709,11.2031013 19.3437361,11.1361373 19.2562991,11.112879 L19.1881247,11.1039815 L17.4372284,11.1039815 C17.2235729,11.1039815 17.0218838,11.0129966 16.8808103,10.8568866 L16.8155501,10.7735243 L15.986,9.544 Z M15.9245185,1.75 C15.1651825,1.75 14.55,2.36480024 14.55,3.12324444 C14.55,3.88168867 15.1653949,4.49691358 15.9245185,4.49691358 C16.6818586,4.49691358 17.2969136,3.8815611 17.2969136,3.12324444 C17.2969136,2.36492767 16.6820709,1.75 15.9245185,1.75 Z" id="形状" fill="#99000000"></path>
+    </g>
 </svg>
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_ssensor.svg b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_ssensor.svg
index 51b9c504f6188b15e678baa2e7d7da89756790fc..d16bf7dccb911dc4ae1dab1ba3ade66a117d2ec4 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_ssensor.svg
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/ic_ssensor.svg
@@ -1,9 +1,9 @@
-<?xml version="1.0" encoding="UTF-8"?>
-<svg width="24px" height="24px" viewBox="0 0 22 18" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
-    <title>HM/ic/24x24/ssensor</title>
-    <g id="Phone" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
-        <g id="HM/ic/24x24/h1.5" transform="translate(-1.000000, -3.000000)" fill="#99000000" fill-rule="nonzero">
-            <path d="M6.88520113,3.25665375 C8.20110847,3.2441055 9.45423321,3.70191516 10.4382279,4.52818986 L10.6448894,4.71085136 L10.6448894,4.71085136 L10.8307509,4.8921425 L12.976,7.22140244 L11.9770711,8.2105109 L9.75814072,5.94071648 C9.06143139,5.22803664 8.12676193,4.80899735 7.13043906,4.7610321 L6.89923552,4.7565881 C4.73297495,4.77685708 2.9442573,6.6249968 3.00133068,8.77403723 C3.01513617,9.28969008 3.12229988,9.78243475 3.31369779,10.2240841 C3.55588591,10.7815376 3.99804021,11.4975524 4.5646206,12.2655031 L8.48955036,12.2661597 L9.06590376,10.5234792 C9.28460194,9.86221647 10.1997769,9.80984134 10.4924878,10.4418363 L11.7838314,13.2299896 L13.5515924,8.29791662 C13.78546,7.64542344 14.6956603,7.6118272 14.9769941,8.24530387 L16.516272,11.7112816 L19.8146263,11.7107293 C20.1891539,11.168373 20.4721867,10.6724268 20.6751555,10.2113872 C20.9634789,9.55619284 21.0621436,8.84144072 20.962039,8.11014604 C20.7254198,6.38058715 19.2884683,4.98260785 17.5331805,4.78304299 C16.4453685,4.65947728 15.2702156,5.04996218 14.401689,5.81822352 L14.2321887,5.97687243 L14.155,6.05240244 L13.08,5.00540244 L13.176616,4.9111491 C14.3686991,3.73042013 16.0743524,3.107687 17.7024783,3.29262753 C20.1396687,3.5697203 22.1186199,5.49780703 22.4481955,7.90682646 C22.5860683,8.91402884 22.4474129,9.90814878 22.0480988,10.8155617 C21.963373,11.0080146 21.867777,11.2043805 21.7605257,11.4054465 L21.5908092,11.710669 L21.5552268,11.7717417 C21.4057908,12.0263345 21.2380086,12.2887519 21.0504191,12.5604591 C21.0279954,12.5929382 21.0052615,12.6255886 20.9822414,12.6583747 C20.943106,12.7141083 20.9034812,12.7697659 20.863031,12.8258208 L20.7916816,12.9239381 L20.7916816,12.9239381 L20.7788785,12.9413885 C20.7124801,13.0317681 20.6439566,13.1231816 20.573259,13.215678 C20.5653999,13.2259611 20.5571383,13.2367469 20.5488471,13.2475476 C19.8353467,14.1769973 18.902944,15.2157708 17.7024783,16.4131641 C16.3656625,17.7465587 14.7925137,19.1395141 12.9830318,20.5920303 C12.4519735,21.018324 11.7129601,21.0518761 11.1489587,20.6909917 L11.0220856,20.6007081 L9.65556885,19.5121388 C9.4833887,19.372194 9.3561404,19.2664956 9.27382393,19.1950436 L9.22982587,19.156282 C8.42735825,18.436006 7.65565362,17.7313751 6.92454102,17.0507199 L6.2441969,16.4131641 C5.51617255,15.7262006 4.825114,14.9817787 4.21136312,14.243737 L3.85271226,13.8021883 C3.63212339,13.5240162 3.42383242,13.2486023 3.23004481,12.9794365 C3.2090598,12.9502912 3.18782453,12.9206286 3.16676924,12.8910469 C3.13931405,12.8524721 3.11238967,12.8143555 3.08577271,12.7763846 C2.97266522,12.6150295 2.86508583,12.4562675 2.76355384,12.3009163 C2.75616605,12.2896136 2.74842237,12.2777321 2.7407144,12.2658709 C2.39391679,11.7321258 2.11983051,11.2404862 1.93792765,10.8217935 C1.66957051,10.2025634 1.52079316,9.52106177 1.50186798,8.81418212 C1.42255575,5.82776195 3.87928317,3.28477913 6.88520113,3.25665375 Z M14.3510337,10.6216115 L12.597787,15.5131894 C12.3659036,16.1601468 11.4662288,16.2004707 11.1773975,15.576852 L9.91471062,12.8505717 L9.77410978,13.2756969 C9.67006241,13.5902978 9.37603547,13.8027451 9.04467524,13.8027451 L5.8084156,13.8018219 C6.19037386,14.2352275 6.5949595,14.6633794 7.00971748,15.0686972 L7.41179063,15.45234 L8.49212243,16.4581803 C8.67772418,16.6292924 8.86601563,16.8020655 9.0568715,16.976387 L10.2317773,18.0399965 C10.3152935,18.1149586 10.5226799,18.2857329 10.8442125,18.5440027 L11.9506809,19.4226967 C11.9781034,19.4443132 12.0168168,19.4441419 12.044047,19.4222836 C13.8134328,18.0019534 15.3466495,16.6443562 16.643178,15.3511458 C17.4119101,14.5843812 18.0650527,13.887249 18.6144238,13.2478559 L16.016827,13.247867 C15.7131288,13.247867 15.4379315,13.0689692 15.3146653,12.7914119 L14.3510337,10.6216115 Z" id="形状结合"></path>
-        </g>
-    </g>
+<?xml version="1.0" encoding="UTF-8"?>
+<svg width="24px" height="24px" viewBox="0 0 22 18" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
+    <title>HM/ic/24x24/ssensor</title>
+    <g id="Phone" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
+        <g id="HM/ic/24x24/h1.5" transform="translate(-1.000000, -3.000000)" fill="#99000000" fill-rule="nonzero">
+            <path d="M6.88520113,3.25665375 C8.20110847,3.2441055 9.45423321,3.70191516 10.4382279,4.52818986 L10.6448894,4.71085136 L10.6448894,4.71085136 L10.8307509,4.8921425 L12.976,7.22140244 L11.9770711,8.2105109 L9.75814072,5.94071648 C9.06143139,5.22803664 8.12676193,4.80899735 7.13043906,4.7610321 L6.89923552,4.7565881 C4.73297495,4.77685708 2.9442573,6.6249968 3.00133068,8.77403723 C3.01513617,9.28969008 3.12229988,9.78243475 3.31369779,10.2240841 C3.55588591,10.7815376 3.99804021,11.4975524 4.5646206,12.2655031 L8.48955036,12.2661597 L9.06590376,10.5234792 C9.28460194,9.86221647 10.1997769,9.80984134 10.4924878,10.4418363 L11.7838314,13.2299896 L13.5515924,8.29791662 C13.78546,7.64542344 14.6956603,7.6118272 14.9769941,8.24530387 L16.516272,11.7112816 L19.8146263,11.7107293 C20.1891539,11.168373 20.4721867,10.6724268 20.6751555,10.2113872 C20.9634789,9.55619284 21.0621436,8.84144072 20.962039,8.11014604 C20.7254198,6.38058715 19.2884683,4.98260785 17.5331805,4.78304299 C16.4453685,4.65947728 15.2702156,5.04996218 14.401689,5.81822352 L14.2321887,5.97687243 L14.155,6.05240244 L13.08,5.00540244 L13.176616,4.9111491 C14.3686991,3.73042013 16.0743524,3.107687 17.7024783,3.29262753 C20.1396687,3.5697203 22.1186199,5.49780703 22.4481955,7.90682646 C22.5860683,8.91402884 22.4474129,9.90814878 22.0480988,10.8155617 C21.963373,11.0080146 21.867777,11.2043805 21.7605257,11.4054465 L21.5908092,11.710669 L21.5552268,11.7717417 C21.4057908,12.0263345 21.2380086,12.2887519 21.0504191,12.5604591 C21.0279954,12.5929382 21.0052615,12.6255886 20.9822414,12.6583747 C20.943106,12.7141083 20.9034812,12.7697659 20.863031,12.8258208 L20.7916816,12.9239381 L20.7916816,12.9239381 L20.7788785,12.9413885 C20.7124801,13.0317681 20.6439566,13.1231816 20.573259,13.215678 C20.5653999,13.2259611 20.5571383,13.2367469 20.5488471,13.2475476 C19.8353467,14.1769973 18.902944,15.2157708 17.7024783,16.4131641 C16.3656625,17.7465587 14.7925137,19.1395141 12.9830318,20.5920303 C12.4519735,21.018324 11.7129601,21.0518761 11.1489587,20.6909917 L11.0220856,20.6007081 L9.65556885,19.5121388 C9.4833887,19.372194 9.3561404,19.2664956 9.27382393,19.1950436 L9.22982587,19.156282 C8.42735825,18.436006 7.65565362,17.7313751 6.92454102,17.0507199 L6.2441969,16.4131641 C5.51617255,15.7262006 4.825114,14.9817787 4.21136312,14.243737 L3.85271226,13.8021883 C3.63212339,13.5240162 3.42383242,13.2486023 3.23004481,12.9794365 C3.2090598,12.9502912 3.18782453,12.9206286 3.16676924,12.8910469 C3.13931405,12.8524721 3.11238967,12.8143555 3.08577271,12.7763846 C2.97266522,12.6150295 2.86508583,12.4562675 2.76355384,12.3009163 C2.75616605,12.2896136 2.74842237,12.2777321 2.7407144,12.2658709 C2.39391679,11.7321258 2.11983051,11.2404862 1.93792765,10.8217935 C1.66957051,10.2025634 1.52079316,9.52106177 1.50186798,8.81418212 C1.42255575,5.82776195 3.87928317,3.28477913 6.88520113,3.25665375 Z M14.3510337,10.6216115 L12.597787,15.5131894 C12.3659036,16.1601468 11.4662288,16.2004707 11.1773975,15.576852 L9.91471062,12.8505717 L9.77410978,13.2756969 C9.67006241,13.5902978 9.37603547,13.8027451 9.04467524,13.8027451 L5.8084156,13.8018219 C6.19037386,14.2352275 6.5949595,14.6633794 7.00971748,15.0686972 L7.41179063,15.45234 L8.49212243,16.4581803 C8.67772418,16.6292924 8.86601563,16.8020655 9.0568715,16.976387 L10.2317773,18.0399965 C10.3152935,18.1149586 10.5226799,18.2857329 10.8442125,18.5440027 L11.9506809,19.4226967 C11.9781034,19.4443132 12.0168168,19.4441419 12.044047,19.4222836 C13.8134328,18.0019534 15.3466495,16.6443562 16.643178,15.3511458 C17.4119101,14.5843812 18.0650527,13.887249 18.6144238,13.2478559 L16.016827,13.247867 C15.7131288,13.247867 15.4379315,13.0689692 15.3146653,12.7914119 L14.3510337,10.6216115 Z" id="形状结合"></path>
+        </g>
+    </g>
 </svg>
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/in_app_installations.svg b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/in_app_installations.svg
index c40993ab5cedaefb586f94faf4c578f8faa93c57..802cfb438128d68a06add4d59fe12bf40f2bf983 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/in_app_installations.svg
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/in_app_installations.svg
@@ -1,13 +1,13 @@
-<?xml version="1.0" encoding="UTF-8"?>
-<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
-    <title>HM/ic/24x24/in-app installations</title>
-    <defs>
-        <path d="M7.36710401,12.75 C8.55605717,12.75 9.10734318,12.8974289 9.62499024,13.1742696 C10.1426373,13.4511103 10.5488897,13.8573627 10.8257304,14.3750098 L10.8776917,14.4757818 C11.1209805,14.9664447 11.25,15.5206495 11.25,16.632896 L11.25,17.867104 C11.25,19.0560572 11.1025711,19.6073432 10.8257304,20.1249902 C10.5488897,20.6426373 10.1426373,21.0488897 9.62499024,21.3257304 L9.52421823,21.3776917 C9.03355532,21.6209805 8.47935051,21.75 7.36710401,21.75 L6.13289599,21.75 C4.94394283,21.75 4.39265682,21.6025711 3.87500976,21.3257304 C3.35736271,21.0488897 2.95111026,20.6426373 2.67426959,20.1249902 L2.62230832,20.0242182 C2.38740875,19.5504747 2.25903377,19.017496 2.25045963,17.9801936 L2.25,16.632896 C2.25,15.4439428 2.39742891,14.8926568 2.67426959,14.3750098 C2.95111026,13.8573627 3.35736271,13.4511103 3.87500976,13.1742696 L3.97578177,13.1223083 C4.44952527,12.8874087 4.98250402,12.7590338 6.01980637,12.7504596 L7.36710401,12.75 Z M17.867104,12.75 C19.0560572,12.75 19.6073432,12.8974289 20.1249902,13.1742696 C20.6426373,13.4511103 21.0488897,13.8573627 21.3257304,14.3750098 L21.3776917,14.4757818 C21.6209805,14.9664447 21.75,15.5206495 21.75,16.632896 L21.75,17.867104 C21.75,19.0560572 21.6025711,19.6073432 21.3257304,20.1249902 C21.0488897,20.6426373 20.6426373,21.0488897 20.1249902,21.3257304 L20.0242182,21.3776917 C19.5335553,21.6209805 18.9793505,21.75 17.867104,21.75 L16.632896,21.75 C15.4439428,21.75 14.8926568,21.6025711 14.3750098,21.3257304 C13.8573627,21.0488897 13.4511103,20.6426373 13.1742696,20.1249902 L13.1223083,20.0242182 C12.8874087,19.5504747 12.7590338,19.017496 12.7504596,17.9801936 L12.75,16.632896 C12.75,15.4439428 12.8974289,14.8926568 13.1742696,14.3750098 C13.4511103,13.8573627 13.8573627,13.4511103 14.3750098,13.1742696 L14.4757818,13.1223083 C14.9495253,12.8874087 15.482504,12.7590338 16.5198064,12.7504596 L17.867104,12.75 Z M7.36761573,14.2499999 L6.03220465,14.2504084 L5.86406875,14.2529244 C5.24687011,14.2666673 4.93692836,14.3276696 4.69448301,14.4404982 L4.66322277,14.4555093 L4.58240805,14.4969894 C4.3261637,14.6340304 4.13403036,14.8261637 3.99698939,15.0824081 C3.83932927,15.3772068 3.76616296,15.6858557 3.75242281,16.3718463 L3.74999991,16.6323843 L3.75040839,17.9677953 L3.75292443,18.1359312 C3.76666726,18.7531299 3.82766959,19.0630716 3.94049824,19.305517 L3.95550931,19.3367772 L3.99698939,19.4175919 C4.13403036,19.6738363 4.3261637,19.8659696 4.58240805,20.0030106 C4.87720684,20.1606707 5.1858557,20.233837 5.87221194,20.2475771 L6.13289599,20.2499999 L7.36710401,20.2499999 L7.53743597,20.2489724 C8.21866339,20.2404021 8.55102876,20.1781418 8.80647543,20.0590542 L8.83677723,20.0444907 L8.91759195,20.0030106 C9.1738363,19.8659696 9.36596964,19.6738363 9.50301061,19.4175919 C9.66067073,19.1227932 9.73383704,18.8141443 9.74757712,18.1277881 L9.74999991,17.867104 L9.74999991,16.632896 L9.74897237,16.462564 C9.74040205,15.7813366 9.67814179,15.4489712 9.55905417,15.1935246 L9.54449069,15.1632228 L9.50301061,15.0824081 C9.36596964,14.8261637 9.1738363,14.6340304 8.91759195,14.4969894 C8.62279316,14.3393293 8.3141443,14.266163 7.62778806,14.2524229 L7.36761573,14.2499999 Z M17.8676157,14.2499999 L16.5322047,14.2504084 L16.3640688,14.2529244 C15.7468701,14.2666673 15.4369284,14.3276696 15.194483,14.4404982 L15.1632228,14.4555093 L15.0824081,14.4969894 C14.8261637,14.6340304 14.6340304,14.8261637 14.4969894,15.0824081 C14.3393293,15.3772068 14.266163,15.6858557 14.2524228,16.3718463 L14.2499999,16.6323843 L14.2504084,17.9677953 L14.2529244,18.1359312 C14.2666673,18.7531299 14.3276696,19.0630716 14.4404982,19.305517 L14.4555093,19.3367772 L14.4969894,19.4175919 C14.6340304,19.6738363 14.8261637,19.8659696 15.0824081,20.0030106 C15.3772068,20.1606707 15.6858557,20.233837 16.3722119,20.2475771 L16.632896,20.2499999 L17.867104,20.2499999 L18.037436,20.2489724 C18.7186634,20.2404021 19.0510288,20.1781418 19.3064754,20.0590542 L19.3367772,20.0444907 L19.4175919,20.0030106 C19.6738363,19.8659696 19.8659696,19.6738363 20.0030106,19.4175919 C20.1606707,19.1227932 20.233837,18.8141443 20.2475771,18.1277881 L20.2499999,17.867104 L20.2499999,16.632896 L20.2489724,16.462564 C20.2404021,15.7813366 20.1781418,15.4489712 20.0590542,15.1935246 L20.0444907,15.1632228 L20.0030106,15.0824081 C19.8659696,14.8261637 19.6738363,14.6340304 19.4175919,14.4969894 C19.1227932,14.3393293 18.8141443,14.266163 18.1277881,14.2524229 L17.8676157,14.2499999 Z M7.36710401,2.25 C8.55605717,2.25 9.10734318,2.39742891 9.62499024,2.67426959 C10.1426373,2.95111026 10.5488897,3.35736271 10.8257304,3.87500976 L10.8776917,3.97578177 C11.1209805,4.46644468 11.25,5.02064949 11.25,6.13289599 L11.25,7.36710401 C11.25,8.55605717 11.1025711,9.10734318 10.8257304,9.62499024 C10.5488897,10.1426373 10.1426373,10.5488897 9.62499024,10.8257304 L9.52421823,10.8776917 C9.03355532,11.1209805 8.47935051,11.25 7.36710401,11.25 L6.13289599,11.25 C4.94394283,11.25 4.39265682,11.1025711 3.87500976,10.8257304 C3.35736271,10.5488897 2.95111026,10.1426373 2.67426959,9.62499024 L2.62230832,9.52421823 C2.38740875,9.05047473 2.25903377,8.51749598 2.25045963,7.48019363 L2.25,6.13289599 C2.25,4.94394283 2.39742891,4.39265682 2.67426959,3.87500976 C2.95111026,3.35736271 3.35736271,2.95111026 3.87500976,2.67426959 L3.97578177,2.62230832 C4.44952527,2.38740875 4.98250402,2.25903377 6.01980637,2.25045963 L7.36710401,2.25 Z M17.867104,2.25 C19.0560572,2.25 19.6073432,2.39742891 20.1249902,2.67426959 C20.6426373,2.95111026 21.0488897,3.35736271 21.3257304,3.87500976 L21.3776917,3.97578177 C21.6209805,4.46644468 21.75,5.02064949 21.75,6.13289599 L21.75,7.36710401 C21.75,8.55605717 21.6025711,9.10734318 21.3257304,9.62499024 C21.0488897,10.1426373 20.6426373,10.5488897 20.1249902,10.8257304 L20.0242182,10.8776917 C19.5335553,11.1209805 18.9793505,11.25 17.867104,11.25 L16.632896,11.25 C15.4439428,11.25 14.8926568,11.1025711 14.3750098,10.8257304 C13.8573627,10.5488897 13.4511103,10.1426373 13.1742696,9.62499024 L13.1223083,9.52421823 C12.8874087,9.05047473 12.7590338,8.51749598 12.7504596,7.48019363 L12.75,6.13289599 C12.75,4.94394283 12.8974289,4.39265682 13.1742696,3.87500976 C13.4511103,3.35736271 13.8573627,2.95111026 14.3750098,2.67426959 L14.4757818,2.62230832 C14.9495253,2.38740875 15.482504,2.25903377 16.5198064,2.25045963 L17.867104,2.25 Z M17.8676157,3.74999991 L16.5322047,3.75040839 L16.3640688,3.75292443 C15.7468701,3.76666726 15.4369284,3.82766959 15.194483,3.94049824 L15.1632228,3.95550931 L15.0824081,3.99698939 C14.8261637,4.13403036 14.6340304,4.3261637 14.4969894,4.58240805 C14.3393293,4.87720684 14.266163,5.1858557 14.2524228,5.87184631 L14.2499999,6.13238427 L14.2504084,7.46779535 L14.2529244,7.63593125 C14.2666673,8.25312989 14.3276696,8.56307164 14.4404982,8.80551699 L14.4555093,8.83677723 L14.4969894,8.91759195 C14.6340304,9.1738363 14.8261637,9.36596964 15.0824081,9.50301061 C15.3772068,9.66067073 15.6858557,9.73383704 16.3722119,9.74757712 L16.632896,9.74999991 L17.867104,9.74999991 L18.037436,9.74897237 C18.7186634,9.74040205 19.0510288,9.67814179 19.3064754,9.55905417 L19.3367772,9.54449069 L19.4175919,9.50301061 C19.6738363,9.36596964 19.8659696,9.1738363 20.0030106,8.91759195 C20.1606707,8.62279316 20.233837,8.3141443 20.2475771,7.62778806 L20.2499999,7.36710401 L20.2499999,6.13289599 L20.2489724,5.96256403 C20.2404021,5.28133661 20.1781418,4.94897124 20.0590542,4.69352457 L20.0444907,4.66322277 L20.0030106,4.58240805 C19.8659696,4.3261637 19.6738363,4.13403036 19.4175919,3.99698939 C19.1227932,3.83932927 18.8141443,3.76616296 18.1277881,3.75242288 L17.8676157,3.74999991 Z M9.73734861,4.92039861 C9.4884875,4.67130139 9.0847375,4.67130139 8.83564028,4.92039861 L8.83564028,4.92039861 L6.18151528,7.57452361 L4.82600139,6.21900972 C4.57690417,5.97014861 4.17315417,5.97014861 3.92429306,6.21900972 C3.67519583,6.46810694 3.67519583,6.87185694 3.92429306,7.12095417 L3.92429306,7.12095417 L5.73054306,8.92720417 C5.97964028,9.17630139 6.38339028,9.17630139 6.63225139,8.92720417 L6.63225139,8.92720417 L9.73734861,5.82210694 C9.98644583,5.57324583 9.98644583,5.16949583 9.73734861,4.92039861 Z" id="path-1"></path>
-    </defs>
-    <g id="HM/ic/24x24/in-app-installations" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
-        <mask id="mask-2" fill="white">
-            <use xlink:href="#path-1"></use>
-        </mask>
-        <use id="形状结合" fill="#000000" xlink:href="#path-1"></use>
-    </g>
+<?xml version="1.0" encoding="UTF-8"?>
+<svg width="24px" height="24px" viewBox="0 0 24 24" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
+    <title>HM/ic/24x24/in-app installations</title>
+    <defs>
+        <path d="M7.36710401,12.75 C8.55605717,12.75 9.10734318,12.8974289 9.62499024,13.1742696 C10.1426373,13.4511103 10.5488897,13.8573627 10.8257304,14.3750098 L10.8776917,14.4757818 C11.1209805,14.9664447 11.25,15.5206495 11.25,16.632896 L11.25,17.867104 C11.25,19.0560572 11.1025711,19.6073432 10.8257304,20.1249902 C10.5488897,20.6426373 10.1426373,21.0488897 9.62499024,21.3257304 L9.52421823,21.3776917 C9.03355532,21.6209805 8.47935051,21.75 7.36710401,21.75 L6.13289599,21.75 C4.94394283,21.75 4.39265682,21.6025711 3.87500976,21.3257304 C3.35736271,21.0488897 2.95111026,20.6426373 2.67426959,20.1249902 L2.62230832,20.0242182 C2.38740875,19.5504747 2.25903377,19.017496 2.25045963,17.9801936 L2.25,16.632896 C2.25,15.4439428 2.39742891,14.8926568 2.67426959,14.3750098 C2.95111026,13.8573627 3.35736271,13.4511103 3.87500976,13.1742696 L3.97578177,13.1223083 C4.44952527,12.8874087 4.98250402,12.7590338 6.01980637,12.7504596 L7.36710401,12.75 Z M17.867104,12.75 C19.0560572,12.75 19.6073432,12.8974289 20.1249902,13.1742696 C20.6426373,13.4511103 21.0488897,13.8573627 21.3257304,14.3750098 L21.3776917,14.4757818 C21.6209805,14.9664447 21.75,15.5206495 21.75,16.632896 L21.75,17.867104 C21.75,19.0560572 21.6025711,19.6073432 21.3257304,20.1249902 C21.0488897,20.6426373 20.6426373,21.0488897 20.1249902,21.3257304 L20.0242182,21.3776917 C19.5335553,21.6209805 18.9793505,21.75 17.867104,21.75 L16.632896,21.75 C15.4439428,21.75 14.8926568,21.6025711 14.3750098,21.3257304 C13.8573627,21.0488897 13.4511103,20.6426373 13.1742696,20.1249902 L13.1223083,20.0242182 C12.8874087,19.5504747 12.7590338,19.017496 12.7504596,17.9801936 L12.75,16.632896 C12.75,15.4439428 12.8974289,14.8926568 13.1742696,14.3750098 C13.4511103,13.8573627 13.8573627,13.4511103 14.3750098,13.1742696 L14.4757818,13.1223083 C14.9495253,12.8874087 15.482504,12.7590338 16.5198064,12.7504596 L17.867104,12.75 Z M7.36761573,14.2499999 L6.03220465,14.2504084 L5.86406875,14.2529244 C5.24687011,14.2666673 4.93692836,14.3276696 4.69448301,14.4404982 L4.66322277,14.4555093 L4.58240805,14.4969894 C4.3261637,14.6340304 4.13403036,14.8261637 3.99698939,15.0824081 C3.83932927,15.3772068 3.76616296,15.6858557 3.75242281,16.3718463 L3.74999991,16.6323843 L3.75040839,17.9677953 L3.75292443,18.1359312 C3.76666726,18.7531299 3.82766959,19.0630716 3.94049824,19.305517 L3.95550931,19.3367772 L3.99698939,19.4175919 C4.13403036,19.6738363 4.3261637,19.8659696 4.58240805,20.0030106 C4.87720684,20.1606707 5.1858557,20.233837 5.87221194,20.2475771 L6.13289599,20.2499999 L7.36710401,20.2499999 L7.53743597,20.2489724 C8.21866339,20.2404021 8.55102876,20.1781418 8.80647543,20.0590542 L8.83677723,20.0444907 L8.91759195,20.0030106 C9.1738363,19.8659696 9.36596964,19.6738363 9.50301061,19.4175919 C9.66067073,19.1227932 9.73383704,18.8141443 9.74757712,18.1277881 L9.74999991,17.867104 L9.74999991,16.632896 L9.74897237,16.462564 C9.74040205,15.7813366 9.67814179,15.4489712 9.55905417,15.1935246 L9.54449069,15.1632228 L9.50301061,15.0824081 C9.36596964,14.8261637 9.1738363,14.6340304 8.91759195,14.4969894 C8.62279316,14.3393293 8.3141443,14.266163 7.62778806,14.2524229 L7.36761573,14.2499999 Z M17.8676157,14.2499999 L16.5322047,14.2504084 L16.3640688,14.2529244 C15.7468701,14.2666673 15.4369284,14.3276696 15.194483,14.4404982 L15.1632228,14.4555093 L15.0824081,14.4969894 C14.8261637,14.6340304 14.6340304,14.8261637 14.4969894,15.0824081 C14.3393293,15.3772068 14.266163,15.6858557 14.2524228,16.3718463 L14.2499999,16.6323843 L14.2504084,17.9677953 L14.2529244,18.1359312 C14.2666673,18.7531299 14.3276696,19.0630716 14.4404982,19.305517 L14.4555093,19.3367772 L14.4969894,19.4175919 C14.6340304,19.6738363 14.8261637,19.8659696 15.0824081,20.0030106 C15.3772068,20.1606707 15.6858557,20.233837 16.3722119,20.2475771 L16.632896,20.2499999 L17.867104,20.2499999 L18.037436,20.2489724 C18.7186634,20.2404021 19.0510288,20.1781418 19.3064754,20.0590542 L19.3367772,20.0444907 L19.4175919,20.0030106 C19.6738363,19.8659696 19.8659696,19.6738363 20.0030106,19.4175919 C20.1606707,19.1227932 20.233837,18.8141443 20.2475771,18.1277881 L20.2499999,17.867104 L20.2499999,16.632896 L20.2489724,16.462564 C20.2404021,15.7813366 20.1781418,15.4489712 20.0590542,15.1935246 L20.0444907,15.1632228 L20.0030106,15.0824081 C19.8659696,14.8261637 19.6738363,14.6340304 19.4175919,14.4969894 C19.1227932,14.3393293 18.8141443,14.266163 18.1277881,14.2524229 L17.8676157,14.2499999 Z M7.36710401,2.25 C8.55605717,2.25 9.10734318,2.39742891 9.62499024,2.67426959 C10.1426373,2.95111026 10.5488897,3.35736271 10.8257304,3.87500976 L10.8776917,3.97578177 C11.1209805,4.46644468 11.25,5.02064949 11.25,6.13289599 L11.25,7.36710401 C11.25,8.55605717 11.1025711,9.10734318 10.8257304,9.62499024 C10.5488897,10.1426373 10.1426373,10.5488897 9.62499024,10.8257304 L9.52421823,10.8776917 C9.03355532,11.1209805 8.47935051,11.25 7.36710401,11.25 L6.13289599,11.25 C4.94394283,11.25 4.39265682,11.1025711 3.87500976,10.8257304 C3.35736271,10.5488897 2.95111026,10.1426373 2.67426959,9.62499024 L2.62230832,9.52421823 C2.38740875,9.05047473 2.25903377,8.51749598 2.25045963,7.48019363 L2.25,6.13289599 C2.25,4.94394283 2.39742891,4.39265682 2.67426959,3.87500976 C2.95111026,3.35736271 3.35736271,2.95111026 3.87500976,2.67426959 L3.97578177,2.62230832 C4.44952527,2.38740875 4.98250402,2.25903377 6.01980637,2.25045963 L7.36710401,2.25 Z M17.867104,2.25 C19.0560572,2.25 19.6073432,2.39742891 20.1249902,2.67426959 C20.6426373,2.95111026 21.0488897,3.35736271 21.3257304,3.87500976 L21.3776917,3.97578177 C21.6209805,4.46644468 21.75,5.02064949 21.75,6.13289599 L21.75,7.36710401 C21.75,8.55605717 21.6025711,9.10734318 21.3257304,9.62499024 C21.0488897,10.1426373 20.6426373,10.5488897 20.1249902,10.8257304 L20.0242182,10.8776917 C19.5335553,11.1209805 18.9793505,11.25 17.867104,11.25 L16.632896,11.25 C15.4439428,11.25 14.8926568,11.1025711 14.3750098,10.8257304 C13.8573627,10.5488897 13.4511103,10.1426373 13.1742696,9.62499024 L13.1223083,9.52421823 C12.8874087,9.05047473 12.7590338,8.51749598 12.7504596,7.48019363 L12.75,6.13289599 C12.75,4.94394283 12.8974289,4.39265682 13.1742696,3.87500976 C13.4511103,3.35736271 13.8573627,2.95111026 14.3750098,2.67426959 L14.4757818,2.62230832 C14.9495253,2.38740875 15.482504,2.25903377 16.5198064,2.25045963 L17.867104,2.25 Z M17.8676157,3.74999991 L16.5322047,3.75040839 L16.3640688,3.75292443 C15.7468701,3.76666726 15.4369284,3.82766959 15.194483,3.94049824 L15.1632228,3.95550931 L15.0824081,3.99698939 C14.8261637,4.13403036 14.6340304,4.3261637 14.4969894,4.58240805 C14.3393293,4.87720684 14.266163,5.1858557 14.2524228,5.87184631 L14.2499999,6.13238427 L14.2504084,7.46779535 L14.2529244,7.63593125 C14.2666673,8.25312989 14.3276696,8.56307164 14.4404982,8.80551699 L14.4555093,8.83677723 L14.4969894,8.91759195 C14.6340304,9.1738363 14.8261637,9.36596964 15.0824081,9.50301061 C15.3772068,9.66067073 15.6858557,9.73383704 16.3722119,9.74757712 L16.632896,9.74999991 L17.867104,9.74999991 L18.037436,9.74897237 C18.7186634,9.74040205 19.0510288,9.67814179 19.3064754,9.55905417 L19.3367772,9.54449069 L19.4175919,9.50301061 C19.6738363,9.36596964 19.8659696,9.1738363 20.0030106,8.91759195 C20.1606707,8.62279316 20.233837,8.3141443 20.2475771,7.62778806 L20.2499999,7.36710401 L20.2499999,6.13289599 L20.2489724,5.96256403 C20.2404021,5.28133661 20.1781418,4.94897124 20.0590542,4.69352457 L20.0444907,4.66322277 L20.0030106,4.58240805 C19.8659696,4.3261637 19.6738363,4.13403036 19.4175919,3.99698939 C19.1227932,3.83932927 18.8141443,3.76616296 18.1277881,3.75242288 L17.8676157,3.74999991 Z M9.73734861,4.92039861 C9.4884875,4.67130139 9.0847375,4.67130139 8.83564028,4.92039861 L8.83564028,4.92039861 L6.18151528,7.57452361 L4.82600139,6.21900972 C4.57690417,5.97014861 4.17315417,5.97014861 3.92429306,6.21900972 C3.67519583,6.46810694 3.67519583,6.87185694 3.92429306,7.12095417 L3.92429306,7.12095417 L5.73054306,8.92720417 C5.97964028,9.17630139 6.38339028,9.17630139 6.63225139,8.92720417 L6.63225139,8.92720417 L9.73734861,5.82210694 C9.98644583,5.57324583 9.98644583,5.16949583 9.73734861,4.92039861 Z" id="path-1"></path>
+    </defs>
+    <g id="HM/ic/24x24/in-app-installations" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
+        <mask id="mask-2" fill="white">
+            <use xlink:href="#path-1"></use>
+        </mask>
+        <use id="形状结合" fill="#000000" xlink:href="#path-1"></use>
+    </g>
 </svg>
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/noRecord.svg b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/noRecord.svg
index bc844b75803d1679ef7a1eed6bab6d8afea73c92..6abcd9ac8e7e64049d41135a0bb32d721c5ae3cd 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/noRecord.svg
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/noRecord.svg
@@ -1,20 +1,20 @@
-<?xml version="1.0" encoding="UTF-8"?>
-<svg width="89px" height="100px" viewBox="0 0 89 100" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
-    <title>EmptyPage/04 NoRecord</title>
-    <g id="页面-3" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
-        <g id="编组" transform="translate(-26.000000, -10.000000)" fill="#A1A7B3">
-            <g transform="translate(25.110000, 10.000000)">
-                <g id="board" transform="translate(0.699850, 0.000000)">
-                    <ellipse id="椭圆形" opacity="0.15" cx="33.6169259" cy="97.7931677" rx="33.3235423" ry="2.09054905"></ellipse>
-                    <path d="M15.6566517,7.68481948 C14.8320038,8.84653907 14.3086539,10.237133 14.2005157,11.7426876 L9.37355468,11.7427205 C8.86071884,11.7427205 8.43804752,12.1287607 8.38028241,12.6260993 L8.37355468,12.7427205 L8.37355468,80.4445085 C8.37355468,80.9573443 8.75959487,81.3800156 9.25693355,81.4377807 L9.37355468,81.4445085 L55.9597787,81.4445085 C56.4726145,81.4445085 56.8952858,81.0584683 56.9530509,80.5611296 L56.9597787,80.4445085 L56.9591918,59.4642467 C58.2354881,58.6963697 59.5848521,57.8715818 60.9689698,57.0202918 C61.872061,56.4648531 62.7610143,55.9245256 63.6374278,55.3893306 L63.6365385,89.1456801 C63.6365385,91.3548191 61.8456775,93.1456801 59.6365385,93.1456801 L5.41431625,93.1456801 C3.20517725,93.1456801 1.41431625,91.3548191 1.41431625,89.1456801 L1.41431625,11.6865305 C1.41431625,9.47739154 3.20517725,7.68653054 5.41431625,7.68653054 L15.6566517,7.68481948 Z M49.6766817,7.68481948 L59.6365385,7.68653054 C61.8456775,7.68653054 63.6365385,9.47739154 63.6365385,11.6865305 L63.6371125,41.7414945 C61.4081436,43.9658433 59.103154,46.6784541 56.9601952,49.4365519 L56.9597787,12.7427205 C56.9597787,12.1904357 56.5120634,11.7427205 55.9597787,11.7427205 L51.1328176,11.7426876 C51.0246794,10.237133 50.5013296,8.84653907 49.6766817,7.68481948 Z" id="形状结合" opacity="0.600000024"></path>
-                    <path d="M1.42842215,88.034569 C1.42842215,90.243708 3.21928315,92.034569 5.42842215,92.034569 L5.42842215,92.034569 L59.6506444,92.034569 C61.8597834,92.034569 63.6506444,90.243708 63.6506444,88.034569 L63.6506444,88.034569 L63.6506444,89.1456801 C63.6506444,91.3548191 61.8597834,93.1456801 59.6506444,93.1456801 L5.42842215,93.1456801 C3.21928315,93.1456801 1.42842215,91.3548191 1.42842215,89.1456801 Z" id="bolder" opacity="0.300000012"></path>
-                    <path d="M56.9591918,59.4642467 L56.9597787,80.4445085 C56.9597787,80.9967932 56.5120634,81.4445085 55.9597787,81.4445085 L9.37355468,81.4445085 C8.86071884,81.4445085 8.43804752,81.0584683 8.38028241,80.5611296 L8.37409683,80.4451067 C8.39228046,80.997099 8.85449933,81.4298363 9.40649115,81.4116402 C36.410719,80.5220714 50.9667056,79.0071163 53.074451,76.866775 C54.0969746,75.8284382 54.9268724,70.3057364 55.5641443,60.2986697 C56.0174001,60.0290696 56.4832148,59.7506158 56.9591918,59.4642467 Z M55.9597787,11.7427205 C56.5120634,11.7427205 56.9597787,12.1904357 56.9597787,12.7427205 L56.9601952,49.4365519 C56.6579918,49.8255032 56.3590107,50.215359 56.0639196,50.6048777 C56.4662846,41.0062372 56.7563626,28.7933575 56.9341716,13.9668335 L56.9483896,12.754852 L56.9484554,12.7433799 C56.9484554,12.2305185 56.562396,11.8078261 56.0650326,11.750098 L55.9484056,11.7433799 L55.9597787,11.7427205 Z" id="形状结合" opacity="0.800000012"></path>
-                    <path d="M14.2004684,11.7433459 L14.1902746,11.909269 L14.1902746,11.909269 L14.1834578,12.076084 L14.1804818,12.2778365 L51.153554,12.2779649 C51.1524982,12.0982019 51.1455335,11.9198392 51.1328445,11.7430614 L55.9484056,11.7433799 C56.5007179,11.7433301 56.9484554,12.1910676 56.9484554,12.7433799 L56.9483896,12.754852 C56.7720078,28.1295003 56.4771782,40.7466641 56.063901,50.6063433 C52.4333112,55.3973618 49.392156,60.1376676 48.1823636,62.5154382 L48.1823636,62.5154382 L33.652283,76.54691 L31.2131832,79.5271207 C31.1615524,79.5902057 31.1586794,79.6800882 31.2061761,79.7463417 C31.2513374,79.8093376 31.3378528,79.8260652 31.4032416,79.7844441 L31.4032416,79.7844441 L34.6497457,77.7179883 L49.0240891,63.8205749 C50.4317295,63.253589 52.7668367,61.9562089 55.563735,60.2980309 C54.9268558,70.305847 54.0969644,75.8284486 53.074451,76.866775 C50.9667056,79.0071163 36.410719,80.5220714 9.40649115,81.4116402 C8.85449933,81.4298363 8.39228046,80.997099 8.37409683,80.4451067 L8.37355468,12.7433799 C8.37355468,12.1910951 8.82126993,11.7433799 9.37355468,11.7433799 L14.2004684,11.7433459 Z M51.1542828,12.8843279 L14.1802255,12.8843279 L14.1802255,13.6297163 C14.1802255,13.9328527 14.401392,14.1843328 14.6911658,14.2315975 L14.7900888,14.2395796 L50.5444195,14.2395796 C50.8475559,14.2395796 51.0990361,14.0184131 51.1463007,13.7286393 L51.1542828,13.6297163 L51.1542828,12.8843279 Z" id="形状结合" opacity="0.200000003"></path>
-                    <path d="M14.2004684,11.7433459 L14.1902746,11.909269 L14.1902746,11.909269 L14.1834578,12.076084 L14.1804818,12.2778365 L51.153554,12.2779649 C51.1524982,12.0982019 51.1455335,11.9198392 51.1328445,11.7430614 L55.9484056,11.7433799 C56.5007179,11.7433301 56.9484554,12.1910676 56.9484554,12.7433799 L56.9483896,12.754852 C56.7720078,28.1295003 56.4771782,40.7466641 56.063901,50.6063433 C52.4333112,55.3973618 49.392156,60.1376676 48.1823636,62.5154382 L48.1823636,62.5154382 L33.652283,76.54691 L31.2131832,79.5271207 C31.1615524,79.5902057 31.1586794,79.6800882 31.2061761,79.7463417 C31.2513374,79.8093376 31.3378528,79.8260652 31.4032416,79.7844441 L31.4032416,79.7844441 L34.6497457,77.7179883 L49.0240891,63.8205749 C50.4317295,63.253589 52.7668367,61.9562089 55.563735,60.2980309 C54.9268558,70.305847 54.0969644,75.8284486 53.074451,76.866775 C50.9667056,79.0071163 36.410719,80.5220714 9.40649115,81.4116402 C8.85449933,81.4298363 8.39228046,80.997099 8.37409683,80.4451067 L8.37355468,12.7433799 C8.37355468,12.1910951 8.82126993,11.7433799 9.37355468,11.7433799 L14.2004684,11.7433459 Z M51.1542828,12.8843279 L14.1802255,12.8843279 L14.1802255,13.6297163 C14.1802255,13.9328527 14.401392,14.1843328 14.6911658,14.2315975 L14.7900888,14.2395796 L50.5444195,14.2395796 C50.8475559,14.2395796 51.0990361,14.0184131 51.1463007,13.7286393 L51.1542828,13.6297163 L51.1542828,12.8843279 Z" id="形状结合" opacity="0.1"></path>
-                    <path d="M51.1542828,12.8843279 L51.1542828,13.6297163 C51.1542828,13.9665345 50.8812377,14.2395796 50.5444195,14.2395796 L14.7900888,14.2395796 C14.4532706,14.2395796 14.1802255,13.9665345 14.1802255,13.6297163 L14.1802255,12.8843279 L51.1542828,12.8843279 Z M32.6666667,0.409947594 C35.3390122,0.409947594 36.4844182,2.04054424 37.559354,4.09230166 L37.6666667,4.29883648 L43.1264189,4.29883648 C47.5437009,4.29883648 51.1276453,7.86677865 51.153554,12.2779649 L14.1804818,12.2778365 L14.1834578,12.076084 C14.315557,7.75842984 17.85722,4.29883648 22.2069144,4.29883648 L27.6666667,4.29883648 C28.6150174,2.15106246 29.9052429,0.409947594 32.6666667,0.409947594 Z M32.6666667,2.78115151 C31.3120837,2.78115151 30.2139772,3.87925801 30.2139772,5.23384102 C30.2139772,6.58842404 31.3120837,7.68653054 32.6666667,7.68653054 C34.0212497,7.68653054 35.1193562,6.58842404 35.1193562,5.23384102 C35.1193562,3.87925801 34.0212497,2.78115151 32.6666667,2.78115151 Z" id="形状结合" opacity="0.600000024"></path>
-                </g>
-                <path d="M97.6761419,40.2903995 C99.7517293,42.2127197 89.9389235,49.9460736 81.8339935,53.1136911 C73.7290635,56.2813086 66.9727037,56.5237494 59.1503546,57.1521926 C53.2024735,57.6300421 47.8343942,58.0022314 45.4201241,57.7884268 L26.3031966,63.6452975 L22.472389,64.0126411 C22.3952315,64.0200399 22.32574,63.9658583 22.3141005,63.8892258 C22.3018591,63.8086304 22.3452247,63.7298488 22.4198681,63.6970795 L25.9461093,62.1490205 L45.2626608,56.2434061 C49.0125662,53.5156053 60.9326362,46.9400314 69.6983687,44.3686601 C71.5385763,43.828847 73.5142111,43.2968003 75.534509,42.7957409 L76.344795,42.5970249 C76.7509139,42.4985483 77.1583353,42.401435 77.566333,42.3058708 L78.3828816,42.1168629 C78.5190294,42.0857242 78.6551875,42.0547713 78.7913289,42.0240113 L79.6077626,41.8418191 C88.037734,39.9842067 96.1969822,38.9204761 97.6761419,40.2903995 Z M73.8198845,49.3904138 C72.844215,49.2292085 71.2184974,48.6857103 71.4069642,49.2618687 C71.595431,49.838027 73.5434796,50.6831254 77.9582298,50.9219131 C82.1364755,51.1479085 80.9884089,50.5768282 79.1725031,50.2294564 L78.9643262,50.1911419 L78.9643262,50.1911419 L78.8585674,50.1728042 C76.8757611,49.8359846 74.795554,49.5516191 73.8198845,49.3904138 Z M77.6121891,47.055513 C76.7867087,46.8700867 75.9819316,46.7044908 76.1176277,47.1193248 C76.3060945,47.6954831 78.2541431,48.5405815 82.6688933,48.7793692 C87.0836434,49.0181568 85.552037,48.3670799 83.5692308,48.0302603 C81.5864245,47.6934407 79.5062174,47.4090752 78.5305479,47.2478699 C78.335414,47.2156288 78.1142782,47.1680961 77.8868543,47.1172872 Z M83.0030573,44.6437142 C82.2282905,44.4723045 81.5175691,44.346363 81.6457265,44.7381507 C81.8341933,45.314309 83.7822419,46.1594075 88.1969921,46.3981951 C92.3752378,46.6241905 91.2271711,46.0531102 89.4112654,45.7057385 L89.2030885,45.6674239 L89.2030885,45.6674239 L89.0973296,45.6490862 C87.1145234,45.3122666 85.0343163,45.0279011 84.0586468,44.8666958 C83.8635129,44.8344547 83.6423771,44.786922 83.4149532,44.7361131 Z" id="pencil" opacity="0.5" transform="translate(60.134884, 51.841162) rotate(-27.000000) translate(-60.134884, -51.841162) "></path>
-            </g>
-        </g>
-    </g>
+<?xml version="1.0" encoding="UTF-8"?>
+<svg width="89px" height="100px" viewBox="0 0 89 100" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
+    <title>EmptyPage/04 NoRecord</title>
+    <g id="页面-3" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
+        <g id="编组" transform="translate(-26.000000, -10.000000)" fill="#A1A7B3">
+            <g transform="translate(25.110000, 10.000000)">
+                <g id="board" transform="translate(0.699850, 0.000000)">
+                    <ellipse id="椭圆形" opacity="0.15" cx="33.6169259" cy="97.7931677" rx="33.3235423" ry="2.09054905"></ellipse>
+                    <path d="M15.6566517,7.68481948 C14.8320038,8.84653907 14.3086539,10.237133 14.2005157,11.7426876 L9.37355468,11.7427205 C8.86071884,11.7427205 8.43804752,12.1287607 8.38028241,12.6260993 L8.37355468,12.7427205 L8.37355468,80.4445085 C8.37355468,80.9573443 8.75959487,81.3800156 9.25693355,81.4377807 L9.37355468,81.4445085 L55.9597787,81.4445085 C56.4726145,81.4445085 56.8952858,81.0584683 56.9530509,80.5611296 L56.9597787,80.4445085 L56.9591918,59.4642467 C58.2354881,58.6963697 59.5848521,57.8715818 60.9689698,57.0202918 C61.872061,56.4648531 62.7610143,55.9245256 63.6374278,55.3893306 L63.6365385,89.1456801 C63.6365385,91.3548191 61.8456775,93.1456801 59.6365385,93.1456801 L5.41431625,93.1456801 C3.20517725,93.1456801 1.41431625,91.3548191 1.41431625,89.1456801 L1.41431625,11.6865305 C1.41431625,9.47739154 3.20517725,7.68653054 5.41431625,7.68653054 L15.6566517,7.68481948 Z M49.6766817,7.68481948 L59.6365385,7.68653054 C61.8456775,7.68653054 63.6365385,9.47739154 63.6365385,11.6865305 L63.6371125,41.7414945 C61.4081436,43.9658433 59.103154,46.6784541 56.9601952,49.4365519 L56.9597787,12.7427205 C56.9597787,12.1904357 56.5120634,11.7427205 55.9597787,11.7427205 L51.1328176,11.7426876 C51.0246794,10.237133 50.5013296,8.84653907 49.6766817,7.68481948 Z" id="形状结合" opacity="0.600000024"></path>
+                    <path d="M1.42842215,88.034569 C1.42842215,90.243708 3.21928315,92.034569 5.42842215,92.034569 L5.42842215,92.034569 L59.6506444,92.034569 C61.8597834,92.034569 63.6506444,90.243708 63.6506444,88.034569 L63.6506444,88.034569 L63.6506444,89.1456801 C63.6506444,91.3548191 61.8597834,93.1456801 59.6506444,93.1456801 L5.42842215,93.1456801 C3.21928315,93.1456801 1.42842215,91.3548191 1.42842215,89.1456801 Z" id="bolder" opacity="0.300000012"></path>
+                    <path d="M56.9591918,59.4642467 L56.9597787,80.4445085 C56.9597787,80.9967932 56.5120634,81.4445085 55.9597787,81.4445085 L9.37355468,81.4445085 C8.86071884,81.4445085 8.43804752,81.0584683 8.38028241,80.5611296 L8.37409683,80.4451067 C8.39228046,80.997099 8.85449933,81.4298363 9.40649115,81.4116402 C36.410719,80.5220714 50.9667056,79.0071163 53.074451,76.866775 C54.0969746,75.8284382 54.9268724,70.3057364 55.5641443,60.2986697 C56.0174001,60.0290696 56.4832148,59.7506158 56.9591918,59.4642467 Z M55.9597787,11.7427205 C56.5120634,11.7427205 56.9597787,12.1904357 56.9597787,12.7427205 L56.9601952,49.4365519 C56.6579918,49.8255032 56.3590107,50.215359 56.0639196,50.6048777 C56.4662846,41.0062372 56.7563626,28.7933575 56.9341716,13.9668335 L56.9483896,12.754852 L56.9484554,12.7433799 C56.9484554,12.2305185 56.562396,11.8078261 56.0650326,11.750098 L55.9484056,11.7433799 L55.9597787,11.7427205 Z" id="形状结合" opacity="0.800000012"></path>
+                    <path d="M14.2004684,11.7433459 L14.1902746,11.909269 L14.1902746,11.909269 L14.1834578,12.076084 L14.1804818,12.2778365 L51.153554,12.2779649 C51.1524982,12.0982019 51.1455335,11.9198392 51.1328445,11.7430614 L55.9484056,11.7433799 C56.5007179,11.7433301 56.9484554,12.1910676 56.9484554,12.7433799 L56.9483896,12.754852 C56.7720078,28.1295003 56.4771782,40.7466641 56.063901,50.6063433 C52.4333112,55.3973618 49.392156,60.1376676 48.1823636,62.5154382 L48.1823636,62.5154382 L33.652283,76.54691 L31.2131832,79.5271207 C31.1615524,79.5902057 31.1586794,79.6800882 31.2061761,79.7463417 C31.2513374,79.8093376 31.3378528,79.8260652 31.4032416,79.7844441 L31.4032416,79.7844441 L34.6497457,77.7179883 L49.0240891,63.8205749 C50.4317295,63.253589 52.7668367,61.9562089 55.563735,60.2980309 C54.9268558,70.305847 54.0969644,75.8284486 53.074451,76.866775 C50.9667056,79.0071163 36.410719,80.5220714 9.40649115,81.4116402 C8.85449933,81.4298363 8.39228046,80.997099 8.37409683,80.4451067 L8.37355468,12.7433799 C8.37355468,12.1910951 8.82126993,11.7433799 9.37355468,11.7433799 L14.2004684,11.7433459 Z M51.1542828,12.8843279 L14.1802255,12.8843279 L14.1802255,13.6297163 C14.1802255,13.9328527 14.401392,14.1843328 14.6911658,14.2315975 L14.7900888,14.2395796 L50.5444195,14.2395796 C50.8475559,14.2395796 51.0990361,14.0184131 51.1463007,13.7286393 L51.1542828,13.6297163 L51.1542828,12.8843279 Z" id="形状结合" opacity="0.200000003"></path>
+                    <path d="M14.2004684,11.7433459 L14.1902746,11.909269 L14.1902746,11.909269 L14.1834578,12.076084 L14.1804818,12.2778365 L51.153554,12.2779649 C51.1524982,12.0982019 51.1455335,11.9198392 51.1328445,11.7430614 L55.9484056,11.7433799 C56.5007179,11.7433301 56.9484554,12.1910676 56.9484554,12.7433799 L56.9483896,12.754852 C56.7720078,28.1295003 56.4771782,40.7466641 56.063901,50.6063433 C52.4333112,55.3973618 49.392156,60.1376676 48.1823636,62.5154382 L48.1823636,62.5154382 L33.652283,76.54691 L31.2131832,79.5271207 C31.1615524,79.5902057 31.1586794,79.6800882 31.2061761,79.7463417 C31.2513374,79.8093376 31.3378528,79.8260652 31.4032416,79.7844441 L31.4032416,79.7844441 L34.6497457,77.7179883 L49.0240891,63.8205749 C50.4317295,63.253589 52.7668367,61.9562089 55.563735,60.2980309 C54.9268558,70.305847 54.0969644,75.8284486 53.074451,76.866775 C50.9667056,79.0071163 36.410719,80.5220714 9.40649115,81.4116402 C8.85449933,81.4298363 8.39228046,80.997099 8.37409683,80.4451067 L8.37355468,12.7433799 C8.37355468,12.1910951 8.82126993,11.7433799 9.37355468,11.7433799 L14.2004684,11.7433459 Z M51.1542828,12.8843279 L14.1802255,12.8843279 L14.1802255,13.6297163 C14.1802255,13.9328527 14.401392,14.1843328 14.6911658,14.2315975 L14.7900888,14.2395796 L50.5444195,14.2395796 C50.8475559,14.2395796 51.0990361,14.0184131 51.1463007,13.7286393 L51.1542828,13.6297163 L51.1542828,12.8843279 Z" id="形状结合" opacity="0.1"></path>
+                    <path d="M51.1542828,12.8843279 L51.1542828,13.6297163 C51.1542828,13.9665345 50.8812377,14.2395796 50.5444195,14.2395796 L14.7900888,14.2395796 C14.4532706,14.2395796 14.1802255,13.9665345 14.1802255,13.6297163 L14.1802255,12.8843279 L51.1542828,12.8843279 Z M32.6666667,0.409947594 C35.3390122,0.409947594 36.4844182,2.04054424 37.559354,4.09230166 L37.6666667,4.29883648 L43.1264189,4.29883648 C47.5437009,4.29883648 51.1276453,7.86677865 51.153554,12.2779649 L14.1804818,12.2778365 L14.1834578,12.076084 C14.315557,7.75842984 17.85722,4.29883648 22.2069144,4.29883648 L27.6666667,4.29883648 C28.6150174,2.15106246 29.9052429,0.409947594 32.6666667,0.409947594 Z M32.6666667,2.78115151 C31.3120837,2.78115151 30.2139772,3.87925801 30.2139772,5.23384102 C30.2139772,6.58842404 31.3120837,7.68653054 32.6666667,7.68653054 C34.0212497,7.68653054 35.1193562,6.58842404 35.1193562,5.23384102 C35.1193562,3.87925801 34.0212497,2.78115151 32.6666667,2.78115151 Z" id="形状结合" opacity="0.600000024"></path>
+                </g>
+                <path d="M97.6761419,40.2903995 C99.7517293,42.2127197 89.9389235,49.9460736 81.8339935,53.1136911 C73.7290635,56.2813086 66.9727037,56.5237494 59.1503546,57.1521926 C53.2024735,57.6300421 47.8343942,58.0022314 45.4201241,57.7884268 L26.3031966,63.6452975 L22.472389,64.0126411 C22.3952315,64.0200399 22.32574,63.9658583 22.3141005,63.8892258 C22.3018591,63.8086304 22.3452247,63.7298488 22.4198681,63.6970795 L25.9461093,62.1490205 L45.2626608,56.2434061 C49.0125662,53.5156053 60.9326362,46.9400314 69.6983687,44.3686601 C71.5385763,43.828847 73.5142111,43.2968003 75.534509,42.7957409 L76.344795,42.5970249 C76.7509139,42.4985483 77.1583353,42.401435 77.566333,42.3058708 L78.3828816,42.1168629 C78.5190294,42.0857242 78.6551875,42.0547713 78.7913289,42.0240113 L79.6077626,41.8418191 C88.037734,39.9842067 96.1969822,38.9204761 97.6761419,40.2903995 Z M73.8198845,49.3904138 C72.844215,49.2292085 71.2184974,48.6857103 71.4069642,49.2618687 C71.595431,49.838027 73.5434796,50.6831254 77.9582298,50.9219131 C82.1364755,51.1479085 80.9884089,50.5768282 79.1725031,50.2294564 L78.9643262,50.1911419 L78.9643262,50.1911419 L78.8585674,50.1728042 C76.8757611,49.8359846 74.795554,49.5516191 73.8198845,49.3904138 Z M77.6121891,47.055513 C76.7867087,46.8700867 75.9819316,46.7044908 76.1176277,47.1193248 C76.3060945,47.6954831 78.2541431,48.5405815 82.6688933,48.7793692 C87.0836434,49.0181568 85.552037,48.3670799 83.5692308,48.0302603 C81.5864245,47.6934407 79.5062174,47.4090752 78.5305479,47.2478699 C78.335414,47.2156288 78.1142782,47.1680961 77.8868543,47.1172872 Z M83.0030573,44.6437142 C82.2282905,44.4723045 81.5175691,44.346363 81.6457265,44.7381507 C81.8341933,45.314309 83.7822419,46.1594075 88.1969921,46.3981951 C92.3752378,46.6241905 91.2271711,46.0531102 89.4112654,45.7057385 L89.2030885,45.6674239 L89.2030885,45.6674239 L89.0973296,45.6490862 C87.1145234,45.3122666 85.0343163,45.0279011 84.0586468,44.8666958 C83.8635129,44.8344547 83.6423771,44.786922 83.4149532,44.7361131 Z" id="pencil" opacity="0.5" transform="translate(60.134884, 51.841162) rotate(-27.000000) translate(-60.134884, -51.841162) "></path>
+            </g>
+        </g>
+    </g>
 </svg>
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/noinstallationpackage.svg b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/noinstallationpackage.svg
index 5b10a66c6b63e6d73bfb96492ec59a900ed5335c..7482b2ef3ffaefa6baec907c8799ec3e4bc86987 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/noinstallationpackage.svg
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/noinstallationpackage.svg
@@ -1,17 +1,17 @@
-<?xml version="1.0" encoding="UTF-8"?>
-<svg width="120px" height="120px" viewBox="0 0 120 120" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
-    <title>EmptyPage/08 NoInstallationPackage</title>
-    <g id="EmptyPage/08-NoInstallationPackage" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
-        <g id="编组-2" transform="translate(14.000000, 51.025747)" fill="#A1A7B3">
-            <path d="M4.57792274,47.0669184 L4.57900841,49.0245634 C4.57900841,50.2738388 5.59189592,51.2865766 6.8411713,51.2865766 L6.8411713,51.2865766 L85.446129,51.2865766 C86.6954044,51.2865766 87.7081422,50.2738388 87.7081422,49.0245634 L87.7081422,49.0245634 L87.708644,47.328947 C89.8357984,48.1875518 91.0073975,49.126339 91.0073975,50.1099331 C91.0073975,54.1981099 70.7675805,57.5122319 45.8005009,57.5122319 C20.8334214,57.5122319 0.593604392,54.1981099 0.593604392,50.1099331 C0.593604392,49.0252975 2.01827659,47.9951473 4.57792274,47.0669184 Z" id="形状结合" opacity="0.15"></path>
-            <g id="编组" transform="translate(4.579008, 0.039774)" opacity="0.400000006">
-                <path d="M62.716712,4.50827115e-14 C63.331748,4.50827115e-14 63.9182463,0.250319527 64.3430889,0.689872805 L64.4316038,0.786936966 L82.8555435,22.2062117 C83.00998,22.3857563 83.1035975,22.6085521 83.1245888,22.8427661 L83.1291338,22.9716384 L83.1291338,48.9847899 C83.1291338,50.2340652 82.116396,51.246803 80.8671206,51.246803 L2.2621629,51.246803 C1.01288752,51.246803 -2.92629202e-13,50.2340652 -2.92629202e-13,48.9847899 L-2.92629202e-13,22.9716384 C-0.00359823141,22.7376152 0.0629778479,22.5011152 0.204478481,22.2981239 L0.26972224,22.2132841 L18.3835198,0.801081662 C18.7846594,0.326897103 19.3616846,0.0400259175 19.9778847,0.00388391299 L20.1104774,4.50827115e-14 L62.716712,4.50827115e-14 Z" id="形状结合"></path>
-                <path d="M59.414791,0.889121388 C60.0628862,0.889121388 60.6776259,1.16695848 61.1054473,1.64833274 L61.1884738,1.7472994 L76.7381181,21.3935773 C76.8962479,21.5933672 76.9822833,21.8406987 76.9822833,22.0954949 C76.9822833,22.6917399 76.5209017,23.1802236 75.935685,23.2233993 L75.8512767,23.2265015 L67.7878404,23.2265015 L67.7883236,31.0717551 C67.7883236,32.0087117 67.0287703,32.768265 66.0918138,32.768265 L19.1550405,32.768265 C18.2180839,32.768265 17.4585306,32.0087117 17.4585306,31.0717551 L17.4580473,23.2265015 L7.27790875,23.2265015 C7.0577044,23.2265015 6.84300371,23.1622388 6.65973024,23.0426137 L6.58318416,22.9879822 C6.11492237,22.6234807 6.01160067,21.963922 6.33140176,21.4762711 L6.38542141,21.4007703 L21.6727588,1.76168539 C22.0745501,1.24551878 22.6785769,0.930262609 23.327415,0.892871863 L23.4577335,0.889121388 L59.414791,0.889121388 Z" id="形状结合"></path>
-            </g>
-        </g>
-        <path d="M28.4586551,10.6597099 C29.58555,11.2197235 30.4940082,11.8025872 31.185047,12.406965 C31.3517048,12.5527227 31.645936,12.5705628 31.8422309,12.4468119 C32.0385257,12.3230611 32.0625513,12.1045812 31.8958936,11.9588235 C31.1455031,11.3025373 30.1722984,10.6781324 28.9772969,10.084273 C28.7632997,9.97792653 28.4737187,10.0205316 28.3304998,10.1794341 C28.1872808,10.3383366 28.2446579,10.5533634 28.4586551,10.6597099 Z M32.3475853,15.4815162 C32.525601,16.3650881 32.4219463,17.2950834 32.0318839,18.2773755 C31.9536333,18.4744335 32.0640178,18.6924796 32.2784346,18.7643951 C32.4928513,18.8363106 32.730105,18.7348627 32.8083556,18.5378047 C33.2473732,17.4322289 33.3662784,16.365406 33.1603336,15.3432096 C33.118777,15.1369451 32.9031487,15.0006957 32.6787145,15.038888 C32.4542802,15.0770804 32.3060286,15.2752517 32.3475853,15.4815162 Z M29.8276185,21.5304148 L29.1558628,22.7970142 L28.7703673,23.5369555 L28.47235,24.121913 L28.2879383,24.4918402 C28.1865689,24.6971548 28.3050416,24.9317611 28.5525544,25.0158481 C28.8000673,25.0999351 29.0828922,25.0016608 29.1842616,24.7963462 L29.3664979,24.43079 L29.6614312,23.8519062 L30.1544498,22.9079967 L30.7136448,21.8549949 C30.8216968,21.652039 30.7109466,21.414851 30.4662772,21.3252207 C30.2216078,21.2355903 29.9356705,21.3274589 29.8276185,21.5304148 Z M27.4848075,27.8226015 C27.1213073,29.0356285 26.9556977,30.0666323 27.0101466,30.9481501 C27.0230451,31.1569746 27.2083061,31.3161341 27.4239387,31.3036428 C27.6395712,31.2911516 27.8039196,31.1117397 27.7910211,30.9029153 C27.7427277,30.1210537 27.8953898,29.1706545 28.236082,28.0337398 C28.2962871,27.8328311 28.1769144,27.6226975 27.9694557,27.5643933 C27.7619969,27.5060891 27.5450126,27.6216928 27.4848075,27.8226015 Z M28.393765,33.3872485 C29.2174753,34.2073167 30.2617737,34.7607401 31.5198555,35.0502479 C31.7406023,35.1010458 31.9550583,34.934675 31.9988564,34.6786482 C32.0426544,34.4226215 31.8992091,34.173891 31.6784623,34.1230931 C30.5520155,33.8638769 29.6363262,33.3786095 28.9245898,32.6700201 C28.7538245,32.5000099 28.4965627,32.5227464 28.3499795,32.7208036 C28.2033963,32.9188607 28.2229997,33.2172383 28.393765,33.3872485 Z M36.1650065,35.0585035 C37.1005553,34.9936397 38.1170396,34.8410134 39.2148173,34.6009252 C39.4195294,34.5561539 39.5512004,34.3441612 39.5089126,34.1274263 C39.4666248,33.9106915 39.2663919,33.7712875 39.0616798,33.8160588 C37.9966835,34.0489776 37.0145178,34.1964509 36.1155406,34.2587791 C35.9069532,34.273241 35.748933,34.463989 35.7625927,34.6848268 C35.7762523,34.9056646 35.9564191,35.0729654 36.1650065,35.0585035 Z M42.5231315,35.0362112 C43.4739621,34.635306 44.471785,34.1674703 45.5166727,33.6327248 C45.7199456,33.5286952 45.825246,33.2107437 45.7518678,32.9225603 C45.6784896,32.6343768 45.4542195,32.4850905 45.2509467,32.5891201 C44.2197544,33.1168566 43.2360935,33.5780524 42.3000366,33.9727284 C42.0928919,34.0600683 41.9749094,34.3689399 42.0365154,34.6626126 C42.0981213,34.9562852 42.3159868,35.123551 42.5231315,35.0362112 Z M48.7901209,31.287171 C49.7771782,31.0117548 50.7519265,30.8062126 51.7144539,30.6703933 C51.9241745,30.6408002 52.0644669,30.4795757 52.0278058,30.3102881 C51.9911447,30.1410006 51.7914129,30.0277558 51.5816923,30.0573488 C50.5780245,30.1989734 49.5635106,30.4129008 48.5382386,30.69898 C48.3370203,30.7551254 48.2302864,30.9323114 48.2998418,31.0947358 C48.3693971,31.2571603 48.5889026,31.3433164 48.7901209,31.287171 Z M54.9087631,30.9101423 C55.8967195,30.9270713 56.871602,31.0551203 57.8337889,31.294326 C58.0374368,31.3449541 58.2386573,31.1984679 58.2832274,30.9671399 C58.3277975,30.735812 58.1988395,30.5072414 57.9951916,30.4566132 C56.9836679,30.2051421 55.9585279,30.0704919 54.9201499,30.052699 C54.7117055,30.0491272 54.5401789,30.238177 54.5370345,30.4749534 C54.5338902,30.7117299 54.7003187,30.9065706 54.9087631,30.9101423 Z M61.0463499,32.1365655 C62.012974,32.5713096 62.9680982,33.1053484 63.9117872,33.7389239 C64.1044997,33.8683075 64.3609994,33.809786 64.4846954,33.6082126 C64.6083914,33.4066392 64.5524425,33.1383456 64.3597301,33.008962 C63.3783154,32.3500582 62.3830245,31.793561 61.3739224,31.3397122 C61.1635504,31.2450964 60.9196806,31.3467767 60.829224,31.5668217 C60.7387673,31.7868667 60.8359779,32.0419497 61.0463499,32.1365655 Z M67.2236209,35.9410737 C68.1522073,36.760509 69.070724,37.6664586 69.979096,38.6589995 C70.1622819,38.8591592 70.4668484,38.8670231 70.6593645,38.676564 C70.8518805,38.4861049 70.8594441,38.1694458 70.6762582,37.969286 C69.7447775,36.9514952 68.8014996,36.0211231 67.8463497,35.1782467 C67.643745,34.9994573 67.3400989,35.0252846 67.1681371,35.2359334 C66.9961753,35.4465823 67.0210163,35.7622844 67.2236209,35.9410737 Z M70.9417002,40.8980718 C71.8495473,41.8723413 72.7849181,42.8037656 73.7478032,43.69232 C73.9467803,43.8759369 74.2551649,43.8615448 74.4365995,43.6601745 C74.6180341,43.4588041 74.6038132,43.1467103 74.4048361,42.9630934 C73.4601326,42.0913171 72.5422372,41.1772944 71.6511403,40.2210007 C71.4663944,40.0227379 71.1578147,40.0135817 70.9619082,40.2005497 C70.7660017,40.3875177 70.7569543,40.699809 70.9417002,40.8980718 Z M75.9860946,45.7461113 C76.9272308,46.3696662 77.894254,46.9591286 78.8871429,47.5144825 C79.0909297,47.6284669 79.3645245,47.5800387 79.498234,47.4063151 C79.6319436,47.2325915 79.5751348,46.9993582 79.371348,46.8853738 C78.3981652,46.3410421 77.4503034,45.7632599 76.5277415,45.1520114 C76.3352951,45.024505 76.0580347,45.0541344 75.908463,45.2181905 C75.7588914,45.3822467 75.7936483,45.6186049 75.9860946,45.7461113 Z M82.2871897,48.4218698 C83.2516341,49.0016734 84.2397596,49.5410487 85.251542,50.0399895 C85.4579959,50.1417982 85.7004325,50.0403366 85.7930393,49.8133687 C85.8856462,49.5864008 85.793355,49.3198747 85.5869012,49.218066 C84.5947058,48.7287841 83.6258575,48.1999314 82.6803322,47.6315016 C82.4818046,47.512151 82.2328582,47.5923281 82.1242949,47.8105823 C82.0157316,48.0288365 82.0886621,48.3025192 82.2871897,48.4218698 Z M88.5905032,51.8789641 C89.5696796,52.1339949 90.5700586,52.3651229 91.5916223,52.5723515 C91.7991549,52.6144503 92.0145958,52.5269401 92.072823,52.3768918 C92.1310502,52.2268436 92.0100143,52.0710776 91.8024817,52.0289787 C90.7989266,51.8254033 89.8164548,51.5984126 88.8550482,51.34801 C88.6522587,51.2951925 88.4286449,51.3712337 88.3555928,51.5178526 C88.2825407,51.6644715 88.3877137,51.8261467 88.5905032,51.8789641 Z M94.893376,53.3151238 C95.8807285,53.5154997 96.8868155,53.6873836 97.911628,53.8307837 C98.1194046,53.8598575 98.3120543,53.7194744 98.3419233,53.5172294 C98.3717922,53.3149844 98.2275696,53.1274635 98.0197931,53.0983897 C97.0106226,52.9571784 96.0202039,52.7879713 95.048528,52.5907768 C94.8430344,52.5490734 94.6417169,52.6774167 94.5988729,52.8774395 C94.5560288,53.0774624 94.6878824,53.2734203 94.893376,53.3151238 Z" id="路径-24" fill="#A1A7B3" opacity="0.300000012" transform="translate(62.672920, 31.930171) scale(-1, 1) rotate(-5.000000) translate(-62.672920, -31.930171) "></path>
-        <path d="M88.9189333,20.2887828 C87.7183495,22.0671017 86.8356621,23.1357866 86.2708713,23.4948375 C84.6666606,24.5146722 83.2198624,24.7436751 82.2390575,24.7436751 C79.9909033,24.7436751 84.6243483,24.2163833 86.2708713,22.4303255 C87.3685533,21.2396203 88.6676638,19.4380941 90.1682028,17.0257469 L88.9189333,17.0257469 L87.5387205,18.7105768 C87.1074507,18.1796158 86.5497369,17.9141353 85.8655793,17.9141353 C84.8393429,17.9141353 82.1886267,18.3518543 81.173374,21.1715594 C80.4965389,23.0513628 79.1054143,24.7061193 77,26.1358289 C80.0419706,27.6449668 82.9971637,27.6449668 85.8655793,26.1358289 C88.733995,24.626691 89.7517796,22.6776756 88.9189333,20.2887828 Z" id="路径-14" fill="#A1A7B3" opacity="0.400000006"></path>
-        <path d="M97.6216296,47.8903388 C96.9546386,48.9065211 96.4642567,49.5171982 96.150484,49.7223701 C95.2592559,50.3051328 94.4554791,50.4359916 93.9105875,50.4359916 C92.661613,50.4359916 95.235749,50.134682 96.150484,49.1140775 C96.7603074,48.4336745 97.4820354,47.404231 98.3156682,46.0257469 L97.6216296,46.0257469 L96.8548447,46.9885068 C96.6152504,46.6851005 96.3054094,46.5333974 95.9253218,46.5333974 C95.3551905,46.5333974 93.8825704,46.7835226 93.3185411,48.3947826 C92.9425216,49.468956 92.1696746,50.4145311 91,51.231508 C92.6899837,52.0938726 94.3317576,52.0938726 95.9253218,51.231508 C97.5188861,50.3691435 98.084322,49.2554204 97.6216296,47.8903388 Z" id="路径-14备份" fill="#A1A7B3" opacity="0.400000006" transform="translate(94.657834, 48.952014) rotate(-62.000000) translate(-94.657834, -48.952014) "></path>
-        <path d="M23.9459555,52.3564868 C23.1455663,53.6267146 22.5571081,54.390061 22.1805809,54.6465259 C21.1111071,55.3749793 20.1465749,55.5385527 19.492705,55.5385527 C17.9939355,55.5385527 21.0828988,55.1619158 22.1805809,53.8861602 C22.9123689,53.0356564 23.7784425,51.748852 24.7788018,50.0257469 L23.9459555,50.0257469 L23.0258137,51.2291968 C22.7383004,50.8499389 22.3664913,50.66031 21.9103862,50.66031 C21.2262286,50.66031 19.4590844,50.9729665 18.7822494,52.9870415 C18.331026,54.3297582 17.4036095,55.5117272 16,56.5329483 C18.0279804,57.610904 19.9981091,57.610904 21.9103862,56.5329483 C23.8226633,55.4549927 24.5011864,54.0628388 23.9459555,52.3564868 Z" id="路径-14备份-2" fill="#A1A7B3" opacity="0.600000024" transform="translate(20.389401, 53.683581) rotate(80.000000) translate(-20.389401, -53.683581) "></path>
-    </g>
+<?xml version="1.0" encoding="UTF-8"?>
+<svg width="120px" height="120px" viewBox="0 0 120 120" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
+    <title>EmptyPage/08 NoInstallationPackage</title>
+    <g id="EmptyPage/08-NoInstallationPackage" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
+        <g id="编组-2" transform="translate(14.000000, 51.025747)" fill="#A1A7B3">
+            <path d="M4.57792274,47.0669184 L4.57900841,49.0245634 C4.57900841,50.2738388 5.59189592,51.2865766 6.8411713,51.2865766 L6.8411713,51.2865766 L85.446129,51.2865766 C86.6954044,51.2865766 87.7081422,50.2738388 87.7081422,49.0245634 L87.7081422,49.0245634 L87.708644,47.328947 C89.8357984,48.1875518 91.0073975,49.126339 91.0073975,50.1099331 C91.0073975,54.1981099 70.7675805,57.5122319 45.8005009,57.5122319 C20.8334214,57.5122319 0.593604392,54.1981099 0.593604392,50.1099331 C0.593604392,49.0252975 2.01827659,47.9951473 4.57792274,47.0669184 Z" id="形状结合" opacity="0.15"></path>
+            <g id="编组" transform="translate(4.579008, 0.039774)" opacity="0.400000006">
+                <path d="M62.716712,4.50827115e-14 C63.331748,4.50827115e-14 63.9182463,0.250319527 64.3430889,0.689872805 L64.4316038,0.786936966 L82.8555435,22.2062117 C83.00998,22.3857563 83.1035975,22.6085521 83.1245888,22.8427661 L83.1291338,22.9716384 L83.1291338,48.9847899 C83.1291338,50.2340652 82.116396,51.246803 80.8671206,51.246803 L2.2621629,51.246803 C1.01288752,51.246803 -2.92629202e-13,50.2340652 -2.92629202e-13,48.9847899 L-2.92629202e-13,22.9716384 C-0.00359823141,22.7376152 0.0629778479,22.5011152 0.204478481,22.2981239 L0.26972224,22.2132841 L18.3835198,0.801081662 C18.7846594,0.326897103 19.3616846,0.0400259175 19.9778847,0.00388391299 L20.1104774,4.50827115e-14 L62.716712,4.50827115e-14 Z" id="形状结合"></path>
+                <path d="M59.414791,0.889121388 C60.0628862,0.889121388 60.6776259,1.16695848 61.1054473,1.64833274 L61.1884738,1.7472994 L76.7381181,21.3935773 C76.8962479,21.5933672 76.9822833,21.8406987 76.9822833,22.0954949 C76.9822833,22.6917399 76.5209017,23.1802236 75.935685,23.2233993 L75.8512767,23.2265015 L67.7878404,23.2265015 L67.7883236,31.0717551 C67.7883236,32.0087117 67.0287703,32.768265 66.0918138,32.768265 L19.1550405,32.768265 C18.2180839,32.768265 17.4585306,32.0087117 17.4585306,31.0717551 L17.4580473,23.2265015 L7.27790875,23.2265015 C7.0577044,23.2265015 6.84300371,23.1622388 6.65973024,23.0426137 L6.58318416,22.9879822 C6.11492237,22.6234807 6.01160067,21.963922 6.33140176,21.4762711 L6.38542141,21.4007703 L21.6727588,1.76168539 C22.0745501,1.24551878 22.6785769,0.930262609 23.327415,0.892871863 L23.4577335,0.889121388 L59.414791,0.889121388 Z" id="形状结合"></path>
+            </g>
+        </g>
+        <path d="M28.4586551,10.6597099 C29.58555,11.2197235 30.4940082,11.8025872 31.185047,12.406965 C31.3517048,12.5527227 31.645936,12.5705628 31.8422309,12.4468119 C32.0385257,12.3230611 32.0625513,12.1045812 31.8958936,11.9588235 C31.1455031,11.3025373 30.1722984,10.6781324 28.9772969,10.084273 C28.7632997,9.97792653 28.4737187,10.0205316 28.3304998,10.1794341 C28.1872808,10.3383366 28.2446579,10.5533634 28.4586551,10.6597099 Z M32.3475853,15.4815162 C32.525601,16.3650881 32.4219463,17.2950834 32.0318839,18.2773755 C31.9536333,18.4744335 32.0640178,18.6924796 32.2784346,18.7643951 C32.4928513,18.8363106 32.730105,18.7348627 32.8083556,18.5378047 C33.2473732,17.4322289 33.3662784,16.365406 33.1603336,15.3432096 C33.118777,15.1369451 32.9031487,15.0006957 32.6787145,15.038888 C32.4542802,15.0770804 32.3060286,15.2752517 32.3475853,15.4815162 Z M29.8276185,21.5304148 L29.1558628,22.7970142 L28.7703673,23.5369555 L28.47235,24.121913 L28.2879383,24.4918402 C28.1865689,24.6971548 28.3050416,24.9317611 28.5525544,25.0158481 C28.8000673,25.0999351 29.0828922,25.0016608 29.1842616,24.7963462 L29.3664979,24.43079 L29.6614312,23.8519062 L30.1544498,22.9079967 L30.7136448,21.8549949 C30.8216968,21.652039 30.7109466,21.414851 30.4662772,21.3252207 C30.2216078,21.2355903 29.9356705,21.3274589 29.8276185,21.5304148 Z M27.4848075,27.8226015 C27.1213073,29.0356285 26.9556977,30.0666323 27.0101466,30.9481501 C27.0230451,31.1569746 27.2083061,31.3161341 27.4239387,31.3036428 C27.6395712,31.2911516 27.8039196,31.1117397 27.7910211,30.9029153 C27.7427277,30.1210537 27.8953898,29.1706545 28.236082,28.0337398 C28.2962871,27.8328311 28.1769144,27.6226975 27.9694557,27.5643933 C27.7619969,27.5060891 27.5450126,27.6216928 27.4848075,27.8226015 Z M28.393765,33.3872485 C29.2174753,34.2073167 30.2617737,34.7607401 31.5198555,35.0502479 C31.7406023,35.1010458 31.9550583,34.934675 31.9988564,34.6786482 C32.0426544,34.4226215 31.8992091,34.173891 31.6784623,34.1230931 C30.5520155,33.8638769 29.6363262,33.3786095 28.9245898,32.6700201 C28.7538245,32.5000099 28.4965627,32.5227464 28.3499795,32.7208036 C28.2033963,32.9188607 28.2229997,33.2172383 28.393765,33.3872485 Z M36.1650065,35.0585035 C37.1005553,34.9936397 38.1170396,34.8410134 39.2148173,34.6009252 C39.4195294,34.5561539 39.5512004,34.3441612 39.5089126,34.1274263 C39.4666248,33.9106915 39.2663919,33.7712875 39.0616798,33.8160588 C37.9966835,34.0489776 37.0145178,34.1964509 36.1155406,34.2587791 C35.9069532,34.273241 35.748933,34.463989 35.7625927,34.6848268 C35.7762523,34.9056646 35.9564191,35.0729654 36.1650065,35.0585035 Z M42.5231315,35.0362112 C43.4739621,34.635306 44.471785,34.1674703 45.5166727,33.6327248 C45.7199456,33.5286952 45.825246,33.2107437 45.7518678,32.9225603 C45.6784896,32.6343768 45.4542195,32.4850905 45.2509467,32.5891201 C44.2197544,33.1168566 43.2360935,33.5780524 42.3000366,33.9727284 C42.0928919,34.0600683 41.9749094,34.3689399 42.0365154,34.6626126 C42.0981213,34.9562852 42.3159868,35.123551 42.5231315,35.0362112 Z M48.7901209,31.287171 C49.7771782,31.0117548 50.7519265,30.8062126 51.7144539,30.6703933 C51.9241745,30.6408002 52.0644669,30.4795757 52.0278058,30.3102881 C51.9911447,30.1410006 51.7914129,30.0277558 51.5816923,30.0573488 C50.5780245,30.1989734 49.5635106,30.4129008 48.5382386,30.69898 C48.3370203,30.7551254 48.2302864,30.9323114 48.2998418,31.0947358 C48.3693971,31.2571603 48.5889026,31.3433164 48.7901209,31.287171 Z M54.9087631,30.9101423 C55.8967195,30.9270713 56.871602,31.0551203 57.8337889,31.294326 C58.0374368,31.3449541 58.2386573,31.1984679 58.2832274,30.9671399 C58.3277975,30.735812 58.1988395,30.5072414 57.9951916,30.4566132 C56.9836679,30.2051421 55.9585279,30.0704919 54.9201499,30.052699 C54.7117055,30.0491272 54.5401789,30.238177 54.5370345,30.4749534 C54.5338902,30.7117299 54.7003187,30.9065706 54.9087631,30.9101423 Z M61.0463499,32.1365655 C62.012974,32.5713096 62.9680982,33.1053484 63.9117872,33.7389239 C64.1044997,33.8683075 64.3609994,33.809786 64.4846954,33.6082126 C64.6083914,33.4066392 64.5524425,33.1383456 64.3597301,33.008962 C63.3783154,32.3500582 62.3830245,31.793561 61.3739224,31.3397122 C61.1635504,31.2450964 60.9196806,31.3467767 60.829224,31.5668217 C60.7387673,31.7868667 60.8359779,32.0419497 61.0463499,32.1365655 Z M67.2236209,35.9410737 C68.1522073,36.760509 69.070724,37.6664586 69.979096,38.6589995 C70.1622819,38.8591592 70.4668484,38.8670231 70.6593645,38.676564 C70.8518805,38.4861049 70.8594441,38.1694458 70.6762582,37.969286 C69.7447775,36.9514952 68.8014996,36.0211231 67.8463497,35.1782467 C67.643745,34.9994573 67.3400989,35.0252846 67.1681371,35.2359334 C66.9961753,35.4465823 67.0210163,35.7622844 67.2236209,35.9410737 Z M70.9417002,40.8980718 C71.8495473,41.8723413 72.7849181,42.8037656 73.7478032,43.69232 C73.9467803,43.8759369 74.2551649,43.8615448 74.4365995,43.6601745 C74.6180341,43.4588041 74.6038132,43.1467103 74.4048361,42.9630934 C73.4601326,42.0913171 72.5422372,41.1772944 71.6511403,40.2210007 C71.4663944,40.0227379 71.1578147,40.0135817 70.9619082,40.2005497 C70.7660017,40.3875177 70.7569543,40.699809 70.9417002,40.8980718 Z M75.9860946,45.7461113 C76.9272308,46.3696662 77.894254,46.9591286 78.8871429,47.5144825 C79.0909297,47.6284669 79.3645245,47.5800387 79.498234,47.4063151 C79.6319436,47.2325915 79.5751348,46.9993582 79.371348,46.8853738 C78.3981652,46.3410421 77.4503034,45.7632599 76.5277415,45.1520114 C76.3352951,45.024505 76.0580347,45.0541344 75.908463,45.2181905 C75.7588914,45.3822467 75.7936483,45.6186049 75.9860946,45.7461113 Z M82.2871897,48.4218698 C83.2516341,49.0016734 84.2397596,49.5410487 85.251542,50.0399895 C85.4579959,50.1417982 85.7004325,50.0403366 85.7930393,49.8133687 C85.8856462,49.5864008 85.793355,49.3198747 85.5869012,49.218066 C84.5947058,48.7287841 83.6258575,48.1999314 82.6803322,47.6315016 C82.4818046,47.512151 82.2328582,47.5923281 82.1242949,47.8105823 C82.0157316,48.0288365 82.0886621,48.3025192 82.2871897,48.4218698 Z M88.5905032,51.8789641 C89.5696796,52.1339949 90.5700586,52.3651229 91.5916223,52.5723515 C91.7991549,52.6144503 92.0145958,52.5269401 92.072823,52.3768918 C92.1310502,52.2268436 92.0100143,52.0710776 91.8024817,52.0289787 C90.7989266,51.8254033 89.8164548,51.5984126 88.8550482,51.34801 C88.6522587,51.2951925 88.4286449,51.3712337 88.3555928,51.5178526 C88.2825407,51.6644715 88.3877137,51.8261467 88.5905032,51.8789641 Z M94.893376,53.3151238 C95.8807285,53.5154997 96.8868155,53.6873836 97.911628,53.8307837 C98.1194046,53.8598575 98.3120543,53.7194744 98.3419233,53.5172294 C98.3717922,53.3149844 98.2275696,53.1274635 98.0197931,53.0983897 C97.0106226,52.9571784 96.0202039,52.7879713 95.048528,52.5907768 C94.8430344,52.5490734 94.6417169,52.6774167 94.5988729,52.8774395 C94.5560288,53.0774624 94.6878824,53.2734203 94.893376,53.3151238 Z" id="路径-24" fill="#A1A7B3" opacity="0.300000012" transform="translate(62.672920, 31.930171) scale(-1, 1) rotate(-5.000000) translate(-62.672920, -31.930171) "></path>
+        <path d="M88.9189333,20.2887828 C87.7183495,22.0671017 86.8356621,23.1357866 86.2708713,23.4948375 C84.6666606,24.5146722 83.2198624,24.7436751 82.2390575,24.7436751 C79.9909033,24.7436751 84.6243483,24.2163833 86.2708713,22.4303255 C87.3685533,21.2396203 88.6676638,19.4380941 90.1682028,17.0257469 L88.9189333,17.0257469 L87.5387205,18.7105768 C87.1074507,18.1796158 86.5497369,17.9141353 85.8655793,17.9141353 C84.8393429,17.9141353 82.1886267,18.3518543 81.173374,21.1715594 C80.4965389,23.0513628 79.1054143,24.7061193 77,26.1358289 C80.0419706,27.6449668 82.9971637,27.6449668 85.8655793,26.1358289 C88.733995,24.626691 89.7517796,22.6776756 88.9189333,20.2887828 Z" id="路径-14" fill="#A1A7B3" opacity="0.400000006"></path>
+        <path d="M97.6216296,47.8903388 C96.9546386,48.9065211 96.4642567,49.5171982 96.150484,49.7223701 C95.2592559,50.3051328 94.4554791,50.4359916 93.9105875,50.4359916 C92.661613,50.4359916 95.235749,50.134682 96.150484,49.1140775 C96.7603074,48.4336745 97.4820354,47.404231 98.3156682,46.0257469 L97.6216296,46.0257469 L96.8548447,46.9885068 C96.6152504,46.6851005 96.3054094,46.5333974 95.9253218,46.5333974 C95.3551905,46.5333974 93.8825704,46.7835226 93.3185411,48.3947826 C92.9425216,49.468956 92.1696746,50.4145311 91,51.231508 C92.6899837,52.0938726 94.3317576,52.0938726 95.9253218,51.231508 C97.5188861,50.3691435 98.084322,49.2554204 97.6216296,47.8903388 Z" id="路径-14备份" fill="#A1A7B3" opacity="0.400000006" transform="translate(94.657834, 48.952014) rotate(-62.000000) translate(-94.657834, -48.952014) "></path>
+        <path d="M23.9459555,52.3564868 C23.1455663,53.6267146 22.5571081,54.390061 22.1805809,54.6465259 C21.1111071,55.3749793 20.1465749,55.5385527 19.492705,55.5385527 C17.9939355,55.5385527 21.0828988,55.1619158 22.1805809,53.8861602 C22.9123689,53.0356564 23.7784425,51.748852 24.7788018,50.0257469 L23.9459555,50.0257469 L23.0258137,51.2291968 C22.7383004,50.8499389 22.3664913,50.66031 21.9103862,50.66031 C21.2262286,50.66031 19.4590844,50.9729665 18.7822494,52.9870415 C18.331026,54.3297582 17.4036095,55.5117272 16,56.5329483 C18.0279804,57.610904 19.9981091,57.610904 21.9103862,56.5329483 C23.8226633,55.4549927 24.5011864,54.0628388 23.9459555,52.3564868 Z" id="路径-14备份-2" fill="#A1A7B3" opacity="0.600000024" transform="translate(20.389401, 53.683581) rotate(80.000000) translate(-20.389401, -53.683581) "></path>
+    </g>
 </svg>
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/nopermission.svg b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/nopermission.svg
index fe47a1df835fe7c7a296aa92bf009875373f30ad..b15b3756efcf2e289f375f5ce1ca33dfb9c2844b 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/nopermission.svg
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/nopermission.svg
@@ -1,16 +1,16 @@
-<?xml version="1.0" encoding="UTF-8"?>
-<svg width="120px" height="120px" viewBox="0 0 120 120" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
-    <title>EmptyPage/18 NoPermission</title>
-    <g id="EmptyPage/18-NoPermission" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
-        <path d="M59.4581299,16 C86.6146598,16 109.038027,36.2650767 112.430732,62.4977292 L108.637493,61.8229287 L105.06218,61.1707783 L101.778945,60.5538938 L99.2660295,60.0667626 L97.4017358,59.6946907 L95.2539169,59.2516419 L93.3089293,58.8330833 L91.5667729,58.4390149 L90.3190864,58.1413932 L89.4685106,57.9284627 L88.6909541,57.7243488 L87.9864169,57.5290513 L77.8677758,54.5731447 L66.7894981,51.1680269 L57.9371338,48.4139094 C56.7942297,48.0539454 55.7030916,47.859825 54.6733965,47.7962595 L54.2491555,47.7754726 L54.0682228,47.7621595 L54.0682228,47.7621595 L53.9027597,47.7528092 L53.6171458,47.7440478 L53.4309435,47.7444286 L53.2277586,47.752122 L53.0955308,47.7629891 L52.4582603,47.8593968 L52.1089448,47.9071648 L52.1089448,47.9071648 L51.7674991,47.9652318 L49.3823353,48.3248282 L44.3676854,49.0591119 L39.7137617,49.7130263 L36.6988963,50.1196502 L35.3959471,50.290406 L33.9121451,50.4806179 L31.628643,50.7630268 L30.0300679,50.951742 L29.2503825,51.0405566 C22.8538019,51.759555 15.6292591,53.6294398 7.57675411,56.6502109 C13.299677,33.3135469 34.3570057,16 59.4581299,16 Z" id="bg" fill="#A1A7B3" opacity="0.200000003"></path>
-        <path d="M56.8271484,48.2007747 C58.8140613,48.6552252 62.1843262,49.7802408 66.1083984,51.0405566 C70.0324707,52.3008723 77.4980715,54.4672541 87.7677976,57.4659114 C91.7729665,58.6353806 99.9677379,60.3126532 112.352112,62.4977292 L113.475677,69.947845 L105.420284,69.947845 C105.515503,69.947845 81.2993409,72.2327726 81.6954859,74.5301224 C82.0916308,76.8274722 99.3699996,76.0025743 98.9824309,82.4701437 C98.5948622,88.9377131 77.9556254,86.2999254 71.3243189,90.3372515 C64.6930124,94.3745777 89.5466966,98.1225156 85.080416,101.653566 C80.6141354,105.184617 69.0001029,104.951003 52.8399857,104.951003 C36.6798686,104.951003 17.283563,100.959176 15.6241654,95.3548112 C14.5080002,91.5851318 20.9160791,89.1698933 30.6138684,87.0230943 L30.6150805,94.3332156 C30.6150805,94.8460515 31.0011207,95.2687228 31.4984593,95.3264879 L31.6150805,95.3332156 L33.7889935,95.3332156 C34.3018293,95.3332156 34.7245007,94.9471754 34.7822658,94.4498368 L34.7889935,94.3332156 L34.7881583,86.150266 C38.4629761,85.4191098 42.4680589,84.7024891 46.6230204,83.9541417 C64.3101133,80.7685311 87.9965907,82.2080371 88.7730009,80.9913581 C89.5494111,79.7746792 84.6584513,78.9375381 81.276188,78.050091 C77.8939247,77.1626438 73.419899,76.2773181 75.5919383,73.7000727 C77.3259385,71.642585 85.4099044,70.4103211 94.893497,69.9149371 C84.3665458,69.8744702 66.3423173,69.7969031 40.8210864,69.6822087 L37.254428,66.1155433 L42.9469177,60.4239462 C42.9469773,60.4238867 42.9470368,60.4238272 42.9470963,60.4237677 L43.0816197,60.2809349 C44.2026486,59.0165661 44.1578074,57.0814762 42.9470963,55.870765 C41.6896864,54.6133552 39.6510515,54.6132602 38.3935245,55.870553 L38.3935245,55.870553 L32.7017559,61.5612613 L27.0104691,55.8706333 C25.7529995,54.6133092 23.7143746,54.6133682 22.4569777,55.870765 C21.1995808,57.1281619 21.1995218,59.1667868 22.4568459,60.4242565 L22.4568459,60.4242565 L28.147474,66.1155433 L24.6552847,69.6091481 C18.757625,69.5823599 12.539196,69.5539829 6,69.5240168 L7.57675411,56.6502109 C15.3903507,53.656294 22.6148935,51.7864092 29.2503825,51.0405566 C39.203616,49.9217776 53.0230713,47.7725114 53.0230713,47.7725114 C53.0230713,47.7725114 54.1008813,47.5772176 56.8271484,48.2007747 Z" id="形状结合" fill="#A1A7B3" opacity="0.300000012"></path>
-        <path d="M44.8846961,53.1949619 C44.3221238,51.6576356 49.8259865,45.8592581 57.9371338,48.4139094 C63.3445653,50.1170103 72.8644831,53.0117247 86.4968872,57.0980525 C91.4632081,58.326879 95.4767173,59.2578279 98.5374146,59.8908992 C101.598112,60.5239704 106.229218,61.3929138 112.430732,62.4977292 L113.475677,69.947845 L35.3018692,63.7473708 C46.6103424,60.9097092 52.264579,58.7408478 52.264579,57.2407866 C52.264579,54.9906948 45.4472685,54.7322883 44.8846961,53.1949619 Z" id="mountain-1" fill="#A1A7B3" opacity="0.100000001"></path>
-        <circle id="椭圆形" fill="#A1A7B3" opacity="0.100000001" transform="translate(80.939087, 37.304934) rotate(-360.000000) translate(-80.939087, -37.304934) " cx="80.9390869" cy="37.3049335" r="8.34782609"></circle>
-        <circle id="椭圆形" fill="#A1A7B3" opacity="0.100000001" transform="translate(80.939087, 37.304934) rotate(-360.000000) translate(-80.939087, -37.304934) " cx="80.9390869" cy="37.3049335" r="5.93745541"></circle>
-        <circle id="椭圆形" fill="#A1A7B3" opacity="0.200000003" transform="translate(80.939087, 37.304934) rotate(-360.000000) translate(-80.939087, -37.304934) " cx="80.9390869" cy="37.3049335" r="3.07462134"></circle>
-        <path d="M34.7889095,94.3226088 C38.3894263,94.4384424 41.0498631,94.8469929 41.0498631,95.3332156 C41.0498631,95.9095128 37.312414,96.3766939 32.702037,96.3766939 L32.3890794,96.3759742 C27.9237064,96.355402 24.3542109,95.8964151 24.3542109,95.3332156 C24.3542109,94.8470322 27.0142171,94.4385085 30.6142905,94.3226369 L30.6150805,94.3332156 C30.6150805,94.8855004 31.0627957,95.3332156 31.6150805,95.3332156 L31.6150805,95.3332156 L33.7889935,95.3332156 C34.3412783,95.3332156 34.7889935,94.8855004 34.7889935,94.3332156 L34.7889935,94.3332156 Z" id="形状结合" fill-opacity="0.2" fill="#A1A7B3"></path>
-        <path d="M34.7882277,84.5512153 L34.7889935,94.3332156 C34.7889935,94.8855004 34.3412783,95.3332156 33.7889935,95.3332156 L31.6150805,95.3332156 C31.0627957,95.3332156 30.6150805,94.8855004 30.6150805,94.3332156 L30.6142277,85.3622153 L34.7882277,84.5512153 Z M32.7017559,70.6682153 L34.7882277,72.7552153 L34.7882277,78.1722153 L30.6142277,78.9842153 L30.6142277,72.7552153 L32.7017559,70.6682153 Z" id="形状结合" fill-opacity="0.6" fill="#A1A7B3"></path>
-        <path d="M42.9470963,55.870765 C44.2043732,57.128042 44.2043732,59.1664907 42.9470963,60.4237677 C42.9470368,60.4238272 42.9469773,60.4238867 42.9469177,60.4239462 L37.254428,66.1155433 L37.254428,66.1155433 L42.9469981,71.8076222 C44.2043736,73.0648892 44.2044616,75.1034098 42.9471945,76.3607854 C42.9471617,76.3608181 42.947129,76.3608509 42.9470963,76.3608836 C41.689775,77.6182049 39.6512543,77.6182049 38.393933,76.3608836 C38.3939003,76.3608509 38.3938675,76.3608181 38.3938348,76.3607854 L32.7017559,70.6682153 L32.7017559,70.6682153 L27.0101588,76.3607051 C25.7529805,77.6180806 23.7145318,77.6182405 22.4571562,76.3610621 C22.4570967,76.3610026 22.4570372,76.3609431 22.4569777,76.3608836 C21.1995678,75.1034738 21.1994729,73.0648389 22.4567656,71.8073119 L28.147474,66.1155433 L28.147474,66.1155433 L22.4568459,60.4242565 C21.1995218,59.1667868 21.1995808,57.1281619 22.4569777,55.870765 C23.7143746,54.6133682 25.7529995,54.6133092 27.0104691,55.8706333 L32.7017559,61.5612613 L32.7017559,61.5612613 L38.3935245,55.870553 C39.6510515,54.6132602 41.6896864,54.6133552 42.9470963,55.870765 Z" id="路径" fill-opacity="0.8" fill="#A1A7B3"></path>
-        <path d="M26.3976892,78.6375635 L39.0063848,78.6375635 C39.5586696,78.6375635 40.0063848,79.0852787 40.0063848,79.6375635 L40.0063848,83.898433 C40.0063848,84.4507178 39.5586696,84.898433 39.0063848,84.898433 L26.3976892,84.898433 C25.8454044,84.898433 25.3976892,84.4507178 25.3976892,83.898433 L25.3976892,79.6375635 C25.3976892,79.0852787 25.8454044,78.6375635 26.3976892,78.6375635 Z" id="矩形" fill="#A1A7B3" opacity="0.4" transform="translate(32.702037, 81.767998) rotate(-11.000000) translate(-32.702037, -81.767998) "></path>
-    </g>
+<?xml version="1.0" encoding="UTF-8"?>
+<svg width="120px" height="120px" viewBox="0 0 120 120" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
+    <title>EmptyPage/18 NoPermission</title>
+    <g id="EmptyPage/18-NoPermission" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
+        <path d="M59.4581299,16 C86.6146598,16 109.038027,36.2650767 112.430732,62.4977292 L108.637493,61.8229287 L105.06218,61.1707783 L101.778945,60.5538938 L99.2660295,60.0667626 L97.4017358,59.6946907 L95.2539169,59.2516419 L93.3089293,58.8330833 L91.5667729,58.4390149 L90.3190864,58.1413932 L89.4685106,57.9284627 L88.6909541,57.7243488 L87.9864169,57.5290513 L77.8677758,54.5731447 L66.7894981,51.1680269 L57.9371338,48.4139094 C56.7942297,48.0539454 55.7030916,47.859825 54.6733965,47.7962595 L54.2491555,47.7754726 L54.0682228,47.7621595 L54.0682228,47.7621595 L53.9027597,47.7528092 L53.6171458,47.7440478 L53.4309435,47.7444286 L53.2277586,47.752122 L53.0955308,47.7629891 L52.4582603,47.8593968 L52.1089448,47.9071648 L52.1089448,47.9071648 L51.7674991,47.9652318 L49.3823353,48.3248282 L44.3676854,49.0591119 L39.7137617,49.7130263 L36.6988963,50.1196502 L35.3959471,50.290406 L33.9121451,50.4806179 L31.628643,50.7630268 L30.0300679,50.951742 L29.2503825,51.0405566 C22.8538019,51.759555 15.6292591,53.6294398 7.57675411,56.6502109 C13.299677,33.3135469 34.3570057,16 59.4581299,16 Z" id="bg" fill="#A1A7B3" opacity="0.200000003"></path>
+        <path d="M56.8271484,48.2007747 C58.8140613,48.6552252 62.1843262,49.7802408 66.1083984,51.0405566 C70.0324707,52.3008723 77.4980715,54.4672541 87.7677976,57.4659114 C91.7729665,58.6353806 99.9677379,60.3126532 112.352112,62.4977292 L113.475677,69.947845 L105.420284,69.947845 C105.515503,69.947845 81.2993409,72.2327726 81.6954859,74.5301224 C82.0916308,76.8274722 99.3699996,76.0025743 98.9824309,82.4701437 C98.5948622,88.9377131 77.9556254,86.2999254 71.3243189,90.3372515 C64.6930124,94.3745777 89.5466966,98.1225156 85.080416,101.653566 C80.6141354,105.184617 69.0001029,104.951003 52.8399857,104.951003 C36.6798686,104.951003 17.283563,100.959176 15.6241654,95.3548112 C14.5080002,91.5851318 20.9160791,89.1698933 30.6138684,87.0230943 L30.6150805,94.3332156 C30.6150805,94.8460515 31.0011207,95.2687228 31.4984593,95.3264879 L31.6150805,95.3332156 L33.7889935,95.3332156 C34.3018293,95.3332156 34.7245007,94.9471754 34.7822658,94.4498368 L34.7889935,94.3332156 L34.7881583,86.150266 C38.4629761,85.4191098 42.4680589,84.7024891 46.6230204,83.9541417 C64.3101133,80.7685311 87.9965907,82.2080371 88.7730009,80.9913581 C89.5494111,79.7746792 84.6584513,78.9375381 81.276188,78.050091 C77.8939247,77.1626438 73.419899,76.2773181 75.5919383,73.7000727 C77.3259385,71.642585 85.4099044,70.4103211 94.893497,69.9149371 C84.3665458,69.8744702 66.3423173,69.7969031 40.8210864,69.6822087 L37.254428,66.1155433 L42.9469177,60.4239462 C42.9469773,60.4238867 42.9470368,60.4238272 42.9470963,60.4237677 L43.0816197,60.2809349 C44.2026486,59.0165661 44.1578074,57.0814762 42.9470963,55.870765 C41.6896864,54.6133552 39.6510515,54.6132602 38.3935245,55.870553 L38.3935245,55.870553 L32.7017559,61.5612613 L27.0104691,55.8706333 C25.7529995,54.6133092 23.7143746,54.6133682 22.4569777,55.870765 C21.1995808,57.1281619 21.1995218,59.1667868 22.4568459,60.4242565 L22.4568459,60.4242565 L28.147474,66.1155433 L24.6552847,69.6091481 C18.757625,69.5823599 12.539196,69.5539829 6,69.5240168 L7.57675411,56.6502109 C15.3903507,53.656294 22.6148935,51.7864092 29.2503825,51.0405566 C39.203616,49.9217776 53.0230713,47.7725114 53.0230713,47.7725114 C53.0230713,47.7725114 54.1008813,47.5772176 56.8271484,48.2007747 Z" id="形状结合" fill="#A1A7B3" opacity="0.300000012"></path>
+        <path d="M44.8846961,53.1949619 C44.3221238,51.6576356 49.8259865,45.8592581 57.9371338,48.4139094 C63.3445653,50.1170103 72.8644831,53.0117247 86.4968872,57.0980525 C91.4632081,58.326879 95.4767173,59.2578279 98.5374146,59.8908992 C101.598112,60.5239704 106.229218,61.3929138 112.430732,62.4977292 L113.475677,69.947845 L35.3018692,63.7473708 C46.6103424,60.9097092 52.264579,58.7408478 52.264579,57.2407866 C52.264579,54.9906948 45.4472685,54.7322883 44.8846961,53.1949619 Z" id="mountain-1" fill="#A1A7B3" opacity="0.100000001"></path>
+        <circle id="椭圆形" fill="#A1A7B3" opacity="0.100000001" transform="translate(80.939087, 37.304934) rotate(-360.000000) translate(-80.939087, -37.304934) " cx="80.9390869" cy="37.3049335" r="8.34782609"></circle>
+        <circle id="椭圆形" fill="#A1A7B3" opacity="0.100000001" transform="translate(80.939087, 37.304934) rotate(-360.000000) translate(-80.939087, -37.304934) " cx="80.9390869" cy="37.3049335" r="5.93745541"></circle>
+        <circle id="椭圆形" fill="#A1A7B3" opacity="0.200000003" transform="translate(80.939087, 37.304934) rotate(-360.000000) translate(-80.939087, -37.304934) " cx="80.9390869" cy="37.3049335" r="3.07462134"></circle>
+        <path d="M34.7889095,94.3226088 C38.3894263,94.4384424 41.0498631,94.8469929 41.0498631,95.3332156 C41.0498631,95.9095128 37.312414,96.3766939 32.702037,96.3766939 L32.3890794,96.3759742 C27.9237064,96.355402 24.3542109,95.8964151 24.3542109,95.3332156 C24.3542109,94.8470322 27.0142171,94.4385085 30.6142905,94.3226369 L30.6150805,94.3332156 C30.6150805,94.8855004 31.0627957,95.3332156 31.6150805,95.3332156 L31.6150805,95.3332156 L33.7889935,95.3332156 C34.3412783,95.3332156 34.7889935,94.8855004 34.7889935,94.3332156 L34.7889935,94.3332156 Z" id="形状结合" fill-opacity="0.2" fill="#A1A7B3"></path>
+        <path d="M34.7882277,84.5512153 L34.7889935,94.3332156 C34.7889935,94.8855004 34.3412783,95.3332156 33.7889935,95.3332156 L31.6150805,95.3332156 C31.0627957,95.3332156 30.6150805,94.8855004 30.6150805,94.3332156 L30.6142277,85.3622153 L34.7882277,84.5512153 Z M32.7017559,70.6682153 L34.7882277,72.7552153 L34.7882277,78.1722153 L30.6142277,78.9842153 L30.6142277,72.7552153 L32.7017559,70.6682153 Z" id="形状结合" fill-opacity="0.6" fill="#A1A7B3"></path>
+        <path d="M42.9470963,55.870765 C44.2043732,57.128042 44.2043732,59.1664907 42.9470963,60.4237677 C42.9470368,60.4238272 42.9469773,60.4238867 42.9469177,60.4239462 L37.254428,66.1155433 L37.254428,66.1155433 L42.9469981,71.8076222 C44.2043736,73.0648892 44.2044616,75.1034098 42.9471945,76.3607854 C42.9471617,76.3608181 42.947129,76.3608509 42.9470963,76.3608836 C41.689775,77.6182049 39.6512543,77.6182049 38.393933,76.3608836 C38.3939003,76.3608509 38.3938675,76.3608181 38.3938348,76.3607854 L32.7017559,70.6682153 L32.7017559,70.6682153 L27.0101588,76.3607051 C25.7529805,77.6180806 23.7145318,77.6182405 22.4571562,76.3610621 C22.4570967,76.3610026 22.4570372,76.3609431 22.4569777,76.3608836 C21.1995678,75.1034738 21.1994729,73.0648389 22.4567656,71.8073119 L28.147474,66.1155433 L28.147474,66.1155433 L22.4568459,60.4242565 C21.1995218,59.1667868 21.1995808,57.1281619 22.4569777,55.870765 C23.7143746,54.6133682 25.7529995,54.6133092 27.0104691,55.8706333 L32.7017559,61.5612613 L32.7017559,61.5612613 L38.3935245,55.870553 C39.6510515,54.6132602 41.6896864,54.6133552 42.9470963,55.870765 Z" id="路径" fill-opacity="0.8" fill="#A1A7B3"></path>
+        <path d="M26.3976892,78.6375635 L39.0063848,78.6375635 C39.5586696,78.6375635 40.0063848,79.0852787 40.0063848,79.6375635 L40.0063848,83.898433 C40.0063848,84.4507178 39.5586696,84.898433 39.0063848,84.898433 L26.3976892,84.898433 C25.8454044,84.898433 25.3976892,84.4507178 25.3976892,83.898433 L25.3976892,79.6375635 C25.3976892,79.0852787 25.8454044,78.6375635 26.3976892,78.6375635 Z" id="矩形" fill="#A1A7B3" opacity="0.4" transform="translate(32.702037, 81.767998) rotate(-11.000000) translate(-32.702037, -81.767998) "></path>
+    </g>
 </svg>
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/searchnoresult.svg b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/searchnoresult.svg
index e948acc0bbb8bc715385ff841418b60b81eb0997..86d078ff666d7e4d77898d861205e1f7d994fc19 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/searchnoresult.svg
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/media/searchnoresult.svg
@@ -1,22 +1,22 @@
-<?xml version="1.0" encoding="UTF-8"?>
-<svg width="120px" height="120px" viewBox="0 0 120 120" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
-    <title>EmptyPage/05 SearchNoResult</title>
-    <g id="EmptyPage/05-SearchNoResult" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
-        <g id="编组" transform="translate(5.442857, 14.967857)" fill="#A1A7B3">
-            <path d="M66.8745113,81.5472546 C68.4251242,81.5636925 72.8283566,82.1579284 74.7670742,75.8215255 C81.2263534,77.2078831 85.3071429,79.2496947 85.3071429,81.5261746 C85.3071429,85.7075122 71.5398989,89.0971561 54.5571429,89.0971561 C37.5743868,89.0971561 23.8071429,85.7075122 23.8071429,81.5261746 L23.8081429,81.5465255 Z" id="shadow" opacity="0.15"></path>
-            <g id="名单">
-                <path d="M84.184284,0.477047294 C89.175101,0.477047294 92.6887483,4.78091008 92.6887483,9.57246878 C92.6887483,9.67270637 92.687082,9.77254693 92.6837761,9.8719632 L92.6887483,9.87163721 L92.6887483,18.8466902 L75.6798198,18.8466902 L75.6798198,9.87163721 C75.6814861,9.77254693 75.6798198,9.67270637 75.6798198,9.57246878 C75.6798198,4.78091008 79.1934671,0.477047294 84.184284,0.477047294 Z" id="形状结合" opacity="0.600000024"></path>
-                <path d="M84.3111383,0.62870946 C80.9446833,0.62870946 78.7389646,2.38998069 77.6240825,3.93452927 C76.2145162,5.88733097 75.7261838,7.6891589 75.7030018,9.34458111 C75.6926987,10.0803243 75.6892643,10.8102482 75.6926987,11.5343527 L75.7030018,12.6161449 L75.7029342,36.4757346 C67.4304629,38.2636106 61.2321429,45.6233507 61.2321429,54.4307861 C61.2321429,63.1562984 67.3156909,70.4609219 75.4726349,72.3345045 C74.2667871,82.3567138 68.6662522,81.5662487 66.8745113,81.5472546 L19.890534,81.5469229 L19.8901769,81.5257095 L7.84059012,81.5261746 C6.84986747,81.5261746 3.6925978,79.2739018 1.8922999,75.705109 C0.692101303,73.3259139 0.115621403,69.7952744 0.1628602,65.1131905 L19.8901769,65.1127095 L19.890534,10.5261956 C19.890534,5.491719 22.2927014,2.22433678 27.0970361,0.724048984 L27.413768,0.62870946 L84.3111383,0.62870946 Z" id="形状结合" opacity="0.300000012"></path>
-                <path d="M0.1628602,65.1131905 L57.2866489,65.1131905 C56.909716,70.8184653 57.6384432,74.8662764 59.4728305,77.2566241 C61.3072179,79.6469717 64.0232696,81.0701552 67.6209856,81.5261746 C28.4278704,81.5261746 8.50107189,81.5261746 7.84059012,81.5261746 C6.84986747,81.5261746 3.6925978,79.2739018 1.8922999,75.705109 C0.692101303,73.3259139 0.115621403,69.7952744 0.1628602,65.1131905 Z" id="矩形" opacity="0.400000006"></path>
-            </g>
-            <g id="放大镜" transform="translate(61.232143, 36.058929)">
-                <path d="M31.8552859,30.8429902 L35.4226083,34.4104671 C36.3682462,34.0276822 37.4921636,34.2196849 38.2589537,34.986475 L47.5001621,44.2276834 C48.5230917,45.250613 48.5230917,46.9091095 47.5001621,47.932039 L47.247423,48.1847781 C46.2244935,49.2077077 44.5659969,49.2077077 43.5430674,48.1847781 L34.301859,38.9435698 C33.5352083,38.176919 33.343136,37.053271 33.7256423,36.1077402 L30.1144064,32.4948519 C30.7300227,31.9824198 31.3116118,31.4305033 31.8552859,30.8429902 Z" id="形状结合" opacity="0.600000024"></path>
-                <path d="M18.3696429,0 C28.5149165,0 36.7392857,8.22436925 36.7392857,18.3696429 C36.7392857,28.5149165 28.5149165,36.7392857 18.3696429,36.7392857 C8.22436925,36.7392857 0,28.5149165 0,18.3696429 C0,8.22436925 8.22436925,0 18.3696429,0 Z M18.3696429,4.08214286 C10.4788745,4.08214286 4.08214286,10.4788745 4.08214286,18.3696429 C4.08214286,26.2604112 10.4788745,32.6571429 18.3696429,32.6571429 C26.2604112,32.6571429 32.6571429,26.2604112 32.6571429,18.3696429 C32.6571429,10.4788745 26.2604112,4.08214286 18.3696429,4.08214286 Z" id="形状结合" opacity="0.5"></path>
-                <circle id="椭圆形" opacity="0.200000003" cx="18.3696429" cy="18.3696429" r="14.2875"></circle>
-                <rect id="矩形" opacity="0.200000003" transform="translate(27.039014, 19.156542) rotate(-255.000000) translate(-27.039014, -19.156542) " x="22.9568713" y="18.4761844" width="8.16428571" height="1.36071429" rx="0.680357143"></rect>
-                <rect id="矩形备份" opacity="0.200000003" transform="translate(24.997943, 14.394042) rotate(-255.000000) translate(-24.997943, -14.394042) " x="22.9568713" y="13.7136844" width="4.08214286" height="1.36071429" rx="0.680357143"></rect>
-            </g>
-        </g>
-        <path d="M54.3825439,48.1498383 L56.2216997,55.0136613 C56.4162027,55.7395562 55.9854244,56.4856861 55.2595294,56.6801891 C54.5336345,56.8746921 53.7875046,56.4439138 53.5930016,55.7180188 L51.7538458,48.8541959 C51.5593428,48.1283009 51.9901211,47.382171 52.7160161,47.187668 C53.441911,46.9931651 54.188041,47.4239434 54.3825439,48.1498383 Z M72.6464342,47.187668 C73.3723292,47.382171 73.8031075,48.1283009 73.6086045,48.8541959 L71.7694487,55.7180188 C71.5749457,56.4439138 70.8288158,56.8746921 70.1029209,56.6801891 C69.3770259,56.4856861 68.9462476,55.7395562 69.1407506,55.0136613 L70.9799064,48.1498383 C71.1744093,47.4239434 71.9205393,46.9931651 72.6464342,47.187668 Z M63.0592013,46.2642857 C63.8107031,46.2642857 64.4199156,46.8734983 64.4199156,47.625 L64.4199156,54.7309524 C64.4199156,55.4824541 63.8107031,56.0916667 63.0592013,56.0916667 C62.3076996,56.0916667 61.6984871,55.4824541 61.6984871,54.7309524 L61.6984871,47.625 C61.6984871,46.8734983 62.3076996,46.2642857 63.0592013,46.2642857 Z" id="形状结合" fill="#A1A7B3" opacity="0.300000012" transform="translate(62.681225, 51.495589) rotate(-53.000000) translate(-62.681225, -51.495589) "></path>
-    </g>
+<?xml version="1.0" encoding="UTF-8"?>
+<svg width="120px" height="120px" viewBox="0 0 120 120" version="1.1" xmlns="http://www.w3.org/2000/svg" xmlns:xlink="http://www.w3.org/1999/xlink">
+    <title>EmptyPage/05 SearchNoResult</title>
+    <g id="EmptyPage/05-SearchNoResult" stroke="none" stroke-width="1" fill="none" fill-rule="evenodd">
+        <g id="编组" transform="translate(5.442857, 14.967857)" fill="#A1A7B3">
+            <path d="M66.8745113,81.5472546 C68.4251242,81.5636925 72.8283566,82.1579284 74.7670742,75.8215255 C81.2263534,77.2078831 85.3071429,79.2496947 85.3071429,81.5261746 C85.3071429,85.7075122 71.5398989,89.0971561 54.5571429,89.0971561 C37.5743868,89.0971561 23.8071429,85.7075122 23.8071429,81.5261746 L23.8081429,81.5465255 Z" id="shadow" opacity="0.15"></path>
+            <g id="名单">
+                <path d="M84.184284,0.477047294 C89.175101,0.477047294 92.6887483,4.78091008 92.6887483,9.57246878 C92.6887483,9.67270637 92.687082,9.77254693 92.6837761,9.8719632 L92.6887483,9.87163721 L92.6887483,18.8466902 L75.6798198,18.8466902 L75.6798198,9.87163721 C75.6814861,9.77254693 75.6798198,9.67270637 75.6798198,9.57246878 C75.6798198,4.78091008 79.1934671,0.477047294 84.184284,0.477047294 Z" id="形状结合" opacity="0.600000024"></path>
+                <path d="M84.3111383,0.62870946 C80.9446833,0.62870946 78.7389646,2.38998069 77.6240825,3.93452927 C76.2145162,5.88733097 75.7261838,7.6891589 75.7030018,9.34458111 C75.6926987,10.0803243 75.6892643,10.8102482 75.6926987,11.5343527 L75.7030018,12.6161449 L75.7029342,36.4757346 C67.4304629,38.2636106 61.2321429,45.6233507 61.2321429,54.4307861 C61.2321429,63.1562984 67.3156909,70.4609219 75.4726349,72.3345045 C74.2667871,82.3567138 68.6662522,81.5662487 66.8745113,81.5472546 L19.890534,81.5469229 L19.8901769,81.5257095 L7.84059012,81.5261746 C6.84986747,81.5261746 3.6925978,79.2739018 1.8922999,75.705109 C0.692101303,73.3259139 0.115621403,69.7952744 0.1628602,65.1131905 L19.8901769,65.1127095 L19.890534,10.5261956 C19.890534,5.491719 22.2927014,2.22433678 27.0970361,0.724048984 L27.413768,0.62870946 L84.3111383,0.62870946 Z" id="形状结合" opacity="0.300000012"></path>
+                <path d="M0.1628602,65.1131905 L57.2866489,65.1131905 C56.909716,70.8184653 57.6384432,74.8662764 59.4728305,77.2566241 C61.3072179,79.6469717 64.0232696,81.0701552 67.6209856,81.5261746 C28.4278704,81.5261746 8.50107189,81.5261746 7.84059012,81.5261746 C6.84986747,81.5261746 3.6925978,79.2739018 1.8922999,75.705109 C0.692101303,73.3259139 0.115621403,69.7952744 0.1628602,65.1131905 Z" id="矩形" opacity="0.400000006"></path>
+            </g>
+            <g id="放大镜" transform="translate(61.232143, 36.058929)">
+                <path d="M31.8552859,30.8429902 L35.4226083,34.4104671 C36.3682462,34.0276822 37.4921636,34.2196849 38.2589537,34.986475 L47.5001621,44.2276834 C48.5230917,45.250613 48.5230917,46.9091095 47.5001621,47.932039 L47.247423,48.1847781 C46.2244935,49.2077077 44.5659969,49.2077077 43.5430674,48.1847781 L34.301859,38.9435698 C33.5352083,38.176919 33.343136,37.053271 33.7256423,36.1077402 L30.1144064,32.4948519 C30.7300227,31.9824198 31.3116118,31.4305033 31.8552859,30.8429902 Z" id="形状结合" opacity="0.600000024"></path>
+                <path d="M18.3696429,0 C28.5149165,0 36.7392857,8.22436925 36.7392857,18.3696429 C36.7392857,28.5149165 28.5149165,36.7392857 18.3696429,36.7392857 C8.22436925,36.7392857 0,28.5149165 0,18.3696429 C0,8.22436925 8.22436925,0 18.3696429,0 Z M18.3696429,4.08214286 C10.4788745,4.08214286 4.08214286,10.4788745 4.08214286,18.3696429 C4.08214286,26.2604112 10.4788745,32.6571429 18.3696429,32.6571429 C26.2604112,32.6571429 32.6571429,26.2604112 32.6571429,18.3696429 C32.6571429,10.4788745 26.2604112,4.08214286 18.3696429,4.08214286 Z" id="形状结合" opacity="0.5"></path>
+                <circle id="椭圆形" opacity="0.200000003" cx="18.3696429" cy="18.3696429" r="14.2875"></circle>
+                <rect id="矩形" opacity="0.200000003" transform="translate(27.039014, 19.156542) rotate(-255.000000) translate(-27.039014, -19.156542) " x="22.9568713" y="18.4761844" width="8.16428571" height="1.36071429" rx="0.680357143"></rect>
+                <rect id="矩形备份" opacity="0.200000003" transform="translate(24.997943, 14.394042) rotate(-255.000000) translate(-24.997943, -14.394042) " x="22.9568713" y="13.7136844" width="4.08214286" height="1.36071429" rx="0.680357143"></rect>
+            </g>
+        </g>
+        <path d="M54.3825439,48.1498383 L56.2216997,55.0136613 C56.4162027,55.7395562 55.9854244,56.4856861 55.2595294,56.6801891 C54.5336345,56.8746921 53.7875046,56.4439138 53.5930016,55.7180188 L51.7538458,48.8541959 C51.5593428,48.1283009 51.9901211,47.382171 52.7160161,47.187668 C53.441911,46.9931651 54.188041,47.4239434 54.3825439,48.1498383 Z M72.6464342,47.187668 C73.3723292,47.382171 73.8031075,48.1283009 73.6086045,48.8541959 L71.7694487,55.7180188 C71.5749457,56.4439138 70.8288158,56.8746921 70.1029209,56.6801891 C69.3770259,56.4856861 68.9462476,55.7395562 69.1407506,55.0136613 L70.9799064,48.1498383 C71.1744093,47.4239434 71.9205393,46.9931651 72.6464342,47.187668 Z M63.0592013,46.2642857 C63.8107031,46.2642857 64.4199156,46.8734983 64.4199156,47.625 L64.4199156,54.7309524 C64.4199156,55.4824541 63.8107031,56.0916667 63.0592013,56.0916667 C62.3076996,56.0916667 61.6984871,55.4824541 61.6984871,54.7309524 L61.6984871,47.625 C61.6984871,46.8734983 62.3076996,46.2642857 63.0592013,46.2642857 Z" id="形状结合" fill="#A1A7B3" opacity="0.300000012" transform="translate(62.681225, 51.495589) rotate(-53.000000) translate(-62.681225, -51.495589) "></path>
+    </g>
 </svg>
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/profile/main_pages.json b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/profile/main_pages.json
index c2e856f093e10b849d7a39aff19a40ab42378454..8d7d10dba96af760acd49dae99e711a7ded32611 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/profile/main_pages.json
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/base/profile/main_pages.json
@@ -1,13 +1,13 @@
-{
-  "src": [
-    "pages/authority-management",
-    "pages/application-secondary",
-    "pages/authority-secondary",
-    "pages/authority-tertiary",
-    "pages/application-tertiary",
-    "pages/other-permissions",
-    "pages/authority-tertiary-groups",
-    "pages/permission-access-record",
-    "pages/dialogPlus"
-  ]
-}
+{
+  "src": [
+    "pages/authority-management",
+    "pages/application-secondary",
+    "pages/authority-secondary",
+    "pages/authority-tertiary",
+    "pages/application-tertiary",
+    "pages/other-permissions",
+    "pages/authority-tertiary-groups",
+    "pages/permission-access-record",
+    "pages/dialogPlus"
+  ]
+}
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/dark/profile/string.json b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/dark/profile/string.json
index ddc52a17f97a258671b91d1f14330a673df33285..d7a74c41d6465558a0355552c4a1760e7c72b5e6 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/dark/profile/string.json
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/dark/profile/string.json
@@ -1,7 +1,7 @@
-{
-  "colors": {
-    "colorSubBackground": "#000000",
-    "appbar_subtitle_color": "#99ffffff",
-    "text_color": "#ffffff"
-  }
+{
+  "colors": {
+    "colorSubBackground": "#000000",
+    "appbar_subtitle_color": "#99ffffff",
+    "text_color": "#ffffff"
+  }
 }
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/en/profile/string.json b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/en/profile/string.json
index 319b5d66eabfb2e956923d29ef1f267e48bafbc8..a312eeb3302ba74317579187199f9de625018b49 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/en/profile/string.json
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/en/profile/string.json
@@ -1,14 +1,14 @@
-{
-  "strings": {
-    "app_name": "CategoryPage",
-    "describe": "describe",
-    "category": "Category",
-    "itemChild": "ItemChild",
-    "item": "Item",
-    "search": "search...",
-    "you_search": "You search ",
-    "you_clicked": "You clicked ",
-    "tab": "Tab",
-    "more": "more >"
-  }
+{
+  "strings": {
+    "app_name": "CategoryPage",
+    "describe": "describe",
+    "category": "Category",
+    "itemChild": "ItemChild",
+    "item": "Item",
+    "search": "search...",
+    "you_search": "You search ",
+    "you_clicked": "You clicked ",
+    "tab": "Tab",
+    "more": "more >"
+  }
 }
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/light/profile/string.json b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/light/profile/string.json
index 4b9482c8f2954ce8b38cb37addef4d297b33a279..2c94e0786fb5b453a61689df2cd603c78937011b 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/light/profile/string.json
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/light/profile/string.json
@@ -1,7 +1,7 @@
-{
-  "colors": {
-    "colorSubBackground": "#f1f3f5",
-    "appbar_subtitle_color": "#99000000",
-    "text_color": "#000000"
-  }
+{
+  "colors": {
+    "colorSubBackground": "#f1f3f5",
+    "appbar_subtitle_color": "#99000000",
+    "text_color": "#000000"
+  }
 }
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/zh/profile/string.json b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/zh/profile/string.json
index 4ca364c6261d5db6919dbaf791b5432bc0c7e0da..82a144d6676c601a1c74866bc34d7092fad1d5b5 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/zh/profile/string.json
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/zh/profile/string.json
@@ -1,14 +1,14 @@
-{
-  "strings": {
-    "app_name": "分类页",
-    "describe": "描述",
-    "category": "分类",
-    "itemChild": "子类",
-    "item": "类型",
-    "search": "搜索...",
-    "you_search": "你搜索了",
-    "you_clicked": "你点击了",
-    "tab": "分页",
-    "more": "更多 >"
-  }
+{
+  "strings": {
+    "app_name": "分类页",
+    "describe": "描述",
+    "category": "分类",
+    "itemChild": "子类",
+    "item": "类型",
+    "search": "搜索...",
+    "you_search": "你搜索了",
+    "you_clicked": "你点击了",
+    "tab": "分页",
+    "more": "更多 >"
+  }
 }
\ No newline at end of file
diff --git a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/zh_CN/element/string.json b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/zh_CN/element/string.json
index e92d068a4ca22b1e67d5ebfdd2884414be207b05..ee595d17b8aa05b31ef4840d211e4e5e909b9874 100644
--- a/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/zh_CN/element/string.json
+++ b/frameworks/com.ohos.permissionmanager/permissionmanager/src/main/resources/zh_CN/element/string.json
@@ -1,92 +1,92 @@
-{
-  "string": [
-    {
-      "name": "permissionmanager_desc",
-      "value": "权限管理"
-    },
-    {
-      "name": "MainAbility_desc",
-      "value": "从权限和应用两个维度来管理所有应用申请的权限。"
-    },
-    {
-      "name": "MainAbility_label",
-      "value": "权限管理"
-    },
-    {
-      "name": "no_permission",
-      "value": "暂无权限"
-    },
-    {
-      "name": "access_permission",
-      "value": "访问权限"
-    },
-    {
-      "name": "permission_access_record",
-      "value": "权限访问记录"
-    },
-    {
-      "name": "authority_management",
-      "value": "权限管理"
-    },
-    {
-      "name": "other_permissions",
-      "value": "其它权限"
-    },
-    {
-      "name": "application",
-      "value": "应用"
-    },
-    {
-      "name": "authority",
-      "value": "权限"
-    },
-    {
-      "name": "textInput_placeholder",
-      "value": "搜索应用"
-    },
-    {
-      "name": "allowed",
-      "value": "已允许"
-    },
-    {
-      "name": "banned",
-      "value": "已禁止"
-    },
-    {
-      "name": "Authorization_failed",
-      "value": "授权失败！"
-    },
-    {
-      "name": "reason_suffix",
-      "value": "等权限。"
-    },
-    {
-      "name": "separator",
-      "value": "、"
-    },
-    {
-      "name": "visits",
-      "value": "访问次数："
-    },
-    {
-      "name": "recent_visit",
-      "value": "；最近访问："
-    },
-    {
-      "name": "morning",
-      "value": "上午"
-    },
-    {
-      "name": "afternoon",
-      "value": "下午"
-    },
-    {
-      "name": "no_record",
-      "value": "没有权限访问记录"
-    },
-    {
-      "name": "record_time_limit",
-      "value": "近7天访问记录"
-    }
-  ]
+{
+  "string": [
+    {
+      "name": "permissionmanager_desc",
+      "value": "权限管理"
+    },
+    {
+      "name": "MainAbility_desc",
+      "value": "从权限和应用两个维度来管理所有应用申请的权限。"
+    },
+    {
+      "name": "MainAbility_label",
+      "value": "权限管理"
+    },
+    {
+      "name": "no_permission",
+      "value": "暂无权限"
+    },
+    {
+      "name": "access_permission",
+      "value": "访问权限"
+    },
+    {
+      "name": "permission_access_record",
+      "value": "权限访问记录"
+    },
+    {
+      "name": "authority_management",
+      "value": "权限管理"
+    },
+    {
+      "name": "other_permissions",
+      "value": "其它权限"
+    },
+    {
+      "name": "application",
+      "value": "应用"
+    },
+    {
+      "name": "authority",
+      "value": "权限"
+    },
+    {
+      "name": "textInput_placeholder",
+      "value": "搜索应用"
+    },
+    {
+      "name": "allowed",
+      "value": "已允许"
+    },
+    {
+      "name": "banned",
+      "value": "已禁止"
+    },
+    {
+      "name": "Authorization_failed",
+      "value": "授权失败！"
+    },
+    {
+      "name": "reason_suffix",
+      "value": "等权限。"
+    },
+    {
+      "name": "separator",
+      "value": "、"
+    },
+    {
+      "name": "visits",
+      "value": "访问次数："
+    },
+    {
+      "name": "recent_visit",
+      "value": "；最近访问："
+    },
+    {
+      "name": "morning",
+      "value": "上午"
+    },
+    {
+      "name": "afternoon",
+      "value": "下午"
+    },
+    {
+      "name": "no_record",
+      "value": "没有权限访问记录"
+    },
+    {
+      "name": "record_time_limit",
+      "value": "近7天访问记录"
+    }
+  ]
 }
\ No newline at end of file
diff --git a/frameworks/common/BUILD.gn b/frameworks/common/BUILD.gn
index 3970b261d89776d1a2f08aac024dc9bb01b47527..8293c0151697b1c91d3edd9b3f647d271e813235 100644
--- a/frameworks/common/BUILD.gn
+++ b/frameworks/common/BUILD.gn
@@ -1,48 +1,48 @@
-# Copyright (c) 2021-2022 Huawei Device Co., Ltd.
-# Licensed under the Apache License, Version 2.0 (the "License");
-# you may not use this file except in compliance with the License.
-# You may obtain a copy of the License at
-#
-#     http://www.apache.org/licenses/LICENSE-2.0
-#
-# Unless required by applicable law or agreed to in writing, software
-# distributed under the License is distributed on an "AS IS" BASIS,
-# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-# See the License for the specific language governing permissions and
-# limitations under the License.
-
-import("//build/ohos.gni")
-
-config("accesstoken_common_cxx_public_config") {
-  visibility = [ ":*" ]
-  include_dirs = [ "include" ]
-}
-
-ohos_shared_library("accesstoken_common_cxx") {
-  subsystem_name = "security"
-  part_name = "access_token"
-
-  public_configs = [ ":accesstoken_common_cxx_public_config" ]
-
-  include_dirs = [
-    "include",
-    "//utils/system/safwk/native/include",
-    "//third_party/mbedtls/include",
-    "//base/security/access_token/interfaces/innerkits/accesstoken/include",
-  ]
-
-  sources = [
-    "src/constant_common.cpp",
-    "src/data_validator.cpp",
-    "src/random_mbedtls.cpp",
-  ]
-
-  deps = [ "//third_party/mbedtls:mbedtls_shared" ]
-  external_deps = [
-    "c_utils:utils",
-    "hiviewdfx_hilog_native:libhilog",
-    "init:libbegetutil",
-  ]
-
-  cflags_cc = [ "-DHILOG_ENABLE" ]
-}
+# Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+# Licensed under the Apache License, Version 2.0 (the "License");
+# you may not use this file except in compliance with the License.
+# You may obtain a copy of the License at
+#
+#     http://www.apache.org/licenses/LICENSE-2.0
+#
+# Unless required by applicable law or agreed to in writing, software
+# distributed under the License is distributed on an "AS IS" BASIS,
+# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+# See the License for the specific language governing permissions and
+# limitations under the License.
+
+import("//build/ohos.gni")
+
+config("accesstoken_common_cxx_public_config") {
+  visibility = [ ":*" ]
+  include_dirs = [ "include" ]
+}
+
+ohos_shared_library("accesstoken_common_cxx") {
+  subsystem_name = "security"
+  part_name = "access_token"
+
+  public_configs = [ ":accesstoken_common_cxx_public_config" ]
+
+  include_dirs = [
+    "include",
+    "//utils/system/safwk/native/include",
+    "//third_party/mbedtls/include",
+    "//base/security/access_token/interfaces/innerkits/accesstoken/include",
+  ]
+
+  sources = [
+    "src/constant_common.cpp",
+    "src/data_validator.cpp",
+    "src/random_mbedtls.cpp",
+  ]
+
+  deps = [ "//third_party/mbedtls:mbedtls_shared" ]
+  external_deps = [
+    "c_utils:utils",
+    "hiviewdfx_hilog_native:libhilog",
+    "init:libbegetutil",
+  ]
+
+  cflags_cc = [ "-DHILOG_ENABLE" ]
+}
diff --git a/frameworks/common/include/accesstoken_log.h b/frameworks/common/include/accesstoken_log.h
index 8f0c43b2d1dc4585a0fe714402a889a446fb963e..5b4f940151483d9ea0e5d11ef77e8ebeeb81c1a4 100644
--- a/frameworks/common/include/accesstoken_log.h
+++ b/frameworks/common/include/accesstoken_log.h
@@ -1,69 +1,69 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef ACCESSTOKEN_LOG_H
-#define ACCESSTOKEN_LOG_H
-
-#ifdef HILOG_ENABLE
-
-#include "hilog/log.h"
-
-#ifndef __cplusplus
-
-#define ACCESSTOKEN_LOG_DEBUG(fmt, ...) HILOG_DEBUG(LOG_CORE, "[%{public}s]:" fmt, __func__, ##__VA_ARGS__)
-#define ACCESSTOKEN_LOG_INFO(fmt, ...) HILOG_INFO(LOG_CORE, "[%{public}s]:" fmt, __func__, ##__VA_ARGS__)
-#define ACCESSTOKEN_LOG_WARN(fmt, ...) HILOG_WARN(LOG_CORE, "[%{public}s]:" fmt, __func__, ##__VA_ARGS__)
-#define ACCESSTOKEN_LOG_ERROR(fmt, ...) HILOG_ERROR(LOG_CORE, "[%{public}s]:" fmt, __func__, ##__VA_ARGS__)
-#define ACCESSTOKEN_LOG_FATAL(fmt, ...) HILOG_FATAL(LOG_CORE, "[%{public}s]:" fmt, __func__, ##__VA_ARGS__)
-
-#else
-
-#define ACCESSTOKEN_LOG_DEBUG(label, fmt, ...) \
-    OHOS::HiviewDFX::HiLog::Debug(label, "[%{public}s]:" fmt, __func__, ##__VA_ARGS__)
-#define ACCESSTOKEN_LOG_INFO(label, fmt, ...) \
-    OHOS::HiviewDFX::HiLog::Info(label, "[%{public}s]:" fmt, __func__, ##__VA_ARGS__)
-#define ACCESSTOKEN_LOG_WARN(label, fmt, ...) \
-    OHOS::HiviewDFX::HiLog::Warn(label, "[%{public}s]:" fmt, __func__, ##__VA_ARGS__)
-#define ACCESSTOKEN_LOG_ERROR(label, fmt, ...) \
-    OHOS::HiviewDFX::HiLog::Error(label, "[%{public}s]:" fmt, __func__, ##__VA_ARGS__)
-#define ACCESSTOKEN_LOG_FATAL(label, fmt, ...) \
-    OHOS::HiviewDFX::HiLog::Fatal(label, "[%{public}s]:" fmt, __func__, ##__VA_ARGS__)
-
-#endif // __cplusplus
-
-/* define LOG_TAG as "security_*" at your submodule, * means your submodule name such as "security_dac" */
-#undef LOG_TAG
-#undef LOG_DOMAIN
-
-static constexpr unsigned int SECURITY_DOMAIN_ACCESSTOKEN = 0xD002F01;
-static constexpr unsigned int SECURITY_DOMAIN_PRIVACY = 0xD002F03;
-
-#else
-
-#include <stdarg.h>
-#include <stdio.h>
-
-/* define LOG_TAG as "security_*" at your submodule, * means your submodule name such as "security_dac" */
-#undef LOG_TAG
-
-#define ACCESSTOKEN_LOG_DEBUG(fmt, ...) printf("[%s] debug: %s: " fmt "\n", LOG_TAG, __func__, ##__VA_ARGS__)
-#define ACCESSTOKEN_LOG_INFO(fmt, ...) printf("[%s] info: %s: " fmt "\n", LOG_TAG, __func__, ##__VA_ARGS__)
-#define ACCESSTOKEN_LOG_WARN(fmt, ...) printf("[%s] warn: %s: " fmt "\n", LOG_TAG, __func__, ##__VA_ARGS__)
-#define ACCESSTOKEN_LOG_ERROR(fmt, ...) printf("[%s] error: %s: " fmt "\n", LOG_TAG, __func__, ##__VA_ARGS__)
-#define ACCESSTOKEN_LOG_FATAL(fmt, ...) printf("[%s] fatal: %s: " fmt "\n", LOG_TAG, __func__, ##__VA_ARGS__)
-
-#endif // HILOG_ENABLE
-
-#endif // ACCESSTOKEN_LOG_H
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef ACCESSTOKEN_LOG_H
+#define ACCESSTOKEN_LOG_H
+
+#ifdef HILOG_ENABLE
+
+#include "hilog/log.h"
+
+#ifndef __cplusplus
+
+#define ACCESSTOKEN_LOG_DEBUG(fmt, ...) HILOG_DEBUG(LOG_CORE, "[%{public}s]:" fmt, __func__, ##__VA_ARGS__)
+#define ACCESSTOKEN_LOG_INFO(fmt, ...) HILOG_INFO(LOG_CORE, "[%{public}s]:" fmt, __func__, ##__VA_ARGS__)
+#define ACCESSTOKEN_LOG_WARN(fmt, ...) HILOG_WARN(LOG_CORE, "[%{public}s]:" fmt, __func__, ##__VA_ARGS__)
+#define ACCESSTOKEN_LOG_ERROR(fmt, ...) HILOG_ERROR(LOG_CORE, "[%{public}s]:" fmt, __func__, ##__VA_ARGS__)
+#define ACCESSTOKEN_LOG_FATAL(fmt, ...) HILOG_FATAL(LOG_CORE, "[%{public}s]:" fmt, __func__, ##__VA_ARGS__)
+
+#else
+
+#define ACCESSTOKEN_LOG_DEBUG(label, fmt, ...) \
+    OHOS::HiviewDFX::HiLog::Debug(label, "[%{public}s]:" fmt, __func__, ##__VA_ARGS__)
+#define ACCESSTOKEN_LOG_INFO(label, fmt, ...) \
+    OHOS::HiviewDFX::HiLog::Info(label, "[%{public}s]:" fmt, __func__, ##__VA_ARGS__)
+#define ACCESSTOKEN_LOG_WARN(label, fmt, ...) \
+    OHOS::HiviewDFX::HiLog::Warn(label, "[%{public}s]:" fmt, __func__, ##__VA_ARGS__)
+#define ACCESSTOKEN_LOG_ERROR(label, fmt, ...) \
+    OHOS::HiviewDFX::HiLog::Error(label, "[%{public}s]:" fmt, __func__, ##__VA_ARGS__)
+#define ACCESSTOKEN_LOG_FATAL(label, fmt, ...) \
+    OHOS::HiviewDFX::HiLog::Fatal(label, "[%{public}s]:" fmt, __func__, ##__VA_ARGS__)
+
+#endif // __cplusplus
+
+/* define LOG_TAG as "security_*" at your submodule, * means your submodule name such as "security_dac" */
+#undef LOG_TAG
+#undef LOG_DOMAIN
+
+static constexpr unsigned int SECURITY_DOMAIN_ACCESSTOKEN = 0xD002F01;
+static constexpr unsigned int SECURITY_DOMAIN_PRIVACY = 0xD002F03;
+
+#else
+
+#include <stdarg.h>
+#include <stdio.h>
+
+/* define LOG_TAG as "security_*" at your submodule, * means your submodule name such as "security_dac" */
+#undef LOG_TAG
+
+#define ACCESSTOKEN_LOG_DEBUG(fmt, ...) printf("[%s] debug: %s: " fmt "\n", LOG_TAG, __func__, ##__VA_ARGS__)
+#define ACCESSTOKEN_LOG_INFO(fmt, ...) printf("[%s] info: %s: " fmt "\n", LOG_TAG, __func__, ##__VA_ARGS__)
+#define ACCESSTOKEN_LOG_WARN(fmt, ...) printf("[%s] warn: %s: " fmt "\n", LOG_TAG, __func__, ##__VA_ARGS__)
+#define ACCESSTOKEN_LOG_ERROR(fmt, ...) printf("[%s] error: %s: " fmt "\n", LOG_TAG, __func__, ##__VA_ARGS__)
+#define ACCESSTOKEN_LOG_FATAL(fmt, ...) printf("[%s] fatal: %s: " fmt "\n", LOG_TAG, __func__, ##__VA_ARGS__)
+
+#endif // HILOG_ENABLE
+
+#endif // ACCESSTOKEN_LOG_H
diff --git a/frameworks/common/include/constant_common.h b/frameworks/common/include/constant_common.h
index 8651f5d4e77c956572bfb92bd1cbb4c724d6fc9e..b533824a5141207673523992551b8743266e4935 100644
--- a/frameworks/common/include/constant_common.h
+++ b/frameworks/common/include/constant_common.h
@@ -1,44 +1,44 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-#ifndef FRAMEWORK_CONSTANT_COMMON_H
-#define FRAMEWORK_CONSTANT_COMMON_H
-
-#include <algorithm>
-#include <iosfwd>
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class ConstantCommon {
-public:
-    /**
-     * Device id length.
-     */
-    const static int32_t DEVICE_UUID_LENGTH = 65;
-    static constexpr int32_t MINDEVICEIDLEN = 8;
-    static constexpr int32_t ENCRYPTLEN = 4;
-    static constexpr int32_t ENCRYPTBEGIN = 0;
-    static constexpr int32_t ENCRYPTEND = 3;
-    static std::string EncryptDevId(std::string deviceId);
-
-    /**
-     * GetLocalDeviceId
-     */
-    static std::string GetLocalDeviceId();
-};
-}
-}
-}
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+#ifndef FRAMEWORK_CONSTANT_COMMON_H
+#define FRAMEWORK_CONSTANT_COMMON_H
+
+#include <algorithm>
+#include <iosfwd>
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class ConstantCommon {
+public:
+    /**
+     * Device id length.
+     */
+    const static int32_t DEVICE_UUID_LENGTH = 65;
+    static constexpr int32_t MINDEVICEIDLEN = 8;
+    static constexpr int32_t ENCRYPTLEN = 4;
+    static constexpr int32_t ENCRYPTBEGIN = 0;
+    static constexpr int32_t ENCRYPTEND = 3;
+    static std::string EncryptDevId(std::string deviceId);
+
+    /**
+     * GetLocalDeviceId
+     */
+    static std::string GetLocalDeviceId();
+};
+}
+}
+}
 #endif
\ No newline at end of file
diff --git a/frameworks/common/include/data_validator.h b/frameworks/common/include/data_validator.h
index bea3c582a507a6ff1b77d669a0e34fcfa424df0f..334dfeb37c2bdb649d2a5d1d06e9a58bb0edb8fd 100644
--- a/frameworks/common/include/data_validator.h
+++ b/frameworks/common/include/data_validator.h
@@ -1,59 +1,59 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef DATA_VALIDATOR_H
-#define DATA_VALIDATOR_H
-
-#include <string>
-#include "access_token.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class DataValidator final {
-public:
-    static bool IsBundleNameValid(const std::string& bundleName);
-
-    static bool IsPermissionNameValid(const std::string& permissionName);
-
-    static bool IsUserIdValid(const int userId);
-
-    static bool IsAppIDDescValid(const std::string& appIDDesc);
-
-    static bool IsDomainValid(const std::string& domain);
-
-    static bool IsAplNumValid(const int apl);
-
-    static bool IsProcessNameValid(const std::string& processName);
-
-    static bool IsDeviceIdValid(const std::string& deviceId);
-
-    static bool IsLabelValid(const std::string& label);
-
-    static bool IsDescValid(const std::string& desc);
-    static bool IsPermissionFlagValid(int flag);
-    static bool IsDcapValid(const std::string& dcap);
-    static bool IsTokenIDValid(AccessTokenID id);
-    static bool IsDlpTypeValid(int dlpType);
-
-private:
-    const static int MAX_LENGTH = 256;
-    const static int MAX_APPIDDESC_LENGTH = 10240;
-    const static int MAX_DCAP_LENGTH = 1024;
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-#endif // DATA_VALIDATOR_H
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef DATA_VALIDATOR_H
+#define DATA_VALIDATOR_H
+
+#include <string>
+#include "access_token.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class DataValidator final {
+public:
+    static bool IsBundleNameValid(const std::string& bundleName);
+
+    static bool IsPermissionNameValid(const std::string& permissionName);
+
+    static bool IsUserIdValid(const int userId);
+
+    static bool IsAppIDDescValid(const std::string& appIDDesc);
+
+    static bool IsDomainValid(const std::string& domain);
+
+    static bool IsAplNumValid(const int apl);
+
+    static bool IsProcessNameValid(const std::string& processName);
+
+    static bool IsDeviceIdValid(const std::string& deviceId);
+
+    static bool IsLabelValid(const std::string& label);
+
+    static bool IsDescValid(const std::string& desc);
+    static bool IsPermissionFlagValid(int flag);
+    static bool IsDcapValid(const std::string& dcap);
+    static bool IsTokenIDValid(AccessTokenID id);
+    static bool IsDlpTypeValid(int dlpType);
+
+private:
+    const static int MAX_LENGTH = 256;
+    const static int MAX_APPIDDESC_LENGTH = 10240;
+    const static int MAX_DCAP_LENGTH = 1024;
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+#endif // DATA_VALIDATOR_H
diff --git a/frameworks/common/include/parcel_utils.h b/frameworks/common/include/parcel_utils.h
index d6b7e8b6b56f3dbc7133fad4555428a10f0d36d9..512a2a60b132ff3375b8ad0d984bc9e56b4cdcdc 100644
--- a/frameworks/common/include/parcel_utils.h
+++ b/frameworks/common/include/parcel_utils.h
@@ -1,38 +1,38 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef PARCEL_UTILS_H
-#define PARCEL_UTILS_H
-#define MAX_PERMLIST_SIZE 256
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-#define RETURN_IF_FALSE(expr) \
-    if (!(expr)) { \
-        return false; \
-    }
-
-#define RELEASE_IF_FALSE(expr, obj) \
-    if (!(expr)) { \
-        if ((obj) != nullptr) { \
-            delete (obj); \
-            (obj) = nullptr; \
-        } \
-        return (obj); \
-    }
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-#endif // PARCEL_UTILS_H
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef PARCEL_UTILS_H
+#define PARCEL_UTILS_H
+#define MAX_PERMLIST_SIZE 256
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+#define RETURN_IF_FALSE(expr) \
+    if (!(expr)) { \
+        return false; \
+    }
+
+#define RELEASE_IF_FALSE(expr, obj) \
+    if (!(expr)) { \
+        if ((obj) != nullptr) { \
+            delete (obj); \
+            (obj) = nullptr; \
+        } \
+        return (obj); \
+    }
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+#endif // PARCEL_UTILS_H
diff --git a/frameworks/common/include/random.h b/frameworks/common/include/random.h
index 29d2e637ff8e56ddeba6f5f1319e3df828a35593..ddb1b54a28f0794d78518f35a3890ba858a221c6 100644
--- a/frameworks/common/include/random.h
+++ b/frameworks/common/include/random.h
@@ -1,32 +1,32 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef ACCESSTOKEN_RANDOM_H
-#define ACCESSTOKEN_RANDOM_H
-
-#ifdef __cplusplus
-#if __cplusplus
-extern "C" {
-#endif
-#endif
-
-unsigned int GetRandomUint32(void);
-
-#ifdef __cplusplus
-#if __cplusplus
-}
-#endif /* __cplusplus */
-#endif /* __cplusplus */
-#endif /* ACCESSTOKEN_RANDOM_H */
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef ACCESSTOKEN_RANDOM_H
+#define ACCESSTOKEN_RANDOM_H
+
+#ifdef __cplusplus
+#if __cplusplus
+extern "C" {
+#endif
+#endif
+
+unsigned int GetRandomUint32(void);
+
+#ifdef __cplusplus
+#if __cplusplus
+}
+#endif /* __cplusplus */
+#endif /* __cplusplus */
+#endif /* ACCESSTOKEN_RANDOM_H */
diff --git a/frameworks/common/include/random_mbedtls.h b/frameworks/common/include/random_mbedtls.h
index d9461c734a277e015371d2a74d51e979fb75ec27..7faf53e7fcad41ea7274376b96b9d7afad0dd68b 100644
--- a/frameworks/common/include/random_mbedtls.h
+++ b/frameworks/common/include/random_mbedtls.h
@@ -1,43 +1,43 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef ACCESS_TOKEN_RANDOM_MBEDTLS
-#define ACCESS_TOKEN_RANDOM_MBEDTLS
-
-#include "rwlock.h"
-#include "mbedtls/ctr_drbg.h"
-#include "mbedtls/entropy.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class RandomMbedtls {
-public:
-    static RandomMbedtls& GetInstance();
-    int GenerateRandomArray(unsigned char *randStr, unsigned int len);
-    ~RandomMbedtls() {}
-    static unsigned int GetRandomUint32();
-
-private:
-    RandomMbedtls() : initFlag_(false) {}
-    mbedtls_entropy_context entropy_;
-    mbedtls_ctr_drbg_context ctrDrbg_;
-    OHOS::Utils::RWLock randomLock_;
-    bool initFlag_;
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-#endif // ACCESS_TOKEN_RANDOM_MBEDTLS
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef ACCESS_TOKEN_RANDOM_MBEDTLS
+#define ACCESS_TOKEN_RANDOM_MBEDTLS
+
+#include "rwlock.h"
+#include "mbedtls/ctr_drbg.h"
+#include "mbedtls/entropy.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class RandomMbedtls {
+public:
+    static RandomMbedtls& GetInstance();
+    int GenerateRandomArray(unsigned char *randStr, unsigned int len);
+    ~RandomMbedtls() {}
+    static unsigned int GetRandomUint32();
+
+private:
+    RandomMbedtls() : initFlag_(false) {}
+    mbedtls_entropy_context entropy_;
+    mbedtls_ctr_drbg_context ctrDrbg_;
+    OHOS::Utils::RWLock randomLock_;
+    bool initFlag_;
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+#endif // ACCESS_TOKEN_RANDOM_MBEDTLS
diff --git a/frameworks/common/src/constant_common.cpp b/frameworks/common/src/constant_common.cpp
index 736a66ce0f070143bc4f4840f37a0d1923243807..36e1123c1fd90458cd5bc886d1906e27bdf19c5e 100644
--- a/frameworks/common/src/constant_common.cpp
+++ b/frameworks/common/src/constant_common.cpp
@@ -1,56 +1,56 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "constant_common.h"
-#include <string>
-#include "parameter.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-namespace {
-static const std::string REPLACE_TARGET = "****";
-static const std::string REPLACE_TARGET_LESS_THAN_MINLEN = "*******";
-} // namespace
-std::string ConstantCommon::EncryptDevId(std::string deviceId)
-{
-    std::string result = deviceId;
-    if (deviceId.empty()) {
-        return result;
-    }
-    if (deviceId.size() > MINDEVICEIDLEN) {
-        result.replace(ENCRYPTBEGIN + ENCRYPTLEN, deviceId.size() - MINDEVICEIDLEN, REPLACE_TARGET);
-    } else {
-        result.replace(ENCRYPTBEGIN + 1, deviceId.size()-1, REPLACE_TARGET_LESS_THAN_MINLEN);
-    }
-    return result;
-}
-
-std::string ConstantCommon::GetLocalDeviceId()
-{
-    static std::string localDeviceId;
-    if (!localDeviceId.empty()) {
-        return localDeviceId;
-    }
-    const int32_t DEVICE_UUID_LENGTH = 65;
-    char udid[DEVICE_UUID_LENGTH] = {0};
-    if (GetDevUdid(udid, DEVICE_UUID_LENGTH) == 0) {
-        localDeviceId = udid;
-    }
-    return localDeviceId;
-}
-} // namespace AccessToken
-} // namespace Security
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "constant_common.h"
+#include <string>
+#include "parameter.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+namespace {
+static const std::string REPLACE_TARGET = "****";
+static const std::string REPLACE_TARGET_LESS_THAN_MINLEN = "*******";
+} // namespace
+std::string ConstantCommon::EncryptDevId(std::string deviceId)
+{
+    std::string result = deviceId;
+    if (deviceId.empty()) {
+        return result;
+    }
+    if (deviceId.size() > MINDEVICEIDLEN) {
+        result.replace(ENCRYPTBEGIN + ENCRYPTLEN, deviceId.size() - MINDEVICEIDLEN, REPLACE_TARGET);
+    } else {
+        result.replace(ENCRYPTBEGIN + 1, deviceId.size()-1, REPLACE_TARGET_LESS_THAN_MINLEN);
+    }
+    return result;
+}
+
+std::string ConstantCommon::GetLocalDeviceId()
+{
+    static std::string localDeviceId;
+    if (!localDeviceId.empty()) {
+        return localDeviceId;
+    }
+    const int32_t DEVICE_UUID_LENGTH = 65;
+    char udid[DEVICE_UUID_LENGTH] = {0};
+    if (GetDevUdid(udid, DEVICE_UUID_LENGTH) == 0) {
+        localDeviceId = udid;
+    }
+    return localDeviceId;
+}
+} // namespace AccessToken
+} // namespace Security
 } // namespace OHOS
\ No newline at end of file
diff --git a/frameworks/common/src/data_validator.cpp b/frameworks/common/src/data_validator.cpp
index 80fde5efa0d466653c23ab75670c0b8e6342378d..95422a586124602a58c284ca8b3383adb0624510 100644
--- a/frameworks/common/src/data_validator.cpp
+++ b/frameworks/common/src/data_validator.cpp
@@ -1,99 +1,99 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "data_validator.h"
-#include "access_token.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-bool DataValidator::IsBundleNameValid(const std::string& bundleName)
-{
-    return !bundleName.empty() && (bundleName.length() <= MAX_LENGTH);
-}
-
-bool DataValidator::IsLabelValid(const std::string& label)
-{
-    return label.length() <= MAX_LENGTH;
-}
-
-bool DataValidator::IsDescValid(const std::string& desc)
-{
-    return desc.length() <= MAX_LENGTH;
-}
-
-bool DataValidator::IsPermissionNameValid(const std::string& permissionName)
-{
-    return !permissionName.empty() && (permissionName.length() <= MAX_LENGTH);
-}
-
-bool DataValidator::IsUserIdValid(const int userId)
-{
-    return userId >= 0;
-}
-
-bool DataValidator::IsAppIDDescValid(const std::string& appIDDesc)
-{
-    return !appIDDesc.empty() && (appIDDesc.length() <= MAX_APPIDDESC_LENGTH);
-}
-
-bool DataValidator::IsDomainValid(const std::string& domain)
-{
-    return !domain.empty() && (domain.length() <= MAX_LENGTH);
-}
-
-bool DataValidator::IsAplNumValid(const int apl)
-{
-    return (apl == APL_NORMAL || apl == APL_SYSTEM_BASIC || apl == APL_SYSTEM_CORE);
-}
-
-bool DataValidator::IsProcessNameValid(const std::string& processName)
-{
-    return !processName.empty() && (processName.length() <= MAX_LENGTH);
-}
-
-bool DataValidator::IsDeviceIdValid(const std::string& deviceId)
-{
-    return !deviceId.empty() && (deviceId.length() <= MAX_LENGTH);
-}
-
-bool DataValidator::IsDcapValid(const std::string& dcap)
-{
-    return !dcap.empty() && (dcap.length() <= MAX_DCAP_LENGTH);
-}
-
-bool DataValidator::IsPermissionFlagValid(int flag)
-{
-    uint32_t unmaskedFlag =
-        static_cast<uint32_t>(flag) & (~PermissionFlag::PERMISSION_GRANTED_BY_POLICY);
-
-    return unmaskedFlag == PermissionFlag::PERMISSION_DEFAULT_FLAG ||
-    unmaskedFlag == PermissionFlag::PERMISSION_USER_SET ||
-    unmaskedFlag == PermissionFlag::PERMISSION_USER_FIXED ||
-    unmaskedFlag == PermissionFlag::PERMISSION_SYSTEM_FIXED;
-}
-
-bool DataValidator::IsTokenIDValid(AccessTokenID id)
-{
-    return id != 0;
-}
-
-bool DataValidator::IsDlpTypeValid(int dlpType)
-{
-    return ((dlpType == DLP_COMMON) || (dlpType == DLP_READ) || (dlpType == DLP_FULL_CONTROL));
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "data_validator.h"
+#include "access_token.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+bool DataValidator::IsBundleNameValid(const std::string& bundleName)
+{
+    return !bundleName.empty() && (bundleName.length() <= MAX_LENGTH);
+}
+
+bool DataValidator::IsLabelValid(const std::string& label)
+{
+    return label.length() <= MAX_LENGTH;
+}
+
+bool DataValidator::IsDescValid(const std::string& desc)
+{
+    return desc.length() <= MAX_LENGTH;
+}
+
+bool DataValidator::IsPermissionNameValid(const std::string& permissionName)
+{
+    return !permissionName.empty() && (permissionName.length() <= MAX_LENGTH);
+}
+
+bool DataValidator::IsUserIdValid(const int userId)
+{
+    return userId >= 0;
+}
+
+bool DataValidator::IsAppIDDescValid(const std::string& appIDDesc)
+{
+    return !appIDDesc.empty() && (appIDDesc.length() <= MAX_APPIDDESC_LENGTH);
+}
+
+bool DataValidator::IsDomainValid(const std::string& domain)
+{
+    return !domain.empty() && (domain.length() <= MAX_LENGTH);
+}
+
+bool DataValidator::IsAplNumValid(const int apl)
+{
+    return (apl == APL_NORMAL || apl == APL_SYSTEM_BASIC || apl == APL_SYSTEM_CORE);
+}
+
+bool DataValidator::IsProcessNameValid(const std::string& processName)
+{
+    return !processName.empty() && (processName.length() <= MAX_LENGTH);
+}
+
+bool DataValidator::IsDeviceIdValid(const std::string& deviceId)
+{
+    return !deviceId.empty() && (deviceId.length() <= MAX_LENGTH);
+}
+
+bool DataValidator::IsDcapValid(const std::string& dcap)
+{
+    return !dcap.empty() && (dcap.length() <= MAX_DCAP_LENGTH);
+}
+
+bool DataValidator::IsPermissionFlagValid(int flag)
+{
+    uint32_t unmaskedFlag =
+        static_cast<uint32_t>(flag) & (~PermissionFlag::PERMISSION_GRANTED_BY_POLICY);
+
+    return unmaskedFlag == PermissionFlag::PERMISSION_DEFAULT_FLAG ||
+    unmaskedFlag == PermissionFlag::PERMISSION_USER_SET ||
+    unmaskedFlag == PermissionFlag::PERMISSION_USER_FIXED ||
+    unmaskedFlag == PermissionFlag::PERMISSION_SYSTEM_FIXED;
+}
+
+bool DataValidator::IsTokenIDValid(AccessTokenID id)
+{
+    return id != 0;
+}
+
+bool DataValidator::IsDlpTypeValid(int dlpType)
+{
+    return ((dlpType == DLP_COMMON) || (dlpType == DLP_READ) || (dlpType == DLP_FULL_CONTROL));
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/frameworks/common/src/random_mbedtls.cpp b/frameworks/common/src/random_mbedtls.cpp
index 1a6ad4013f32d63d3f96f7412bbe802cd98c426a..aa58074ef94a823c9f3f6949c71c7170f35048e9 100644
--- a/frameworks/common/src/random_mbedtls.cpp
+++ b/frameworks/common/src/random_mbedtls.cpp
@@ -1,67 +1,67 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "random_mbedtls.h"
-#include "access_token.h"
-
-using OHOS::Security::AccessToken::RandomMbedtls;
-using OHOS::Security::AccessToken::RET_SUCCESS;
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-extern "C" unsigned int GetRandomUint32()
-{
-    unsigned int rand;
-    int ret = RandomMbedtls::GetInstance().GenerateRandomArray((unsigned char *)&rand, sizeof(rand));
-    if (ret != RET_SUCCESS) {
-        return 0;
-    }
-    return rand;
-}
-
-int RandomMbedtls::GenerateRandomArray(unsigned char *randStr, unsigned int len)
-{
-    if (randStr == nullptr || len == 0) {
-        return RET_FAILED;
-    }
-    int ret;
-
-    Utils::UniqueWriteGuard<Utils::RWLock> infoGuard(this->randomLock_);
-    if (!initFlag_) {
-        mbedtls_ctr_drbg_init(&ctrDrbg_);
-        mbedtls_entropy_init(&entropy_);
-        ret = mbedtls_ctr_drbg_seed(&ctrDrbg_, mbedtls_entropy_func, &entropy_, NULL, 0);
-        if (ret != 0) {
-            return RET_FAILED;
-        }
-        initFlag_ = true;
-    }
-
-    ret = mbedtls_ctr_drbg_random(&ctrDrbg_, randStr, len);
-    if (ret != 0) {
-        return RET_FAILED;
-    }
-    return RET_SUCCESS;
-}
-
-RandomMbedtls& RandomMbedtls::GetInstance()
-{
-    static RandomMbedtls instance;
-    return instance;
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "random_mbedtls.h"
+#include "access_token.h"
+
+using OHOS::Security::AccessToken::RandomMbedtls;
+using OHOS::Security::AccessToken::RET_SUCCESS;
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+extern "C" unsigned int GetRandomUint32()
+{
+    unsigned int rand;
+    int ret = RandomMbedtls::GetInstance().GenerateRandomArray((unsigned char *)&rand, sizeof(rand));
+    if (ret != RET_SUCCESS) {
+        return 0;
+    }
+    return rand;
+}
+
+int RandomMbedtls::GenerateRandomArray(unsigned char *randStr, unsigned int len)
+{
+    if (randStr == nullptr || len == 0) {
+        return RET_FAILED;
+    }
+    int ret;
+
+    Utils::UniqueWriteGuard<Utils::RWLock> infoGuard(this->randomLock_);
+    if (!initFlag_) {
+        mbedtls_ctr_drbg_init(&ctrDrbg_);
+        mbedtls_entropy_init(&entropy_);
+        ret = mbedtls_ctr_drbg_seed(&ctrDrbg_, mbedtls_entropy_func, &entropy_, NULL, 0);
+        if (ret != 0) {
+            return RET_FAILED;
+        }
+        initFlag_ = true;
+    }
+
+    ret = mbedtls_ctr_drbg_random(&ctrDrbg_, randStr, len);
+    if (ret != 0) {
+        return RET_FAILED;
+    }
+    return RET_SUCCESS;
+}
+
+RandomMbedtls& RandomMbedtls::GetInstance()
+{
+    static RandomMbedtls instance;
+    return instance;
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/frameworks/privacy/BUILD.gn b/frameworks/privacy/BUILD.gn
index e721025514c3b6b9cb4139b702574334541bf9f7..70f65f8e5b8fc27deabab8373f4c14e4668c46a6 100644
--- a/frameworks/privacy/BUILD.gn
+++ b/frameworks/privacy/BUILD.gn
@@ -1,41 +1,41 @@
-# Copyright (c) 2022 Huawei Device Co., Ltd.
-# Licensed under the Apache License, Version 2.0 (the "License");
-# you may not use this file except in compliance with the License.
-# You may obtain a copy of the License at
-#
-#     http://www.apache.org/licenses/LICENSE-2.0
-#
-# Unless required by applicable law or agreed to in writing, software
-# distributed under the License is distributed on an "AS IS" BASIS,
-# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-# See the License for the specific language governing permissions and
-# limitations under the License.
-
-import("//build/ohos.gni")
-
-ohos_shared_library("privacy_communication_adapter_cxx") {
-  subsystem_name = "security"
-  part_name = "access_token"
-
-  include_dirs = [
-    "include",
-    "//base/security/access_token/interfaces/innerkits/accesstoken/include",
-    "//base/security/access_token/interfaces/innerkits/privacy/include",
-    "//base/security/access_token/frameworks/common/include",
-    "//commonlibrary/c_utils/base/include",
-  ]
-
-  sources = [
-    "src/bundle_used_record_parcel.cpp",
-    "src/perm_active_response_parcel.cpp",
-    "src/permission_used_record_parcel.cpp",
-    "src/permission_used_request_parcel.cpp",
-    "src/permission_used_result_parcel.cpp",
-    "src/used_record_detail_parcel.cpp",
-  ]
-
-  external_deps = [
-    "c_utils:utils",
-    "ipc:ipc_core",
-  ]
-}
+# Copyright (c) 2022 Huawei Device Co., Ltd.
+# Licensed under the Apache License, Version 2.0 (the "License");
+# you may not use this file except in compliance with the License.
+# You may obtain a copy of the License at
+#
+#     http://www.apache.org/licenses/LICENSE-2.0
+#
+# Unless required by applicable law or agreed to in writing, software
+# distributed under the License is distributed on an "AS IS" BASIS,
+# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+# See the License for the specific language governing permissions and
+# limitations under the License.
+
+import("//build/ohos.gni")
+
+ohos_shared_library("privacy_communication_adapter_cxx") {
+  subsystem_name = "security"
+  part_name = "access_token"
+
+  include_dirs = [
+    "include",
+    "//base/security/access_token/interfaces/innerkits/accesstoken/include",
+    "//base/security/access_token/interfaces/innerkits/privacy/include",
+    "//base/security/access_token/frameworks/common/include",
+    "//commonlibrary/c_utils/base/include",
+  ]
+
+  sources = [
+    "src/bundle_used_record_parcel.cpp",
+    "src/perm_active_response_parcel.cpp",
+    "src/permission_used_record_parcel.cpp",
+    "src/permission_used_request_parcel.cpp",
+    "src/permission_used_result_parcel.cpp",
+    "src/used_record_detail_parcel.cpp",
+  ]
+
+  external_deps = [
+    "c_utils:utils",
+    "ipc:ipc_core",
+  ]
+}
diff --git a/frameworks/privacy/include/bundle_used_record_parcel.h b/frameworks/privacy/include/bundle_used_record_parcel.h
index d94e185e86e65f7a561fd076ea9ca403450d75ae..aeeb8488b1d721b701b622493bf0a25e16f857b8 100644
--- a/frameworks/privacy/include/bundle_used_record_parcel.h
+++ b/frameworks/privacy/include/bundle_used_record_parcel.h
@@ -1,40 +1,40 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef BUNDLE_USED_RECORD_PARCEL_H
-#define BUNDLE_USED_RECORD_PARCEL_H
-
-#include "parcel.h"
-#include "permission_used_result.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-struct BundleUsedRecordParcel final : public Parcelable {
-    BundleUsedRecordParcel() = default;
-
-    ~BundleUsedRecordParcel() override = default;
-
-    bool Marshalling(Parcel& out) const override;
-
-    static BundleUsedRecordParcel* Unmarshalling(Parcel& in);
-
-    BundleUsedRecord bundleRecord;
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-
-#endif // BUNDLE_USED_RECORD_PARCEL_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef BUNDLE_USED_RECORD_PARCEL_H
+#define BUNDLE_USED_RECORD_PARCEL_H
+
+#include "parcel.h"
+#include "permission_used_result.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+struct BundleUsedRecordParcel final : public Parcelable {
+    BundleUsedRecordParcel() = default;
+
+    ~BundleUsedRecordParcel() override = default;
+
+    bool Marshalling(Parcel& out) const override;
+
+    static BundleUsedRecordParcel* Unmarshalling(Parcel& in);
+
+    BundleUsedRecord bundleRecord;
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+
+#endif // BUNDLE_USED_RECORD_PARCEL_H
diff --git a/frameworks/privacy/include/i_privacy_manager.h b/frameworks/privacy/include/i_privacy_manager.h
index ff8bebda82f39a273b4e9568985444c7b3d7800f..3d2646e6f4de1390f2e676b9edb910b24fae9dd1 100644
--- a/frameworks/privacy/include/i_privacy_manager.h
+++ b/frameworks/privacy/include/i_privacy_manager.h
@@ -1,67 +1,70 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef I_PRIVACY_MANAGER_H
-#define I_PRIVACY_MANAGER_H
-
-#include <string>
-
-#include "access_token.h"
-#include "errors.h"
-#include "iremote_broker.h"
-
-#include "on_permission_used_record_callback.h"
-#include "permission_used_request_parcel.h"
-#include "permission_used_result_parcel.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class IPrivacyManager : public IRemoteBroker {
-public:
-    static const int32_t SA_ID_PRIVACY_MANAGER_SERVICE = 3505;
-
-    DECLARE_INTERFACE_DESCRIPTOR(u"ohos.security.accesstoken.IPrivacyManager");
-
-    virtual int32_t AddPermissionUsedRecord(
-        AccessTokenID tokenID, const std::string& permissionName, int32_t successCount, int32_t failCount) = 0;
-    virtual int32_t StartUsingPermission(AccessTokenID tokenID, const std::string& permissionName) = 0;
-    virtual int32_t StopUsingPermission(AccessTokenID tokenID, const std::string& permissionName) = 0;
-    virtual int32_t RemovePermissionUsedRecords(AccessTokenID tokenID, const std::string& deviceID) = 0;
-    virtual int32_t GetPermissionUsedRecords(
-        const PermissionUsedRequestParcel& request, PermissionUsedResultParcel& result) = 0;
-    virtual int32_t GetPermissionUsedRecords(
-        const PermissionUsedRequestParcel& request, const sptr<OnPermissionUsedRecordCallback>& callback) = 0;
-    virtual std::string DumpRecordInfo(AccessTokenID tokenID, const std::string& permissionName) = 0;
-    virtual int32_t RegisterPermActiveStatusCallback(
-        std::vector<std::string>& permList, const sptr<IRemoteObject>& callback) = 0;
-    virtual int32_t UnRegisterPermActiveStatusCallback(const sptr<IRemoteObject>& callback) = 0;
-    enum class InterfaceCode {
-        ADD_PERMISSION_USED_RECORD = 0xf001,
-        START_USING_PERMISSION = 0xf002,
-        STOP_USING_PERMISSION = 0xf003,
-        DELETE_PERMISSION_USED_RECORDS = 0xf004,
-        GET_PERMISSION_USED_RECORDS = 0xf005,
-        GET_PERMISSION_USED_RECORDS_ASYNC = 0xf006,
-        DUMP_RECORD_INFO = 0xf007,
-        REGISTER_PERM_ACTIVE_STATUS_CHANGE_CALLBACK = 0xf008,
-        UNREGISTER_PERM_ACTIVE_STATUS_CHANGE_CALLBACK = 0xf009,
-    };
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-
-#endif // I_PRIVACY_MANAGER_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef I_PRIVACY_MANAGER_H
+#define I_PRIVACY_MANAGER_H
+
+#include <string>
+
+#include "access_token.h"
+#include "errors.h"
+#include "iremote_broker.h"
+
+#include "on_permission_used_record_callback.h"
+#include "permission_used_request_parcel.h"
+#include "permission_used_result_parcel.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class IPrivacyManager : public IRemoteBroker {
+public:
+    static const int32_t SA_ID_PRIVACY_MANAGER_SERVICE = 3505;
+
+    DECLARE_INTERFACE_DESCRIPTOR(u"ohos.security.accesstoken.IPrivacyManager");
+
+    virtual int32_t AddPermissionUsedRecord(
+        AccessTokenID tokenID, const std::string& permissionName, int32_t successCount, int32_t failCount) = 0;
+    virtual int32_t StartUsingPermission(AccessTokenID tokenID, const std::string& permissionName) = 0;
+    virtual int32_t StopUsingPermission(AccessTokenID tokenID, const std::string& permissionName) = 0;
+    virtual int32_t RemovePermissionUsedRecords(AccessTokenID tokenID, const std::string& deviceID) = 0;
+    virtual int32_t GetPermissionUsedRecords(
+        const PermissionUsedRequestParcel& request, PermissionUsedResultParcel& result) = 0;
+    virtual int32_t GetPermissionUsedRecords(
+        const PermissionUsedRequestParcel& request, const sptr<OnPermissionUsedRecordCallback>& callback) = 0;
+    virtual std::string DumpRecordInfo(AccessTokenID tokenID, const std::string& permissionName) = 0;
+    virtual int32_t RegisterPermActiveStatusCallback(
+        std::vector<std::string>& permList, const sptr<IRemoteObject>& callback) = 0;
+    virtual int32_t UnRegisterPermActiveStatusCallback(const sptr<IRemoteObject>& callback) = 0;
+    virtual bool IsAllowUsingPermission(AccessTokenID tokenID, const std::string& permissionName) = 0;
+    
+    enum class InterfaceCode {
+        ADD_PERMISSION_USED_RECORD = 0xf001,
+        START_USING_PERMISSION = 0xf002,
+        STOP_USING_PERMISSION = 0xf003,
+        DELETE_PERMISSION_USED_RECORDS = 0xf004,
+        GET_PERMISSION_USED_RECORDS = 0xf005,
+        GET_PERMISSION_USED_RECORDS_ASYNC = 0xf006,
+        DUMP_RECORD_INFO = 0xf007,
+        REGISTER_PERM_ACTIVE_STATUS_CHANGE_CALLBACK = 0xf008,
+        UNREGISTER_PERM_ACTIVE_STATUS_CHANGE_CALLBACK = 0xf009,
+        IS_ALLOW_USING_PERMISSION = 0xf010,
+    };
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+
+#endif // I_PRIVACY_MANAGER_H
diff --git a/frameworks/privacy/include/perm_active_response_parcel.h b/frameworks/privacy/include/perm_active_response_parcel.h
index 706d9fa4bde0eedb5f98d2457ce4ea5248cfc420..66187ea77f63c64a19cbc23525453a9b96d17e34 100644
--- a/frameworks/privacy/include/perm_active_response_parcel.h
+++ b/frameworks/privacy/include/perm_active_response_parcel.h
@@ -1,40 +1,40 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef PERM_ACTIVE_RESPONES_PARCEL_H
-#define PERM_ACTIVE_RESPONES_PARCEL_H
-
-#include "active_change_response_info.h"
-#include "parcel.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-struct ActiveChangeResponseParcel final : public Parcelable {
-    ActiveChangeResponseParcel() = default;
-
-    ~ActiveChangeResponseParcel() override = default;
-
-    bool Marshalling(Parcel& out) const override;
-
-    static ActiveChangeResponseParcel* Unmarshalling(Parcel& in);
-
-    ActiveChangeResponse changeResponse;
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-
-#endif // PERM_ACTIVE_RESPONES_PARCEL_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef PERM_ACTIVE_RESPONES_PARCEL_H
+#define PERM_ACTIVE_RESPONES_PARCEL_H
+
+#include "active_change_response_info.h"
+#include "parcel.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+struct ActiveChangeResponseParcel final : public Parcelable {
+    ActiveChangeResponseParcel() = default;
+
+    ~ActiveChangeResponseParcel() override = default;
+
+    bool Marshalling(Parcel& out) const override;
+
+    static ActiveChangeResponseParcel* Unmarshalling(Parcel& in);
+
+    ActiveChangeResponse changeResponse;
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+
+#endif // PERM_ACTIVE_RESPONES_PARCEL_H
diff --git a/frameworks/privacy/include/permission_used_record_parcel.h b/frameworks/privacy/include/permission_used_record_parcel.h
index c2a24dcce5c50f2be0e00e5ccead0008ea070193..ac805c04355b805ed4bd020029390fdaffde6ec5 100644
--- a/frameworks/privacy/include/permission_used_record_parcel.h
+++ b/frameworks/privacy/include/permission_used_record_parcel.h
@@ -1,40 +1,40 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef PERMISSION_USED_RECORD_PARCEL_H
-#define PERMISSION_USED_RECORD_PARCEL_H
-
-#include "parcel.h"
-#include "permission_used_result.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-struct PermissionUsedRecordParcel final : public Parcelable {
-    PermissionUsedRecordParcel() = default;
-
-    ~PermissionUsedRecordParcel() override = default;
-
-    bool Marshalling(Parcel& out) const override;
-
-    static PermissionUsedRecordParcel* Unmarshalling(Parcel& in);
-
-    PermissionUsedRecord permissionRecord;
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-
-#endif // PERMISSION_USED_RECORD_PARCEL_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef PERMISSION_USED_RECORD_PARCEL_H
+#define PERMISSION_USED_RECORD_PARCEL_H
+
+#include "parcel.h"
+#include "permission_used_result.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+struct PermissionUsedRecordParcel final : public Parcelable {
+    PermissionUsedRecordParcel() = default;
+
+    ~PermissionUsedRecordParcel() override = default;
+
+    bool Marshalling(Parcel& out) const override;
+
+    static PermissionUsedRecordParcel* Unmarshalling(Parcel& in);
+
+    PermissionUsedRecord permissionRecord;
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+
+#endif // PERMISSION_USED_RECORD_PARCEL_H
diff --git a/frameworks/privacy/include/permission_used_request_parcel.h b/frameworks/privacy/include/permission_used_request_parcel.h
index e0146d5218af02289faf259cfe6414960ae48dce..9ebb748d896e5db1879215365a47c8e6188a66d7 100644
--- a/frameworks/privacy/include/permission_used_request_parcel.h
+++ b/frameworks/privacy/include/permission_used_request_parcel.h
@@ -1,40 +1,40 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef PERMISSION_USED_REQUEST_PARCEL_H
-#define PERMISSION_USED_REQUEST_PARCEL_H
-
-#include "parcel.h"
-#include "permission_used_request.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-struct PermissionUsedRequestParcel final : public Parcelable {
-    PermissionUsedRequestParcel() = default;
-
-    ~PermissionUsedRequestParcel() override = default;
-
-    bool Marshalling(Parcel& out) const override;
-
-    static PermissionUsedRequestParcel* Unmarshalling(Parcel& in);
-
-    PermissionUsedRequest request;
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-
-#endif // PERMISSION_USED_REQUEST_PARCEL_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef PERMISSION_USED_REQUEST_PARCEL_H
+#define PERMISSION_USED_REQUEST_PARCEL_H
+
+#include "parcel.h"
+#include "permission_used_request.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+struct PermissionUsedRequestParcel final : public Parcelable {
+    PermissionUsedRequestParcel() = default;
+
+    ~PermissionUsedRequestParcel() override = default;
+
+    bool Marshalling(Parcel& out) const override;
+
+    static PermissionUsedRequestParcel* Unmarshalling(Parcel& in);
+
+    PermissionUsedRequest request;
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+
+#endif // PERMISSION_USED_REQUEST_PARCEL_H
diff --git a/frameworks/privacy/include/permission_used_result_parcel.h b/frameworks/privacy/include/permission_used_result_parcel.h
index 40e3d01fd51187fcdfefa687315b886464fa00da..950baf112f000b2c48c51c28be1e780d911ecb3d 100644
--- a/frameworks/privacy/include/permission_used_result_parcel.h
+++ b/frameworks/privacy/include/permission_used_result_parcel.h
@@ -1,40 +1,40 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef PERMISSION_USED_RESPONSE_PARCEL_H
-#define PERMISSION_USED_RESPONSE_PARCEL_H
-
-#include "parcel.h"
-#include "permission_used_result.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-struct PermissionUsedResultParcel final : public Parcelable {
-    PermissionUsedResultParcel() = default;
-
-    ~PermissionUsedResultParcel() override = default;
-
-    bool Marshalling(Parcel& out) const override;
-
-    static PermissionUsedResultParcel* Unmarshalling(Parcel& in);
-
-    PermissionUsedResult result;
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-
-#endif // PERMISSION_USED_RESPONSE_PARCEL_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef PERMISSION_USED_RESPONSE_PARCEL_H
+#define PERMISSION_USED_RESPONSE_PARCEL_H
+
+#include "parcel.h"
+#include "permission_used_result.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+struct PermissionUsedResultParcel final : public Parcelable {
+    PermissionUsedResultParcel() = default;
+
+    ~PermissionUsedResultParcel() override = default;
+
+    bool Marshalling(Parcel& out) const override;
+
+    static PermissionUsedResultParcel* Unmarshalling(Parcel& in);
+
+    PermissionUsedResult result;
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+
+#endif // PERMISSION_USED_RESPONSE_PARCEL_H
diff --git a/frameworks/privacy/include/used_record_detail_parcel.h b/frameworks/privacy/include/used_record_detail_parcel.h
index 8922fc222149ca57e5b8115406fb00be3ab2f526..105cf943d23dea07851e7a03e54649dce2676ca2 100644
--- a/frameworks/privacy/include/used_record_detail_parcel.h
+++ b/frameworks/privacy/include/used_record_detail_parcel.h
@@ -1,40 +1,40 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef USED_RECORD_DETAIL_PARCEL_H
-#define USED_RECORD_DETAIL_PARCEL_H
-
-#include "parcel.h"
-#include "permission_used_result.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-struct UsedRecordDetailParcel final : public Parcelable {
-    UsedRecordDetailParcel() = default;
-
-    ~UsedRecordDetailParcel() override = default;
-
-    bool Marshalling(Parcel& out) const override;
-
-    static UsedRecordDetailParcel* Unmarshalling(Parcel& in);
-
-    UsedRecordDetail detail;
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-
-#endif // USED_RECORD_DETAIL_PARCEL_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef USED_RECORD_DETAIL_PARCEL_H
+#define USED_RECORD_DETAIL_PARCEL_H
+
+#include "parcel.h"
+#include "permission_used_result.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+struct UsedRecordDetailParcel final : public Parcelable {
+    UsedRecordDetailParcel() = default;
+
+    ~UsedRecordDetailParcel() override = default;
+
+    bool Marshalling(Parcel& out) const override;
+
+    static UsedRecordDetailParcel* Unmarshalling(Parcel& in);
+
+    UsedRecordDetail detail;
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+
+#endif // USED_RECORD_DETAIL_PARCEL_H
diff --git a/frameworks/privacy/src/bundle_used_record_parcel.cpp b/frameworks/privacy/src/bundle_used_record_parcel.cpp
index 529c386e17179df14f2324847ead17459c1dda8f..3b8fe754e805f5af106b00bc2d1baa300116b124 100644
--- a/frameworks/privacy/src/bundle_used_record_parcel.cpp
+++ b/frameworks/privacy/src/bundle_used_record_parcel.cpp
@@ -1,61 +1,61 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "bundle_used_record_parcel.h"
-#include "refbase.h"
-#include "parcel_utils.h"
-#include "permission_used_record_parcel.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-bool BundleUsedRecordParcel::Marshalling(Parcel& out) const
-{
-    RETURN_IF_FALSE(out.WriteUint32(this->bundleRecord.tokenId));
-    RETURN_IF_FALSE(out.WriteBool(this->bundleRecord.isRemote));
-    RETURN_IF_FALSE(out.WriteString(this->bundleRecord.deviceId));
-    RETURN_IF_FALSE(out.WriteString(this->bundleRecord.bundleName));
-
-    RETURN_IF_FALSE(out.WriteInt32((int32_t)(this->bundleRecord.permissionRecords.size())));
-    for (const auto& permRecord : this->bundleRecord.permissionRecords) {
-        PermissionUsedRecordParcel permRecordParcel;
-        permRecordParcel.permissionRecord = permRecord;
-        out.WriteParcelable(&permRecordParcel);
-    }
-    return true;
-}
-
-BundleUsedRecordParcel* BundleUsedRecordParcel::Unmarshalling(Parcel& in)
-{
-    auto* bundleRecordParcel = new (std::nothrow) BundleUsedRecordParcel();
-    RELEASE_IF_FALSE(bundleRecordParcel != nullptr, bundleRecordParcel);
-
-    RELEASE_IF_FALSE(in.ReadUint32(bundleRecordParcel->bundleRecord.tokenId), bundleRecordParcel);
-    RELEASE_IF_FALSE(in.ReadBool(bundleRecordParcel->bundleRecord.isRemote), bundleRecordParcel);
-    RELEASE_IF_FALSE(in.ReadString(bundleRecordParcel->bundleRecord.deviceId), bundleRecordParcel);
-    RELEASE_IF_FALSE(in.ReadString(bundleRecordParcel->bundleRecord.bundleName), bundleRecordParcel);
-
-    int32_t permRecordSize = 0;
-    RELEASE_IF_FALSE(in.ReadInt32(permRecordSize), bundleRecordParcel);
-    for (int32_t i = 0; i < permRecordSize; i++) {
-        sptr<PermissionUsedRecordParcel> permRecord = in.ReadParcelable<PermissionUsedRecordParcel>();
-        RELEASE_IF_FALSE(permRecord != nullptr, bundleRecordParcel);
-        bundleRecordParcel->bundleRecord.permissionRecords.emplace_back(permRecord->permissionRecord);
-    }
-    return bundleRecordParcel;
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "bundle_used_record_parcel.h"
+#include "refbase.h"
+#include "parcel_utils.h"
+#include "permission_used_record_parcel.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+bool BundleUsedRecordParcel::Marshalling(Parcel& out) const
+{
+    RETURN_IF_FALSE(out.WriteUint32(this->bundleRecord.tokenId));
+    RETURN_IF_FALSE(out.WriteBool(this->bundleRecord.isRemote));
+    RETURN_IF_FALSE(out.WriteString(this->bundleRecord.deviceId));
+    RETURN_IF_FALSE(out.WriteString(this->bundleRecord.bundleName));
+
+    RETURN_IF_FALSE(out.WriteInt32((int32_t)(this->bundleRecord.permissionRecords.size())));
+    for (const auto& permRecord : this->bundleRecord.permissionRecords) {
+        PermissionUsedRecordParcel permRecordParcel;
+        permRecordParcel.permissionRecord = permRecord;
+        out.WriteParcelable(&permRecordParcel);
+    }
+    return true;
+}
+
+BundleUsedRecordParcel* BundleUsedRecordParcel::Unmarshalling(Parcel& in)
+{
+    auto* bundleRecordParcel = new (std::nothrow) BundleUsedRecordParcel();
+    RELEASE_IF_FALSE(bundleRecordParcel != nullptr, bundleRecordParcel);
+
+    RELEASE_IF_FALSE(in.ReadUint32(bundleRecordParcel->bundleRecord.tokenId), bundleRecordParcel);
+    RELEASE_IF_FALSE(in.ReadBool(bundleRecordParcel->bundleRecord.isRemote), bundleRecordParcel);
+    RELEASE_IF_FALSE(in.ReadString(bundleRecordParcel->bundleRecord.deviceId), bundleRecordParcel);
+    RELEASE_IF_FALSE(in.ReadString(bundleRecordParcel->bundleRecord.bundleName), bundleRecordParcel);
+
+    int32_t permRecordSize = 0;
+    RELEASE_IF_FALSE(in.ReadInt32(permRecordSize), bundleRecordParcel);
+    for (int32_t i = 0; i < permRecordSize; i++) {
+        sptr<PermissionUsedRecordParcel> permRecord = in.ReadParcelable<PermissionUsedRecordParcel>();
+        RELEASE_IF_FALSE(permRecord != nullptr, bundleRecordParcel);
+        bundleRecordParcel->bundleRecord.permissionRecords.emplace_back(permRecord->permissionRecord);
+    }
+    return bundleRecordParcel;
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/frameworks/privacy/src/perm_active_response_parcel.cpp b/frameworks/privacy/src/perm_active_response_parcel.cpp
index 49617f9d70b046a6d95d7f96d61725d3786744b8..957972401a55058548ec23049d85854e80012190 100644
--- a/frameworks/privacy/src/perm_active_response_parcel.cpp
+++ b/frameworks/privacy/src/perm_active_response_parcel.cpp
@@ -1,50 +1,50 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "parcel_utils.h"
-#include "perm_active_response_parcel.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-bool ActiveChangeResponseParcel::Marshalling(Parcel& out) const
-{
-    RETURN_IF_FALSE(out.WriteUint32(this->changeResponse.tokenID));
-    RETURN_IF_FALSE(out.WriteString(this->changeResponse.permissionName));
-    RETURN_IF_FALSE(out.WriteString(this->changeResponse.deviceId));
-    RETURN_IF_FALSE(out.WriteInt32(this->changeResponse.type));
-    return true;
-}
-
-ActiveChangeResponseParcel* ActiveChangeResponseParcel::Unmarshalling(Parcel& in)
-{
-    auto* activeChangeResponseParcel = new (std::nothrow) ActiveChangeResponseParcel();
-    if (activeChangeResponseParcel == nullptr) {
-        return nullptr;
-    }
-
-    RELEASE_IF_FALSE(in.ReadUint32(activeChangeResponseParcel->changeResponse.tokenID), activeChangeResponseParcel);
-    RELEASE_IF_FALSE(in.ReadString(activeChangeResponseParcel->changeResponse.permissionName),
-        activeChangeResponseParcel);
-    RELEASE_IF_FALSE(in.ReadString(activeChangeResponseParcel->changeResponse.deviceId), activeChangeResponseParcel);
-
-    int32_t type;
-    RELEASE_IF_FALSE(in.ReadInt32(type), activeChangeResponseParcel);
-    activeChangeResponseParcel->changeResponse.type = static_cast<ActiveChangeType>(type);
-    return activeChangeResponseParcel;
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "parcel_utils.h"
+#include "perm_active_response_parcel.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+bool ActiveChangeResponseParcel::Marshalling(Parcel& out) const
+{
+    RETURN_IF_FALSE(out.WriteUint32(this->changeResponse.tokenID));
+    RETURN_IF_FALSE(out.WriteString(this->changeResponse.permissionName));
+    RETURN_IF_FALSE(out.WriteString(this->changeResponse.deviceId));
+    RETURN_IF_FALSE(out.WriteInt32(this->changeResponse.type));
+    return true;
+}
+
+ActiveChangeResponseParcel* ActiveChangeResponseParcel::Unmarshalling(Parcel& in)
+{
+    auto* activeChangeResponseParcel = new (std::nothrow) ActiveChangeResponseParcel();
+    if (activeChangeResponseParcel == nullptr) {
+        return nullptr;
+    }
+
+    RELEASE_IF_FALSE(in.ReadUint32(activeChangeResponseParcel->changeResponse.tokenID), activeChangeResponseParcel);
+    RELEASE_IF_FALSE(in.ReadString(activeChangeResponseParcel->changeResponse.permissionName),
+        activeChangeResponseParcel);
+    RELEASE_IF_FALSE(in.ReadString(activeChangeResponseParcel->changeResponse.deviceId), activeChangeResponseParcel);
+
+    int32_t type;
+    RELEASE_IF_FALSE(in.ReadInt32(type), activeChangeResponseParcel);
+    activeChangeResponseParcel->changeResponse.type = static_cast<ActiveChangeType>(type);
+    return activeChangeResponseParcel;
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/frameworks/privacy/src/permission_used_record_parcel.cpp b/frameworks/privacy/src/permission_used_record_parcel.cpp
index 135e4a918100c15603ab8dd0ddb1c71125eb1f3f..682994e7563408319a8d1476a14b676922d8c4fa 100644
--- a/frameworks/privacy/src/permission_used_record_parcel.cpp
+++ b/frameworks/privacy/src/permission_used_record_parcel.cpp
@@ -1,80 +1,80 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "permission_used_record_parcel.h"
-#include "refbase.h"
-#include "parcel_utils.h"
-#include "used_record_detail_parcel.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-bool PermissionUsedRecordParcel::Marshalling(Parcel& out) const
-{
-    RETURN_IF_FALSE(out.WriteString(this->permissionRecord.permissionName));
-    RETURN_IF_FALSE(out.WriteInt32(this->permissionRecord.accessCount));
-    RETURN_IF_FALSE(out.WriteInt32(this->permissionRecord.rejectCount));
-    RETURN_IF_FALSE(out.WriteInt64(this->permissionRecord.lastAccessTime));
-    RETURN_IF_FALSE(out.WriteInt64(this->permissionRecord.lastRejectTime));
-    RETURN_IF_FALSE(out.WriteInt64(this->permissionRecord.lastAccessDuration));
-
-    RETURN_IF_FALSE(out.WriteInt32((int32_t)(this->permissionRecord.accessRecords.size())));
-    for (const auto& accRecord : this->permissionRecord.accessRecords) {
-        UsedRecordDetailParcel detailParcel;
-        detailParcel.detail = accRecord;
-        out.WriteParcelable(&detailParcel);
-    }
-
-    RETURN_IF_FALSE(out.WriteInt32((int32_t)(this->permissionRecord.rejectRecords.size())));
-    for (const auto& rejRecord : this->permissionRecord.rejectRecords) {
-        UsedRecordDetailParcel detailParcel;
-        detailParcel.detail = rejRecord;
-        out.WriteParcelable(&detailParcel);
-    }
-    return true;
-}
-
-PermissionUsedRecordParcel* PermissionUsedRecordParcel::Unmarshalling(Parcel& in)
-{
-    auto* permissionRecordParcel = new (std::nothrow) PermissionUsedRecordParcel();
-    RELEASE_IF_FALSE(permissionRecordParcel != nullptr, permissionRecordParcel);
-
-    RELEASE_IF_FALSE(in.ReadString(permissionRecordParcel->permissionRecord.permissionName), permissionRecordParcel);
-    RELEASE_IF_FALSE(in.ReadInt32(permissionRecordParcel->permissionRecord.accessCount), permissionRecordParcel);
-    RELEASE_IF_FALSE(in.ReadInt32(permissionRecordParcel->permissionRecord.rejectCount), permissionRecordParcel);
-    RELEASE_IF_FALSE(in.ReadInt64(permissionRecordParcel->permissionRecord.lastAccessTime), permissionRecordParcel);
-    RELEASE_IF_FALSE(in.ReadInt64(permissionRecordParcel->permissionRecord.lastRejectTime), permissionRecordParcel);
-    RELEASE_IF_FALSE(in.ReadInt64(permissionRecordParcel->permissionRecord.lastAccessDuration), permissionRecordParcel);
-
-    int32_t accRecordSize = 0;
-    RELEASE_IF_FALSE(in.ReadInt32(accRecordSize), permissionRecordParcel);
-    for (int32_t i = 0; i < accRecordSize; i++) {
-        sptr<UsedRecordDetailParcel> detailParcel = in.ReadParcelable<UsedRecordDetailParcel>();
-        RELEASE_IF_FALSE(detailParcel != nullptr, permissionRecordParcel);
-        permissionRecordParcel->permissionRecord.accessRecords.emplace_back(detailParcel->detail);
-    }
-    
-    int32_t rejRecordSize = 0;
-    RELEASE_IF_FALSE(in.ReadInt32(rejRecordSize), permissionRecordParcel);
-    for (int32_t i = 0; i < rejRecordSize; i++) {
-        sptr<UsedRecordDetailParcel> detailParcel = in.ReadParcelable<UsedRecordDetailParcel>();
-        RELEASE_IF_FALSE(detailParcel != nullptr, permissionRecordParcel);
-        permissionRecordParcel->permissionRecord.rejectRecords.emplace_back(detailParcel->detail);
-    }
-    return permissionRecordParcel;
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "permission_used_record_parcel.h"
+#include "refbase.h"
+#include "parcel_utils.h"
+#include "used_record_detail_parcel.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+bool PermissionUsedRecordParcel::Marshalling(Parcel& out) const
+{
+    RETURN_IF_FALSE(out.WriteString(this->permissionRecord.permissionName));
+    RETURN_IF_FALSE(out.WriteInt32(this->permissionRecord.accessCount));
+    RETURN_IF_FALSE(out.WriteInt32(this->permissionRecord.rejectCount));
+    RETURN_IF_FALSE(out.WriteInt64(this->permissionRecord.lastAccessTime));
+    RETURN_IF_FALSE(out.WriteInt64(this->permissionRecord.lastRejectTime));
+    RETURN_IF_FALSE(out.WriteInt64(this->permissionRecord.lastAccessDuration));
+
+    RETURN_IF_FALSE(out.WriteInt32((int32_t)(this->permissionRecord.accessRecords.size())));
+    for (const auto& accRecord : this->permissionRecord.accessRecords) {
+        UsedRecordDetailParcel detailParcel;
+        detailParcel.detail = accRecord;
+        out.WriteParcelable(&detailParcel);
+    }
+
+    RETURN_IF_FALSE(out.WriteInt32((int32_t)(this->permissionRecord.rejectRecords.size())));
+    for (const auto& rejRecord : this->permissionRecord.rejectRecords) {
+        UsedRecordDetailParcel detailParcel;
+        detailParcel.detail = rejRecord;
+        out.WriteParcelable(&detailParcel);
+    }
+    return true;
+}
+
+PermissionUsedRecordParcel* PermissionUsedRecordParcel::Unmarshalling(Parcel& in)
+{
+    auto* permissionRecordParcel = new (std::nothrow) PermissionUsedRecordParcel();
+    RELEASE_IF_FALSE(permissionRecordParcel != nullptr, permissionRecordParcel);
+
+    RELEASE_IF_FALSE(in.ReadString(permissionRecordParcel->permissionRecord.permissionName), permissionRecordParcel);
+    RELEASE_IF_FALSE(in.ReadInt32(permissionRecordParcel->permissionRecord.accessCount), permissionRecordParcel);
+    RELEASE_IF_FALSE(in.ReadInt32(permissionRecordParcel->permissionRecord.rejectCount), permissionRecordParcel);
+    RELEASE_IF_FALSE(in.ReadInt64(permissionRecordParcel->permissionRecord.lastAccessTime), permissionRecordParcel);
+    RELEASE_IF_FALSE(in.ReadInt64(permissionRecordParcel->permissionRecord.lastRejectTime), permissionRecordParcel);
+    RELEASE_IF_FALSE(in.ReadInt64(permissionRecordParcel->permissionRecord.lastAccessDuration), permissionRecordParcel);
+
+    int32_t accRecordSize = 0;
+    RELEASE_IF_FALSE(in.ReadInt32(accRecordSize), permissionRecordParcel);
+    for (int32_t i = 0; i < accRecordSize; i++) {
+        sptr<UsedRecordDetailParcel> detailParcel = in.ReadParcelable<UsedRecordDetailParcel>();
+        RELEASE_IF_FALSE(detailParcel != nullptr, permissionRecordParcel);
+        permissionRecordParcel->permissionRecord.accessRecords.emplace_back(detailParcel->detail);
+    }
+    
+    int32_t rejRecordSize = 0;
+    RELEASE_IF_FALSE(in.ReadInt32(rejRecordSize), permissionRecordParcel);
+    for (int32_t i = 0; i < rejRecordSize; i++) {
+        sptr<UsedRecordDetailParcel> detailParcel = in.ReadParcelable<UsedRecordDetailParcel>();
+        RELEASE_IF_FALSE(detailParcel != nullptr, permissionRecordParcel);
+        permissionRecordParcel->permissionRecord.rejectRecords.emplace_back(detailParcel->detail);
+    }
+    return permissionRecordParcel;
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/frameworks/privacy/src/permission_used_request_parcel.cpp b/frameworks/privacy/src/permission_used_request_parcel.cpp
index e4eac2bce76576d3ddee9bbfb973df058400566c..1ae64d9d1c46bd6426053ad0b8ae6b46d87216a9 100644
--- a/frameworks/privacy/src/permission_used_request_parcel.cpp
+++ b/frameworks/privacy/src/permission_used_request_parcel.cpp
@@ -1,65 +1,65 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "permission_used_request_parcel.h"
-#include "parcel_utils.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-bool PermissionUsedRequestParcel::Marshalling(Parcel& out) const
-{
-    RETURN_IF_FALSE(out.WriteUint32(this->request.tokenId));
-    RETURN_IF_FALSE(out.WriteBool(this->request.isRemote));
-    RETURN_IF_FALSE(out.WriteString(this->request.deviceId));
-    RETURN_IF_FALSE(out.WriteString(this->request.bundleName));
-
-    RETURN_IF_FALSE(out.WriteInt32((int32_t)(this->request.permissionList.size())));
-    for (const auto& perm : this->request.permissionList) {
-        RETURN_IF_FALSE(out.WriteString(perm));
-    }
-    RETURN_IF_FALSE(out.WriteInt64(this->request.beginTimeMillis));
-    RETURN_IF_FALSE(out.WriteInt64(this->request.endTimeMillis));
-    RETURN_IF_FALSE(out.WriteInt32(this->request.flag));
-    return true;
-}
-
-PermissionUsedRequestParcel* PermissionUsedRequestParcel::Unmarshalling(Parcel& in)
-{
-    auto* requestParcel = new (std::nothrow) PermissionUsedRequestParcel();
-    RELEASE_IF_FALSE(requestParcel != nullptr, requestParcel);
-
-    RELEASE_IF_FALSE(in.ReadUint32(requestParcel->request.tokenId), requestParcel);
-    RELEASE_IF_FALSE(in.ReadBool (requestParcel->request.isRemote), requestParcel);
-    RELEASE_IF_FALSE(in.ReadString(requestParcel->request.deviceId), requestParcel);
-    RELEASE_IF_FALSE(in.ReadString(requestParcel->request.bundleName), requestParcel);
-
-    int32_t permSize = 0;
-    RELEASE_IF_FALSE(in.ReadInt32(permSize), requestParcel);
-    for (int32_t i = 0; i < permSize; i++) {
-        std::string perm;
-        RELEASE_IF_FALSE(in.ReadString(perm), requestParcel);
-        requestParcel->request.permissionList.emplace_back(perm);
-    }
-    RELEASE_IF_FALSE(in.ReadInt64(requestParcel->request.beginTimeMillis), requestParcel);
-    RELEASE_IF_FALSE(in.ReadInt64(requestParcel->request.endTimeMillis), requestParcel);
-    int32_t flag;
-    RELEASE_IF_FALSE(in.ReadInt32(flag), requestParcel);
-    requestParcel->request.flag = static_cast<PermissionUsageFlagEnum>(flag);
-    return requestParcel;
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "permission_used_request_parcel.h"
+#include "parcel_utils.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+bool PermissionUsedRequestParcel::Marshalling(Parcel& out) const
+{
+    RETURN_IF_FALSE(out.WriteUint32(this->request.tokenId));
+    RETURN_IF_FALSE(out.WriteBool(this->request.isRemote));
+    RETURN_IF_FALSE(out.WriteString(this->request.deviceId));
+    RETURN_IF_FALSE(out.WriteString(this->request.bundleName));
+
+    RETURN_IF_FALSE(out.WriteInt32((int32_t)(this->request.permissionList.size())));
+    for (const auto& perm : this->request.permissionList) {
+        RETURN_IF_FALSE(out.WriteString(perm));
+    }
+    RETURN_IF_FALSE(out.WriteInt64(this->request.beginTimeMillis));
+    RETURN_IF_FALSE(out.WriteInt64(this->request.endTimeMillis));
+    RETURN_IF_FALSE(out.WriteInt32(this->request.flag));
+    return true;
+}
+
+PermissionUsedRequestParcel* PermissionUsedRequestParcel::Unmarshalling(Parcel& in)
+{
+    auto* requestParcel = new (std::nothrow) PermissionUsedRequestParcel();
+    RELEASE_IF_FALSE(requestParcel != nullptr, requestParcel);
+
+    RELEASE_IF_FALSE(in.ReadUint32(requestParcel->request.tokenId), requestParcel);
+    RELEASE_IF_FALSE(in.ReadBool (requestParcel->request.isRemote), requestParcel);
+    RELEASE_IF_FALSE(in.ReadString(requestParcel->request.deviceId), requestParcel);
+    RELEASE_IF_FALSE(in.ReadString(requestParcel->request.bundleName), requestParcel);
+
+    int32_t permSize = 0;
+    RELEASE_IF_FALSE(in.ReadInt32(permSize), requestParcel);
+    for (int32_t i = 0; i < permSize; i++) {
+        std::string perm;
+        RELEASE_IF_FALSE(in.ReadString(perm), requestParcel);
+        requestParcel->request.permissionList.emplace_back(perm);
+    }
+    RELEASE_IF_FALSE(in.ReadInt64(requestParcel->request.beginTimeMillis), requestParcel);
+    RELEASE_IF_FALSE(in.ReadInt64(requestParcel->request.endTimeMillis), requestParcel);
+    int32_t flag;
+    RELEASE_IF_FALSE(in.ReadInt32(flag), requestParcel);
+    requestParcel->request.flag = static_cast<PermissionUsageFlagEnum>(flag);
+    return requestParcel;
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/frameworks/privacy/src/permission_used_result_parcel.cpp b/frameworks/privacy/src/permission_used_result_parcel.cpp
index 8dec895ab8d786c5a46d28ffe4179d515d608cb2..0ff3d5dd8be51e02a0960d0e812bdfacd93d1599 100644
--- a/frameworks/privacy/src/permission_used_result_parcel.cpp
+++ b/frameworks/privacy/src/permission_used_result_parcel.cpp
@@ -1,57 +1,57 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "permission_used_result_parcel.h"
-#include "refbase.h"
-#include "bundle_used_record_parcel.h"
-#include "parcel_utils.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-bool PermissionUsedResultParcel::Marshalling(Parcel& out) const
-{
-    RETURN_IF_FALSE(out.WriteInt64(this->result.beginTimeMillis));
-    RETURN_IF_FALSE(out.WriteInt64(this->result.endTimeMillis));
-
-    RETURN_IF_FALSE(out.WriteInt32((int32_t)(this->result.bundleRecords.size())));
-    for (const auto& bundRecord : this->result.bundleRecords) {
-        BundleUsedRecordParcel bundleParcel;
-        bundleParcel.bundleRecord = bundRecord;
-        out.WriteParcelable(&bundleParcel);
-    }
-    return true;
-}
-
-PermissionUsedResultParcel* PermissionUsedResultParcel::Unmarshalling(Parcel& in)
-{
-    auto* resultParcel = new (std::nothrow) PermissionUsedResultParcel();
-    RELEASE_IF_FALSE(resultParcel != nullptr, resultParcel);
-
-    RELEASE_IF_FALSE(in.ReadInt64(resultParcel->result.beginTimeMillis), resultParcel);
-    RELEASE_IF_FALSE(in.ReadInt64(resultParcel->result.endTimeMillis), resultParcel);
-
-    int32_t bundResponseSize = 0;
-    RELEASE_IF_FALSE(in.ReadInt32(bundResponseSize), resultParcel);
-    for (int32_t i = 0; i < bundResponseSize; i++) {
-        sptr<BundleUsedRecordParcel> bunRecordParcel = in.ReadParcelable<BundleUsedRecordParcel>();
-        RELEASE_IF_FALSE(bunRecordParcel != nullptr, resultParcel);
-        resultParcel->result.bundleRecords.emplace_back(bunRecordParcel->bundleRecord);
-    }
-    return resultParcel;
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "permission_used_result_parcel.h"
+#include "refbase.h"
+#include "bundle_used_record_parcel.h"
+#include "parcel_utils.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+bool PermissionUsedResultParcel::Marshalling(Parcel& out) const
+{
+    RETURN_IF_FALSE(out.WriteInt64(this->result.beginTimeMillis));
+    RETURN_IF_FALSE(out.WriteInt64(this->result.endTimeMillis));
+
+    RETURN_IF_FALSE(out.WriteInt32((int32_t)(this->result.bundleRecords.size())));
+    for (const auto& bundRecord : this->result.bundleRecords) {
+        BundleUsedRecordParcel bundleParcel;
+        bundleParcel.bundleRecord = bundRecord;
+        out.WriteParcelable(&bundleParcel);
+    }
+    return true;
+}
+
+PermissionUsedResultParcel* PermissionUsedResultParcel::Unmarshalling(Parcel& in)
+{
+    auto* resultParcel = new (std::nothrow) PermissionUsedResultParcel();
+    RELEASE_IF_FALSE(resultParcel != nullptr, resultParcel);
+
+    RELEASE_IF_FALSE(in.ReadInt64(resultParcel->result.beginTimeMillis), resultParcel);
+    RELEASE_IF_FALSE(in.ReadInt64(resultParcel->result.endTimeMillis), resultParcel);
+
+    int32_t bundResponseSize = 0;
+    RELEASE_IF_FALSE(in.ReadInt32(bundResponseSize), resultParcel);
+    for (int32_t i = 0; i < bundResponseSize; i++) {
+        sptr<BundleUsedRecordParcel> bunRecordParcel = in.ReadParcelable<BundleUsedRecordParcel>();
+        RELEASE_IF_FALSE(bunRecordParcel != nullptr, resultParcel);
+        resultParcel->result.bundleRecords.emplace_back(bunRecordParcel->bundleRecord);
+    }
+    return resultParcel;
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/frameworks/privacy/src/used_record_detail_parcel.cpp b/frameworks/privacy/src/used_record_detail_parcel.cpp
index d59512b675091cd60db6ef59b7011106b1cd2567..33a93adebede280652e2011be62eae246abd4f53 100644
--- a/frameworks/privacy/src/used_record_detail_parcel.cpp
+++ b/frameworks/privacy/src/used_record_detail_parcel.cpp
@@ -1,42 +1,42 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "used_record_detail_parcel.h"
-#include "parcel_utils.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-bool UsedRecordDetailParcel::Marshalling(Parcel& out) const
-{
-    RETURN_IF_FALSE(out.WriteInt32(this->detail.status));
-    RETURN_IF_FALSE(out.WriteInt64(this->detail.timestamp));
-    RETURN_IF_FALSE(out.WriteInt64(this->detail.accessDuration));
-    return true;
-}
-
-UsedRecordDetailParcel* UsedRecordDetailParcel::Unmarshalling(Parcel& in)
-{
-    auto* detailRecordParcel = new (std::nothrow) UsedRecordDetailParcel();
-    RELEASE_IF_FALSE(detailRecordParcel != nullptr, detailRecordParcel);
-
-    RELEASE_IF_FALSE(in.ReadInt32(detailRecordParcel->detail.status), detailRecordParcel);
-    RELEASE_IF_FALSE(in.ReadInt64(detailRecordParcel->detail.timestamp), detailRecordParcel);
-    RELEASE_IF_FALSE(in.ReadInt64(detailRecordParcel->detail.accessDuration), detailRecordParcel);
-    return detailRecordParcel;
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "used_record_detail_parcel.h"
+#include "parcel_utils.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+bool UsedRecordDetailParcel::Marshalling(Parcel& out) const
+{
+    RETURN_IF_FALSE(out.WriteInt32(this->detail.status));
+    RETURN_IF_FALSE(out.WriteInt64(this->detail.timestamp));
+    RETURN_IF_FALSE(out.WriteInt64(this->detail.accessDuration));
+    return true;
+}
+
+UsedRecordDetailParcel* UsedRecordDetailParcel::Unmarshalling(Parcel& in)
+{
+    auto* detailRecordParcel = new (std::nothrow) UsedRecordDetailParcel();
+    RELEASE_IF_FALSE(detailRecordParcel != nullptr, detailRecordParcel);
+
+    RELEASE_IF_FALSE(in.ReadInt32(detailRecordParcel->detail.status), detailRecordParcel);
+    RELEASE_IF_FALSE(in.ReadInt64(detailRecordParcel->detail.timestamp), detailRecordParcel);
+    RELEASE_IF_FALSE(in.ReadInt64(detailRecordParcel->detail.accessDuration), detailRecordParcel);
+    return detailRecordParcel;
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/frameworks/tokensync/include/i_token_sync_manager.h b/frameworks/tokensync/include/i_token_sync_manager.h
index 9736a6fe229de7bb0d09cd7af6eb8557dfed3ed8..c903c218718773c9a58df6075638b45e0b73a9af 100644
--- a/frameworks/tokensync/include/i_token_sync_manager.h
+++ b/frameworks/tokensync/include/i_token_sync_manager.h
@@ -1,50 +1,50 @@
-/*
- * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef I_TOKENSYNC_MANAGER_H
-#define I_TOKENSYNC_MANAGER_H
-
-#include <string>
-
-#include "iremote_broker.h"
-#include "errors.h"
-
-#include "access_token.h"
-#include "hap_token_info_for_sync_parcel.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class ITokenSyncManager : public IRemoteBroker {
-public:
-    static const int SA_ID_TOKENSYNC_MANAGER_SERVICE = 3504;
-
-    DECLARE_INTERFACE_DESCRIPTOR(u"ohos.security.accesstoken.ITokenSyncManager");
-
-    virtual int GetRemoteHapTokenInfo(const std::string& deviceID, AccessTokenID tokenID) = 0;
-    virtual int DeleteRemoteHapTokenInfo(AccessTokenID tokenID) = 0;
-    virtual int UpdateRemoteHapTokenInfo(const HapTokenInfoForSync& tokenInfo) = 0;
-
-    enum class InterfaceCode {
-        GET_REMOTE_HAP_TOKEN_INFO = 0xff01,
-        DELETE_REMOTE_HAP_TOKEN_INFO = 0xff02,
-        UPDATE_REMOTE_HAP_TOKEN_INFO = 0xff03
-    };
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-
-#endif // I_TOKENSYNC_MANAGER_H
+/*
+ * Copyright (c) 2021-2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef I_TOKENSYNC_MANAGER_H
+#define I_TOKENSYNC_MANAGER_H
+
+#include <string>
+
+#include "iremote_broker.h"
+#include "errors.h"
+
+#include "access_token.h"
+#include "hap_token_info_for_sync_parcel.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class ITokenSyncManager : public IRemoteBroker {
+public:
+    static const int SA_ID_TOKENSYNC_MANAGER_SERVICE = 3504;
+
+    DECLARE_INTERFACE_DESCRIPTOR(u"ohos.security.accesstoken.ITokenSyncManager");
+
+    virtual int GetRemoteHapTokenInfo(const std::string& deviceID, AccessTokenID tokenID) = 0;
+    virtual int DeleteRemoteHapTokenInfo(AccessTokenID tokenID) = 0;
+    virtual int UpdateRemoteHapTokenInfo(const HapTokenInfoForSync& tokenInfo) = 0;
+
+    enum class InterfaceCode {
+        GET_REMOTE_HAP_TOKEN_INFO = 0xff01,
+        DELETE_REMOTE_HAP_TOKEN_INFO = 0xff02,
+        UPDATE_REMOTE_HAP_TOKEN_INFO = 0xff03
+    };
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+
+#endif // I_TOKENSYNC_MANAGER_H
diff --git a/interfaces/innerkits/privacy/BUILD.gn b/interfaces/innerkits/privacy/BUILD.gn
index 42ec2da9f8f3cb85ac980618469d97a218a9ab23..b5ec85b41ee57dad4b6452ed4dd6bf64452b05e1 100644
--- a/interfaces/innerkits/privacy/BUILD.gn
+++ b/interfaces/innerkits/privacy/BUILD.gn
@@ -1,67 +1,67 @@
-# Copyright (c) 2022 Huawei Device Co., Ltd.
-# Licensed under the Apache License, Version 2.0 (the "License");
-# you may not use this file except in compliance with the License.
-# You may obtain a copy of the License at
-#
-#     http://www.apache.org/licenses/LICENSE-2.0
-#
-# Unless required by applicable law or agreed to in writing, software
-# distributed under the License is distributed on an "AS IS" BASIS,
-# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-# See the License for the specific language governing permissions and
-# limitations under the License.
-
-import("//build/ohos.gni")
-
-config("pricacy") {
-  visibility = [ ":*" ]
-  include_dirs = [ "include" ]
-}
-
-if (is_standard_system) {
-  ohos_shared_library("libprivacy_sdk") {
-    subsystem_name = "security"
-    part_name = "access_token"
-
-    output_name = "libprivacy_sdk"
-
-    public_configs = [ ":pricacy" ]
-
-    include_dirs = [
-      "//commonlibrary/c_utils/base/include",
-      "include",
-      "src",
-      "//base/security/access_token/frameworks/privacy/include",
-      "//base/security/access_token/frameworks/common/include",
-      "//base/security/access_token/interfaces/innerkits/accesstoken/include",
-      "//base/security/access_token/interfaces/innerkits/privacy/include",
-    ]
-
-    sources = [
-      "src/perm_active_status_change_callback.cpp",
-      "src/perm_active_status_change_callback_stub.cpp",
-      "src/perm_active_status_customized_cbk.cpp",
-      "src/privacy_death_recipient.cpp",
-      "src/privacy_kit.cpp",
-      "src/privacy_manager_client.cpp",
-      "src/privacy_manager_proxy.cpp",
-    ]
-
-    deps = [
-      "//base/security/access_token/frameworks/common:accesstoken_common_cxx",
-      "//base/security/access_token/frameworks/privacy:privacy_communication_adapter_cxx",
-    ]
-
-    external_deps = [
-      "c_utils:utils",
-      "hiviewdfx_hilog_native:libhilog",
-      "ipc:ipc_core",
-      "samgr:samgr_proxy",
-    ]
-
-    cflags_cc = [
-      "-DHILOG_ENABLE",
-      "-DDEBUG_API_PERFORMANCE",
-    ]
-  }
-}
+# Copyright (c) 2022 Huawei Device Co., Ltd.
+# Licensed under the Apache License, Version 2.0 (the "License");
+# you may not use this file except in compliance with the License.
+# You may obtain a copy of the License at
+#
+#     http://www.apache.org/licenses/LICENSE-2.0
+#
+# Unless required by applicable law or agreed to in writing, software
+# distributed under the License is distributed on an "AS IS" BASIS,
+# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+# See the License for the specific language governing permissions and
+# limitations under the License.
+
+import("//build/ohos.gni")
+
+config("pricacy") {
+  visibility = [ ":*" ]
+  include_dirs = [ "include" ]
+}
+
+if (is_standard_system) {
+  ohos_shared_library("libprivacy_sdk") {
+    subsystem_name = "security"
+    part_name = "access_token"
+
+    output_name = "libprivacy_sdk"
+
+    public_configs = [ ":pricacy" ]
+
+    include_dirs = [
+      "//commonlibrary/c_utils/base/include",
+      "include",
+      "src",
+      "//base/security/access_token/frameworks/privacy/include",
+      "//base/security/access_token/frameworks/common/include",
+      "//base/security/access_token/interfaces/innerkits/accesstoken/include",
+      "//base/security/access_token/interfaces/innerkits/privacy/include",
+    ]
+
+    sources = [
+      "src/perm_active_status_change_callback.cpp",
+      "src/perm_active_status_change_callback_stub.cpp",
+      "src/perm_active_status_customized_cbk.cpp",
+      "src/privacy_death_recipient.cpp",
+      "src/privacy_kit.cpp",
+      "src/privacy_manager_client.cpp",
+      "src/privacy_manager_proxy.cpp",
+    ]
+
+    deps = [
+      "//base/security/access_token/frameworks/common:accesstoken_common_cxx",
+      "//base/security/access_token/frameworks/privacy:privacy_communication_adapter_cxx",
+    ]
+
+    external_deps = [
+      "c_utils:utils",
+      "hiviewdfx_hilog_native:libhilog",
+      "ipc:ipc_core",
+      "samgr:samgr_proxy",
+    ]
+
+    cflags_cc = [
+      "-DHILOG_ENABLE",
+      "-DDEBUG_API_PERFORMANCE",
+    ]
+  }
+}
diff --git a/interfaces/innerkits/privacy/include/on_permission_used_record_callback.h b/interfaces/innerkits/privacy/include/on_permission_used_record_callback.h
index acb51194fdcd264f4e76a7a33dea918547132e99..de2d488d4efaba6e700982d63b2b56b8314eaad1 100644
--- a/interfaces/innerkits/privacy/include/on_permission_used_record_callback.h
+++ b/interfaces/innerkits/privacy/include/on_permission_used_record_callback.h
@@ -1,39 +1,39 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef ON_PERMISSION_USED_RECORD_CALLBACK_H
-#define ON_PERMISSION_USED_RECORD_CALLBACK_H
-
-#include "errors.h"
-#include "iremote_broker.h"
-#include "permission_used_result.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class OnPermissionUsedRecordCallback : public IRemoteBroker {
-public:
-    DECLARE_INTERFACE_DESCRIPTOR(u"ohos.security.accesstoken.OnPermissionUsedRecordCallback");
-
-    virtual void OnQueried(ErrCode code, PermissionUsedResult& result) = 0;
-
-    enum {
-        ON_QUERIED = 0,
-    };
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-#endif // ON_PERMISSION_USED_RECORD_CALLBACK_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef ON_PERMISSION_USED_RECORD_CALLBACK_H
+#define ON_PERMISSION_USED_RECORD_CALLBACK_H
+
+#include "errors.h"
+#include "iremote_broker.h"
+#include "permission_used_result.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class OnPermissionUsedRecordCallback : public IRemoteBroker {
+public:
+    DECLARE_INTERFACE_DESCRIPTOR(u"ohos.security.accesstoken.OnPermissionUsedRecordCallback");
+
+    virtual void OnQueried(ErrCode code, PermissionUsedResult& result) = 0;
+
+    enum {
+        ON_QUERIED = 0,
+    };
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+#endif // ON_PERMISSION_USED_RECORD_CALLBACK_H
diff --git a/interfaces/innerkits/privacy/include/perm_active_status_change_callback_stub.h b/interfaces/innerkits/privacy/include/perm_active_status_change_callback_stub.h
index cc9a6c81ab809d035396254fcf9b5163aaaff40b..74f3e92ae4823bec4bff160efea4a20b804a17e5 100644
--- a/interfaces/innerkits/privacy/include/perm_active_status_change_callback_stub.h
+++ b/interfaces/innerkits/privacy/include/perm_active_status_change_callback_stub.h
@@ -1,38 +1,38 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef PERM_ACTIVE_STATUS_CHANGE_CALLBACK_STUB_H
-#define PERM_ACTIVE_STATUS_CHANGE_CALLBACK_STUB_H
-
-
-#include "i_perm_active_status_callback.h"
-
-#include "iremote_stub.h"
-#include "nocopyable.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class PermActiveStatusChangeCallbackStub : public IRemoteStub<IPermActiveStatusCallback> {
-public:
-    PermActiveStatusChangeCallbackStub() = default;
-    virtual ~PermActiveStatusChangeCallbackStub() = default;
-
-    int32_t OnRemoteRequest(uint32_t code, MessageParcel& data, MessageParcel& reply, MessageOption& option) override;
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-#endif // PERM_ACTIVE_STATUS_CHANGE_CALLBACK_STUB_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef PERM_ACTIVE_STATUS_CHANGE_CALLBACK_STUB_H
+#define PERM_ACTIVE_STATUS_CHANGE_CALLBACK_STUB_H
+
+
+#include "i_perm_active_status_callback.h"
+
+#include "iremote_stub.h"
+#include "nocopyable.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class PermActiveStatusChangeCallbackStub : public IRemoteStub<IPermActiveStatusCallback> {
+public:
+    PermActiveStatusChangeCallbackStub() = default;
+    virtual ~PermActiveStatusChangeCallbackStub() = default;
+
+    int32_t OnRemoteRequest(uint32_t code, MessageParcel& data, MessageParcel& reply, MessageOption& option) override;
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+#endif // PERM_ACTIVE_STATUS_CHANGE_CALLBACK_STUB_H
diff --git a/interfaces/innerkits/privacy/include/permission_used_request.h b/interfaces/innerkits/privacy/include/permission_used_request.h
index 1fcdd9f2d6f4811f516f805d1c3728bde550adc4..fed30f2479ae5deb50cd2c0c12d2f3de2a300a35 100644
--- a/interfaces/innerkits/privacy/include/permission_used_request.h
+++ b/interfaces/innerkits/privacy/include/permission_used_request.h
@@ -1,45 +1,45 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef PERMISSION_USED_REQUEST_H
-#define PERMISSION_USED_REQUEST_H
-
-#include <string>
-#include <vector>
-
-#include "access_token.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-typedef enum PermissionUsageFlagEnum {
-    FLAG_PERMISSION_USAGE_SUMMARY = 0,
-    FLAG_PERMISSION_USAGE_DETAIL = 1,
-} PermissionUsageFlag;
-
-struct PermissionUsedRequest {
-    AccessTokenID tokenId = 0;
-    bool isRemote = false;
-    std::string deviceId;
-    std::string bundleName;
-    std::vector<std::string> permissionList;
-    int64_t beginTimeMillis = 0;
-    int64_t endTimeMillis = 0;
-    PermissionUsageFlag flag = FLAG_PERMISSION_USAGE_SUMMARY;
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-#endif // PERMISSION_USED_REQUEST_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef PERMISSION_USED_REQUEST_H
+#define PERMISSION_USED_REQUEST_H
+
+#include <string>
+#include <vector>
+
+#include "access_token.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+typedef enum PermissionUsageFlagEnum {
+    FLAG_PERMISSION_USAGE_SUMMARY = 0,
+    FLAG_PERMISSION_USAGE_DETAIL = 1,
+} PermissionUsageFlag;
+
+struct PermissionUsedRequest {
+    AccessTokenID tokenId = 0;
+    bool isRemote = false;
+    std::string deviceId;
+    std::string bundleName;
+    std::vector<std::string> permissionList;
+    int64_t beginTimeMillis = 0;
+    int64_t endTimeMillis = 0;
+    PermissionUsageFlag flag = FLAG_PERMISSION_USAGE_SUMMARY;
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+#endif // PERMISSION_USED_REQUEST_H
diff --git a/interfaces/innerkits/privacy/include/permission_used_result.h b/interfaces/innerkits/privacy/include/permission_used_result.h
index c52a1ccd610a8ff0ebdd6dfb19a199b366029e44..1fec6474e0349b330b60216ba115e1713a815dc7 100644
--- a/interfaces/innerkits/privacy/include/permission_used_result.h
+++ b/interfaces/innerkits/privacy/include/permission_used_result.h
@@ -1,59 +1,59 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef PERMISSION_USED_RESPONSE_H
-#define PERMISSION_USED_RESPONSE_H
-
-#include <string>
-#include <vector>
-#include "access_token.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-struct UsedRecordDetail {
-    int32_t status = 0;
-    int64_t timestamp = 0L;
-    int64_t accessDuration = 0L;
-};
-
-struct PermissionUsedRecord {
-    std::string permissionName;
-    int32_t accessCount = 0;
-    int32_t rejectCount = 0;
-    int64_t lastAccessTime = 0L;
-    int64_t lastRejectTime = 0L;
-    int64_t lastAccessDuration = 0L;
-    std::vector<UsedRecordDetail> accessRecords;
-    std::vector<UsedRecordDetail> rejectRecords;
-};
-
-struct BundleUsedRecord {
-    AccessTokenID tokenId;
-    bool isRemote;
-    std::string deviceId;
-    std::string bundleName;
-    std::vector<PermissionUsedRecord> permissionRecords;
-};
-
-struct PermissionUsedResult {
-    int64_t beginTimeMillis = 0L;
-    int64_t endTimeMillis = 0L;
-    std::vector<BundleUsedRecord> bundleRecords;
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-#endif // PERMISSION_USED_RESPONSE_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef PERMISSION_USED_RESPONSE_H
+#define PERMISSION_USED_RESPONSE_H
+
+#include <string>
+#include <vector>
+#include "access_token.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+struct UsedRecordDetail {
+    int32_t status = 0;
+    int64_t timestamp = 0L;
+    int64_t accessDuration = 0L;
+};
+
+struct PermissionUsedRecord {
+    std::string permissionName;
+    int32_t accessCount = 0;
+    int32_t rejectCount = 0;
+    int64_t lastAccessTime = 0L;
+    int64_t lastRejectTime = 0L;
+    int64_t lastAccessDuration = 0L;
+    std::vector<UsedRecordDetail> accessRecords;
+    std::vector<UsedRecordDetail> rejectRecords;
+};
+
+struct BundleUsedRecord {
+    AccessTokenID tokenId;
+    bool isRemote;
+    std::string deviceId;
+    std::string bundleName;
+    std::vector<PermissionUsedRecord> permissionRecords;
+};
+
+struct PermissionUsedResult {
+    int64_t beginTimeMillis = 0L;
+    int64_t endTimeMillis = 0L;
+    std::vector<BundleUsedRecord> bundleRecords;
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+#endif // PERMISSION_USED_RESPONSE_H
diff --git a/interfaces/innerkits/privacy/include/privacy_kit.h b/interfaces/innerkits/privacy/include/privacy_kit.h
index a06fa1f8c85e10e99c1105a289bcec7624e9e759..cbde1dc8765450ed794d51a823be9e5e2a3b64fa 100644
--- a/interfaces/innerkits/privacy/include/privacy_kit.h
+++ b/interfaces/innerkits/privacy/include/privacy_kit.h
@@ -1,47 +1,48 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef INTERFACES_INNER_KITS_PRIVACY_KIT_H
-#define INTERFACES_INNER_KITS_PRIVACY_KIT_H
-
-#include <string>
-
-#include "access_token.h"
-#include "on_permission_used_record_callback.h"
-#include "permission_used_request.h"
-#include "permission_used_result.h"
-#include "perm_active_status_customized_cbk.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class PrivacyKit {
-public:
-    static int32_t AddPermissionUsedRecord(
-        AccessTokenID tokenID, const std::string& permissionName, int32_t successCount, int32_t failCount);
-    static int32_t StartUsingPermission(AccessTokenID tokenID, const std::string& permissionName);
-    static int32_t StopUsingPermission(AccessTokenID tokenID, const std::string& permissionName);
-    static int32_t RemovePermissionUsedRecords(AccessTokenID tokenID, const std::string& deviceID);
-    static int32_t GetPermissionUsedRecords(const PermissionUsedRequest& request, PermissionUsedResult& result);
-    static int32_t GetPermissionUsedRecords(
-        const PermissionUsedRequest& request, const sptr<OnPermissionUsedRecordCallback>& callback);
-    static std::string DumpRecordInfo(AccessTokenID tokenID, const std::string& permissionName);
-    static int32_t RegisterPermActiveStatusCallback(const std::shared_ptr<PermActiveStatusCustomizedCbk>& callback);
-    static int32_t UnRegisterPermActiveStatusCallback(const std::shared_ptr<PermActiveStatusCustomizedCbk>& callback);
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-#endif
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef INTERFACES_INNER_KITS_PRIVACY_KIT_H
+#define INTERFACES_INNER_KITS_PRIVACY_KIT_H
+
+#include <string>
+
+#include "access_token.h"
+#include "on_permission_used_record_callback.h"
+#include "permission_used_request.h"
+#include "permission_used_result.h"
+#include "perm_active_status_customized_cbk.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class PrivacyKit {
+public:
+    static int32_t AddPermissionUsedRecord(
+        AccessTokenID tokenID, const std::string& permissionName, int32_t successCount, int32_t failCount);
+    static int32_t StartUsingPermission(AccessTokenID tokenID, const std::string& permissionName);
+    static int32_t StopUsingPermission(AccessTokenID tokenID, const std::string& permissionName);
+    static int32_t RemovePermissionUsedRecords(AccessTokenID tokenID, const std::string& deviceID);
+    static int32_t GetPermissionUsedRecords(const PermissionUsedRequest& request, PermissionUsedResult& result);
+    static int32_t GetPermissionUsedRecords(
+        const PermissionUsedRequest& request, const sptr<OnPermissionUsedRecordCallback>& callback);
+    static std::string DumpRecordInfo(AccessTokenID tokenID, const std::string& permissionName);
+    static int32_t RegisterPermActiveStatusCallback(const std::shared_ptr<PermActiveStatusCustomizedCbk>& callback);
+    static int32_t UnRegisterPermActiveStatusCallback(const std::shared_ptr<PermActiveStatusCustomizedCbk>& callback);
+    static bool IsAllowUsingPermission(AccessTokenID tokenID, const std::string& permissionName);
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+#endif
diff --git a/interfaces/innerkits/privacy/src/perm_active_status_change_callback_stub.cpp b/interfaces/innerkits/privacy/src/perm_active_status_change_callback_stub.cpp
index fa4d4e035dab5d8bf9027c306f05db7f6648eb55..250900ab744838e0bf9547b6470a63ab1ba88372 100644
--- a/interfaces/innerkits/privacy/src/perm_active_status_change_callback_stub.cpp
+++ b/interfaces/innerkits/privacy/src/perm_active_status_change_callback_stub.cpp
@@ -1,57 +1,57 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "perm_active_status_change_callback_stub.h"
-
-#include "accesstoken_log.h"
-#include "perm_active_response_parcel.h"
-#include "string_ex.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-namespace {
-static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
-    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "PermActiveStatusChangeCallbackStub"
-};
-}
-
-int32_t PermActiveStatusChangeCallbackStub::OnRemoteRequest(
-    uint32_t code, MessageParcel& data, MessageParcel& reply, MessageOption& option)
-{
-    ACCESSTOKEN_LOG_DEBUG(LABEL, "Entry, code: 0x%{public}x", code);
-    std::u16string descriptor = data.ReadInterfaceToken();
-    if (descriptor != IPermActiveStatusCallback::GetDescriptor()) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "get unexpect descriptor: %{public}s", Str16ToStr8(descriptor).c_str());
-        return RET_FAILED;
-    }
-
-    int32_t msgCode =  static_cast<int32_t>(code);
-    if (msgCode == IPermActiveStatusCallback::PERM_ACTIVE_STATUS_CHANGE) {
-        sptr<ActiveChangeResponseParcel> resultSptr = data.ReadParcelable<ActiveChangeResponseParcel>();
-        if (resultSptr == nullptr) {
-            ACCESSTOKEN_LOG_ERROR(LABEL, "ReadParcelable fail");
-            return RET_FAILED;
-        }
-
-        ActiveStatusChangeCallback(resultSptr->changeResponse);
-    } else {
-        return IPCObjectStub::OnRemoteRequest(code, data, reply, option);
-    }
-    return RET_SUCCESS;
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "perm_active_status_change_callback_stub.h"
+
+#include "accesstoken_log.h"
+#include "perm_active_response_parcel.h"
+#include "string_ex.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+namespace {
+static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
+    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "PermActiveStatusChangeCallbackStub"
+};
+}
+
+int32_t PermActiveStatusChangeCallbackStub::OnRemoteRequest(
+    uint32_t code, MessageParcel& data, MessageParcel& reply, MessageOption& option)
+{
+    ACCESSTOKEN_LOG_DEBUG(LABEL, "Entry, code: 0x%{public}x", code);
+    std::u16string descriptor = data.ReadInterfaceToken();
+    if (descriptor != IPermActiveStatusCallback::GetDescriptor()) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "get unexpect descriptor: %{public}s", Str16ToStr8(descriptor).c_str());
+        return RET_FAILED;
+    }
+
+    int32_t msgCode =  static_cast<int32_t>(code);
+    if (msgCode == IPermActiveStatusCallback::PERM_ACTIVE_STATUS_CHANGE) {
+        sptr<ActiveChangeResponseParcel> resultSptr = data.ReadParcelable<ActiveChangeResponseParcel>();
+        if (resultSptr == nullptr) {
+            ACCESSTOKEN_LOG_ERROR(LABEL, "ReadParcelable fail");
+            return RET_FAILED;
+        }
+
+        ActiveStatusChangeCallback(resultSptr->changeResponse);
+    } else {
+        return IPCObjectStub::OnRemoteRequest(code, data, reply, option);
+    }
+    return RET_SUCCESS;
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/interfaces/innerkits/privacy/src/privacy_death_recipient.cpp b/interfaces/innerkits/privacy/src/privacy_death_recipient.cpp
index 6322643b8be21f810ddb9927475e048c49d7e8be..875c61b5cb2640c80eea59f3e490a890fc3545a8 100644
--- a/interfaces/innerkits/privacy/src/privacy_death_recipient.cpp
+++ b/interfaces/innerkits/privacy/src/privacy_death_recipient.cpp
@@ -1,36 +1,36 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-#include "privacy_death_recipient.h"
-
-#include "accesstoken_log.h"
-#include "privacy_manager_client.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-namespace {
-static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
-    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "PrivacyDeathRecipient"
-};
-} // namespace
-
-void PrivacyDeathRecipient::OnRemoteDied(const wptr<IRemoteObject>& object)
-{
-    ACCESSTOKEN_LOG_INFO(LABEL, "%{public}s called", __func__);
-    PrivacyManagerClient::GetInstance().OnRemoteDiedHandle();
-}
-}  // namespace AccessToken
-} // namespace Security
-}  // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+#include "privacy_death_recipient.h"
+
+#include "accesstoken_log.h"
+#include "privacy_manager_client.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+namespace {
+static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
+    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "PrivacyDeathRecipient"
+};
+} // namespace
+
+void PrivacyDeathRecipient::OnRemoteDied(const wptr<IRemoteObject>& object)
+{
+    ACCESSTOKEN_LOG_INFO(LABEL, "%{public}s called", __func__);
+    PrivacyManagerClient::GetInstance().OnRemoteDiedHandle();
+}
+}  // namespace AccessToken
+} // namespace Security
+}  // namespace OHOS
diff --git a/interfaces/innerkits/privacy/src/privacy_death_recipient.h b/interfaces/innerkits/privacy/src/privacy_death_recipient.h
index 5670393ace16b14f48572fda1a7531dea839cb75..18ed43f63512980395726ceb38cf838fd6ccfef3 100644
--- a/interfaces/innerkits/privacy/src/privacy_death_recipient.h
+++ b/interfaces/innerkits/privacy/src/privacy_death_recipient.h
@@ -1,35 +1,35 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-
-#ifndef PRIVACY_DEATH_RECIPIENT_H
-#define PRIVACY_DEATH_RECIPIENT_H
-
-#include "iremote_object.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class PrivacyDeathRecipient : public IRemoteObject::DeathRecipient {
-public:
-    PrivacyDeathRecipient() {}
-    virtual ~PrivacyDeathRecipient() = default;
-    void OnRemoteDied(const wptr<IRemoteObject>& object) override;
-};
-}  // namespace AccessToken
-} // namespace Security
-}  // namespace OHOS
-#endif  // PRIVACY_DEATH_RECIPIENT_H
-
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+
+#ifndef PRIVACY_DEATH_RECIPIENT_H
+#define PRIVACY_DEATH_RECIPIENT_H
+
+#include "iremote_object.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class PrivacyDeathRecipient : public IRemoteObject::DeathRecipient {
+public:
+    PrivacyDeathRecipient() {}
+    virtual ~PrivacyDeathRecipient() = default;
+    void OnRemoteDied(const wptr<IRemoteObject>& object) override;
+};
+}  // namespace AccessToken
+} // namespace Security
+}  // namespace OHOS
+#endif  // PRIVACY_DEATH_RECIPIENT_H
+
diff --git a/interfaces/innerkits/privacy/src/privacy_kit.cpp b/interfaces/innerkits/privacy/src/privacy_kit.cpp
index b6349f0b74854d561f40e57da995ad0dd769fce5..88c5a93231152e9ddb268ebc2d735022936d0e1c 100644
--- a/interfaces/innerkits/privacy/src/privacy_kit.cpp
+++ b/interfaces/innerkits/privacy/src/privacy_kit.cpp
@@ -1,91 +1,97 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "privacy_kit.h"
-
-#include <string>
-#include <vector>
-
-#include "accesstoken_log.h"
-#include "constant_common.h"
-#include "privacy_manager_client.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-namespace {
-static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {LOG_CORE, SECURITY_DOMAIN_PRIVACY, "PrivacyKit"};
-} // namespace
-
-int32_t PrivacyKit::AddPermissionUsedRecord(
-    AccessTokenID tokenID, const std::string& permissionName, int32_t successCount, int32_t failCount)
-{
-    ACCESSTOKEN_LOG_DEBUG(LABEL, "Entry, tokenID=0x%{public}x, permissionName=%{public}s,",
-        tokenID, permissionName.c_str());
-    return PrivacyManagerClient::GetInstance().AddPermissionUsedRecord(
-        tokenID, permissionName, successCount, failCount);
-}
-
-int32_t PrivacyKit::StartUsingPermission(AccessTokenID tokenID, const std::string& permissionName)
-{
-    ACCESSTOKEN_LOG_DEBUG(LABEL, "Entry, tokenID=0x%{public}x, permissionName=%{public}s",
-        tokenID, permissionName.c_str());
-    return PrivacyManagerClient::GetInstance().StartUsingPermission(tokenID, permissionName);
-}
-
-int32_t PrivacyKit::StopUsingPermission(AccessTokenID tokenID, const std::string& permissionName)
-{
-    ACCESSTOKEN_LOG_DEBUG(LABEL, "Entry, tokenID=0x%{public}x, permissionName=%{public}s",
-        tokenID, permissionName.c_str());
-    return PrivacyManagerClient::GetInstance().StopUsingPermission(tokenID, permissionName);
-}
-
-int32_t PrivacyKit::RemovePermissionUsedRecords(AccessTokenID tokenID, const std::string& deviceID)
-{
-    ACCESSTOKEN_LOG_DEBUG(LABEL, "Entry, tokenID=0x%{public}x, deviceID=%{public}s",
-        tokenID, ConstantCommon::EncryptDevId(deviceID).c_str());
-    return PrivacyManagerClient::GetInstance().RemovePermissionUsedRecords(tokenID, deviceID);
-}
-
-int32_t PrivacyKit::GetPermissionUsedRecords(const PermissionUsedRequest& request, PermissionUsedResult& result)
-{
-    return PrivacyManagerClient::GetInstance().GetPermissionUsedRecords(request, result);
-}
-
-int32_t PrivacyKit::GetPermissionUsedRecords(
-    const PermissionUsedRequest& request, const sptr<OnPermissionUsedRecordCallback>& callback)
-{
-    return PrivacyManagerClient::GetInstance().GetPermissionUsedRecords(request, callback);
-}
-
-std::string PrivacyKit::DumpRecordInfo(AccessTokenID tokenID, const std::string& permissionName)
-{
-    ACCESSTOKEN_LOG_DEBUG(LABEL, "Entry, tokenID=%{public}d, permissionName=%{public}s",
-        tokenID, permissionName.c_str());
-    return PrivacyManagerClient::GetInstance().DumpRecordInfo(tokenID, permissionName);
-}
-
-int32_t PrivacyKit::RegisterPermActiveStatusCallback(const std::shared_ptr<PermActiveStatusCustomizedCbk>& callback)
-{
-    return PrivacyManagerClient::GetInstance().RegisterPermActiveStatusCallback(callback);
-}
-
-int32_t PrivacyKit::UnRegisterPermActiveStatusCallback(const std::shared_ptr<PermActiveStatusCustomizedCbk>& callback)
-{
-    return PrivacyManagerClient::GetInstance().UnRegisterPermActiveStatusCallback(callback);
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "privacy_kit.h"
+
+#include <string>
+#include <vector>
+
+#include "accesstoken_log.h"
+#include "constant_common.h"
+#include "privacy_manager_client.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+namespace {
+static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {LOG_CORE, SECURITY_DOMAIN_PRIVACY, "PrivacyKit"};
+} // namespace
+
+int32_t PrivacyKit::AddPermissionUsedRecord(
+    AccessTokenID tokenID, const std::string& permissionName, int32_t successCount, int32_t failCount)
+{
+    ACCESSTOKEN_LOG_DEBUG(LABEL, "Entry, tokenID=0x%{public}x, permissionName=%{public}s,",
+        tokenID, permissionName.c_str());
+    return PrivacyManagerClient::GetInstance().AddPermissionUsedRecord(
+        tokenID, permissionName, successCount, failCount);
+}
+
+int32_t PrivacyKit::StartUsingPermission(AccessTokenID tokenID, const std::string& permissionName)
+{
+    ACCESSTOKEN_LOG_DEBUG(LABEL, "Entry, tokenID=0x%{public}x, permissionName=%{public}s",
+        tokenID, permissionName.c_str());
+    return PrivacyManagerClient::GetInstance().StartUsingPermission(tokenID, permissionName);
+}
+
+int32_t PrivacyKit::StopUsingPermission(AccessTokenID tokenID, const std::string& permissionName)
+{
+    ACCESSTOKEN_LOG_DEBUG(LABEL, "Entry, tokenID=0x%{public}x, permissionName=%{public}s",
+        tokenID, permissionName.c_str());
+    return PrivacyManagerClient::GetInstance().StopUsingPermission(tokenID, permissionName);
+}
+
+int32_t PrivacyKit::RemovePermissionUsedRecords(AccessTokenID tokenID, const std::string& deviceID)
+{
+    ACCESSTOKEN_LOG_DEBUG(LABEL, "Entry, tokenID=0x%{public}x, deviceID=%{public}s",
+        tokenID, ConstantCommon::EncryptDevId(deviceID).c_str());
+    return PrivacyManagerClient::GetInstance().RemovePermissionUsedRecords(tokenID, deviceID);
+}
+
+int32_t PrivacyKit::GetPermissionUsedRecords(const PermissionUsedRequest& request, PermissionUsedResult& result)
+{
+    return PrivacyManagerClient::GetInstance().GetPermissionUsedRecords(request, result);
+}
+
+int32_t PrivacyKit::GetPermissionUsedRecords(
+    const PermissionUsedRequest& request, const sptr<OnPermissionUsedRecordCallback>& callback)
+{
+    return PrivacyManagerClient::GetInstance().GetPermissionUsedRecords(request, callback);
+}
+
+std::string PrivacyKit::DumpRecordInfo(AccessTokenID tokenID, const std::string& permissionName)
+{
+    ACCESSTOKEN_LOG_DEBUG(LABEL, "Entry, tokenID=%{public}d, permissionName=%{public}s",
+        tokenID, permissionName.c_str());
+    return PrivacyManagerClient::GetInstance().DumpRecordInfo(tokenID, permissionName);
+}
+
+int32_t PrivacyKit::RegisterPermActiveStatusCallback(const std::shared_ptr<PermActiveStatusCustomizedCbk>& callback)
+{
+    return PrivacyManagerClient::GetInstance().RegisterPermActiveStatusCallback(callback);
+}
+
+int32_t PrivacyKit::UnRegisterPermActiveStatusCallback(const std::shared_ptr<PermActiveStatusCustomizedCbk>& callback)
+{
+    return PrivacyManagerClient::GetInstance().UnRegisterPermActiveStatusCallback(callback);
+}
+
+bool PrivacyKit::IsAllowUsingPermission(AccessTokenID tokenID, const std::string& permissionName)
+{
+    return PrivacyManagerClient::GetInstance().IsAllowUsingPermission(tokenID, permissionName); 
+}
+
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/interfaces/innerkits/privacy/src/privacy_manager_client.cpp b/interfaces/innerkits/privacy/src/privacy_manager_client.cpp
index 12ac9e296752de45807a434ade965eee3ee7ba92..0b912ff94ea805c98f33384b4bcd8ac39577edb0 100644
--- a/interfaces/innerkits/privacy/src/privacy_manager_client.cpp
+++ b/interfaces/innerkits/privacy/src/privacy_manager_client.cpp
@@ -1,272 +1,283 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-#include "privacy_manager_client.h"
-
-#include <algorithm>
-#include "accesstoken_log.h"
-#include "data_validator.h"
-#include "iservice_registry.h"
-#include "privacy_manager_proxy.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-namespace {
-static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
-    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "PrivacyManagerClient"
-};
-} // namespace
-
-const static int32_t ERROR = -1;
-const static int32_t MAX_PERM_LIST_SIZE = 200;
-
-PrivacyManagerClient& PrivacyManagerClient::GetInstance()
-{
-    static PrivacyManagerClient instance;
-    return instance;
-}
-
-PrivacyManagerClient::PrivacyManagerClient()
-{}
-
-PrivacyManagerClient::~PrivacyManagerClient()
-{}
-
-int32_t PrivacyManagerClient::AddPermissionUsedRecord(
-    AccessTokenID tokenID, const std::string& permissionName, int32_t successCount, int32_t failCount)
-{
-    if (!DataValidator::IsTokenIDValid(tokenID) || !DataValidator::IsPermissionNameValid(permissionName) ||
-        (successCount < 0 || failCount < 0)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "parameter is invalid");
-        return ERROR;
-    }
-    auto proxy = GetProxy();
-    if (proxy == nullptr) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "proxy is null");
-        return ERROR;
-    }
-    return proxy->AddPermissionUsedRecord(tokenID, permissionName, successCount, failCount);
-}
-
-int32_t PrivacyManagerClient::StartUsingPermission(AccessTokenID tokenID, const std::string& permissionName)
-{
-    if (!DataValidator::IsTokenIDValid(tokenID) || !DataValidator::IsPermissionNameValid(permissionName)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "parameter is invalid");
-        return ERROR;
-    }
-    auto proxy = GetProxy();
-    if (proxy == nullptr) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "proxy is null");
-        return ERROR;
-    }
-    return proxy->StartUsingPermission(tokenID, permissionName);
-}
-
-int32_t PrivacyManagerClient::StopUsingPermission(AccessTokenID tokenID, const std::string& permissionName)
-{
-    if (!DataValidator::IsTokenIDValid(tokenID) || !DataValidator::IsPermissionNameValid(permissionName)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "parameter is invalid");
-        return ERROR;
-    }
-    auto proxy = GetProxy();
-    if (proxy == nullptr) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "proxy is null");
-        return ERROR;
-    }
-    return proxy->StopUsingPermission(tokenID, permissionName);
-}
-
-int32_t PrivacyManagerClient::RemovePermissionUsedRecords(AccessTokenID tokenID, const std::string& deviceID)
-{
-    if (!DataValidator::IsTokenIDValid(tokenID) && !DataValidator::IsDeviceIdValid(deviceID)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "parameter is invalid");
-        return ERROR;
-    }
-    auto proxy = GetProxy();
-    if (proxy == nullptr) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "proxy is null");
-        return ERROR;
-    }
-    return proxy->RemovePermissionUsedRecords(tokenID, deviceID);
-}
-
-int32_t PrivacyManagerClient::GetPermissionUsedRecords(
-    const PermissionUsedRequest& request, PermissionUsedResult& result)
-{
-    auto proxy = GetProxy();
-    if (proxy == nullptr) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "proxy is null");
-        return ERROR;
-    }
-
-    PermissionUsedRequestParcel requestParcel;
-    PermissionUsedResultParcel reultParcel;
-    requestParcel.request = request;
-    int32_t ret = proxy->GetPermissionUsedRecords(requestParcel, reultParcel);
-    result = reultParcel.result;
-    return ret;
-}
-
-int32_t PrivacyManagerClient::GetPermissionUsedRecords(const PermissionUsedRequest& request,
-    const sptr<OnPermissionUsedRecordCallback>& callback)
-{
-    auto proxy = GetProxy();
-    if (proxy == nullptr) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "proxy is null");
-        return ERROR;
-    }
-
-    PermissionUsedRequestParcel requestParcel;
-    requestParcel.request = request;
-    return proxy->GetPermissionUsedRecords(requestParcel, callback);
-}
-
-std::string PrivacyManagerClient::DumpRecordInfo(AccessTokenID tokenID, const std::string& permissionName)
-{
-    auto proxy = GetProxy();
-    if (proxy == nullptr) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "proxy is null");
-        return "";
-    }
-
-    return proxy->DumpRecordInfo(tokenID, permissionName);
-}
-
-int32_t PrivacyManagerClient::CreateActiveStatusChangeCbk(
-    const std::shared_ptr<PermActiveStatusCustomizedCbk>& callback, sptr<IRemoteObject>& callbackObject)
-{
-    std::lock_guard<std::mutex> lock(activeCbkMutex_);
-
-    if (activeCbkMap_.size() == MAX_PERM_LIST_SIZE) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "the maximum number of subscribers has been reached");
-        return ERROR;
-    }
-
-    auto goalCallback = activeCbkMap_.find(callback);
-    if (goalCallback != activeCbkMap_.end()) {
-        callbackObject = goalCallback->second->AsObject();
-        ACCESSTOKEN_LOG_ERROR(LABEL, "activeCbkMap_ already has such callback");
-        return ERROR;
-    } else {
-        sptr<PermActiveStatusChangeCallback> callbackWraped =
-            new (std::nothrow) PermActiveStatusChangeCallback(callback);
-        if (!callbackWraped) {
-            ACCESSTOKEN_LOG_ERROR(LABEL, "memory allocation for callbackWraped failed!");
-            return ERROR;
-        }
-        ACCESSTOKEN_LOG_INFO(LABEL, "callbackObject added");
-        callbackObject = callbackWraped->AsObject();
-        activeCbkMap_[callback] = callbackWraped;
-    }
-    return RET_SUCCESS;
-}
-
-int32_t PrivacyManagerClient::RegisterPermActiveStatusCallback(
-    const std::shared_ptr<PermActiveStatusCustomizedCbk>& callback)
-{
-    ACCESSTOKEN_LOG_INFO(LABEL, "called!");
-    if (callback == nullptr) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "customizedCb is nullptr");
-        return ERROR;
-    }
-
-    sptr<IRemoteObject> callbackObject = nullptr;
-    int32_t result = CreateActiveStatusChangeCbk(callback, callbackObject);
-    if (result != RET_SUCCESS) {
-        return result;
-    }
-
-    auto proxy = GetProxy();
-    if (proxy == nullptr) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "proxy is null");
-        return ERROR;
-    }
-    std::vector<std::string> permList;
-    callback->GetPermList(permList);
-
-    return proxy->RegisterPermActiveStatusCallback(permList, callbackObject);
-}
-
-int32_t PrivacyManagerClient::UnRegisterPermActiveStatusCallback(
-    const std::shared_ptr<PermActiveStatusCustomizedCbk>& callback)
-{
-    ACCESSTOKEN_LOG_INFO(LABEL, "called!");
-
-    std::lock_guard<std::mutex> lock(activeCbkMutex_);
-    auto goalCallback = activeCbkMap_.find(callback);
-    if (goalCallback == activeCbkMap_.end()) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "goalCallback already is not exist");
-        return ERROR;
-    }
-
-    auto proxy = GetProxy();
-    if (proxy == nullptr) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "proxy is null");
-        return ERROR;
-    }
-
-    int32_t result = proxy->UnRegisterPermActiveStatusCallback(goalCallback->second->AsObject());
-    if (result == RET_SUCCESS) {
-        activeCbkMap_.erase(goalCallback);
-    }
-    return result;
-}
-
-void PrivacyManagerClient::InitProxy()
-{
-    std::lock_guard<std::mutex> lock(proxyMutex_);
-    if (proxy_ == nullptr) {
-        auto sam = SystemAbilityManagerClient::GetInstance().GetSystemAbilityManager();
-        if (sam == nullptr) {
-            ACCESSTOKEN_LOG_DEBUG(LABEL, "GetSystemAbilityManager is null");
-            return;
-        }
-        auto privacySa = sam->GetSystemAbility(IPrivacyManager::SA_ID_PRIVACY_MANAGER_SERVICE);
-        if (privacySa == nullptr) {
-            ACCESSTOKEN_LOG_DEBUG(LABEL, "GetSystemAbility %{public}d is null",
-                IPrivacyManager::SA_ID_PRIVACY_MANAGER_SERVICE);
-            return;
-        }
-
-        serviceDeathObserver_ = new (std::nothrow) PrivacyDeathRecipient();
-        if (serviceDeathObserver_ != nullptr) {
-            privacySa->AddDeathRecipient(serviceDeathObserver_);
-        }
-        proxy_ = iface_cast<IPrivacyManager>(privacySa);
-        if (proxy_ == nullptr) {
-            ACCESSTOKEN_LOG_DEBUG(LABEL, "iface_cast get null");
-        }
-    }
-}
-
-void PrivacyManagerClient::OnRemoteDiedHandle()
-{
-    {
-        std::lock_guard<std::mutex> lock(proxyMutex_);
-        proxy_ = nullptr;
-    }
-    InitProxy();
-}
-
-sptr<IPrivacyManager> PrivacyManagerClient::GetProxy()
-{
-    if (proxy_ == nullptr) {
-        InitProxy();
-    }
-    return proxy_;
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+#include "privacy_manager_client.h"
+
+#include <algorithm>
+#include "accesstoken_log.h"
+#include "data_validator.h"
+#include "iservice_registry.h"
+#include "privacy_manager_proxy.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+namespace {
+static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
+    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "PrivacyManagerClient"
+};
+} // namespace
+
+const static int32_t ERROR = -1;
+const static int32_t MAX_PERM_LIST_SIZE = 200;
+
+PrivacyManagerClient& PrivacyManagerClient::GetInstance()
+{
+    static PrivacyManagerClient instance;
+    return instance;
+}
+
+PrivacyManagerClient::PrivacyManagerClient()
+{}
+
+PrivacyManagerClient::~PrivacyManagerClient()
+{}
+
+int32_t PrivacyManagerClient::AddPermissionUsedRecord(
+    AccessTokenID tokenID, const std::string& permissionName, int32_t successCount, int32_t failCount)
+{
+    if (!DataValidator::IsTokenIDValid(tokenID) || !DataValidator::IsPermissionNameValid(permissionName) ||
+        (successCount < 0 || failCount < 0)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "parameter is invalid");
+        return ERROR;
+    }
+    auto proxy = GetProxy();
+    if (proxy == nullptr) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "proxy is null");
+        return ERROR;
+    }
+    return proxy->AddPermissionUsedRecord(tokenID, permissionName, successCount, failCount);
+}
+
+int32_t PrivacyManagerClient::StartUsingPermission(AccessTokenID tokenID, const std::string& permissionName)
+{
+    if (!DataValidator::IsTokenIDValid(tokenID) || !DataValidator::IsPermissionNameValid(permissionName)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "parameter is invalid");
+        return ERROR;
+    }
+    auto proxy = GetProxy();
+    if (proxy == nullptr) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "proxy is null");
+        return ERROR;
+    }
+    return proxy->StartUsingPermission(tokenID, permissionName);
+}
+
+int32_t PrivacyManagerClient::StopUsingPermission(AccessTokenID tokenID, const std::string& permissionName)
+{
+    if (!DataValidator::IsTokenIDValid(tokenID) || !DataValidator::IsPermissionNameValid(permissionName)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "parameter is invalid");
+        return ERROR;
+    }
+    auto proxy = GetProxy();
+    if (proxy == nullptr) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "proxy is null");
+        return ERROR;
+    }
+    return proxy->StopUsingPermission(tokenID, permissionName);
+}
+
+int32_t PrivacyManagerClient::RemovePermissionUsedRecords(AccessTokenID tokenID, const std::string& deviceID)
+{
+    if (!DataValidator::IsTokenIDValid(tokenID) && !DataValidator::IsDeviceIdValid(deviceID)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "parameter is invalid");
+        return ERROR;
+    }
+    auto proxy = GetProxy();
+    if (proxy == nullptr) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "proxy is null");
+        return ERROR;
+    }
+    return proxy->RemovePermissionUsedRecords(tokenID, deviceID);
+}
+
+int32_t PrivacyManagerClient::GetPermissionUsedRecords(
+    const PermissionUsedRequest& request, PermissionUsedResult& result)
+{
+    auto proxy = GetProxy();
+    if (proxy == nullptr) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "proxy is null");
+        return ERROR;
+    }
+
+    PermissionUsedRequestParcel requestParcel;
+    PermissionUsedResultParcel reultParcel;
+    requestParcel.request = request;
+    int32_t ret = proxy->GetPermissionUsedRecords(requestParcel, reultParcel);
+    result = reultParcel.result;
+    return ret;
+}
+
+int32_t PrivacyManagerClient::GetPermissionUsedRecords(const PermissionUsedRequest& request,
+    const sptr<OnPermissionUsedRecordCallback>& callback)
+{
+    auto proxy = GetProxy();
+    if (proxy == nullptr) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "proxy is null");
+        return ERROR;
+    }
+
+    PermissionUsedRequestParcel requestParcel;
+    requestParcel.request = request;
+    return proxy->GetPermissionUsedRecords(requestParcel, callback);
+}
+
+std::string PrivacyManagerClient::DumpRecordInfo(AccessTokenID tokenID, const std::string& permissionName)
+{
+    auto proxy = GetProxy();
+    if (proxy == nullptr) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "proxy is null");
+        return "";
+    }
+
+    return proxy->DumpRecordInfo(tokenID, permissionName);
+}
+
+int32_t PrivacyManagerClient::CreateActiveStatusChangeCbk(
+    const std::shared_ptr<PermActiveStatusCustomizedCbk>& callback, sptr<IRemoteObject>& callbackObject)
+{
+    std::lock_guard<std::mutex> lock(activeCbkMutex_);
+
+    if (activeCbkMap_.size() == MAX_PERM_LIST_SIZE) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "the maximum number of subscribers has been reached");
+        return ERROR;
+    }
+
+    auto goalCallback = activeCbkMap_.find(callback);
+    if (goalCallback != activeCbkMap_.end()) {
+        callbackObject = goalCallback->second->AsObject();
+        ACCESSTOKEN_LOG_ERROR(LABEL, "activeCbkMap_ already has such callback");
+        return ERROR;
+    } else {
+        sptr<PermActiveStatusChangeCallback> callbackWraped =
+            new (std::nothrow) PermActiveStatusChangeCallback(callback);
+        if (!callbackWraped) {
+            ACCESSTOKEN_LOG_ERROR(LABEL, "memory allocation for callbackWraped failed!");
+            return ERROR;
+        }
+        ACCESSTOKEN_LOG_INFO(LABEL, "callbackObject added");
+        callbackObject = callbackWraped->AsObject();
+        activeCbkMap_[callback] = callbackWraped;
+    }
+    return RET_SUCCESS;
+}
+
+int32_t PrivacyManagerClient::RegisterPermActiveStatusCallback(
+    const std::shared_ptr<PermActiveStatusCustomizedCbk>& callback)
+{
+    ACCESSTOKEN_LOG_INFO(LABEL, "called!");
+    if (callback == nullptr) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "customizedCb is nullptr");
+        return ERROR;
+    }
+
+    sptr<IRemoteObject> callbackObject = nullptr;
+    int32_t result = CreateActiveStatusChangeCbk(callback, callbackObject);
+    if (result != RET_SUCCESS) {
+        return result;
+    }
+
+    auto proxy = GetProxy();
+    if (proxy == nullptr) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "proxy is null");
+        return ERROR;
+    }
+    std::vector<std::string> permList;
+    callback->GetPermList(permList);
+
+    return proxy->RegisterPermActiveStatusCallback(permList, callbackObject);
+}
+
+int32_t PrivacyManagerClient::UnRegisterPermActiveStatusCallback(
+    const std::shared_ptr<PermActiveStatusCustomizedCbk>& callback)
+{
+    ACCESSTOKEN_LOG_INFO(LABEL, "called!");
+
+    std::lock_guard<std::mutex> lock(activeCbkMutex_);
+    auto goalCallback = activeCbkMap_.find(callback);
+    if (goalCallback == activeCbkMap_.end()) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "goalCallback already is not exist");
+        return ERROR;
+    }
+
+    auto proxy = GetProxy();
+    if (proxy == nullptr) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "proxy is null");
+        return ERROR;
+    }
+
+    int32_t result = proxy->UnRegisterPermActiveStatusCallback(goalCallback->second->AsObject());
+    if (result == RET_SUCCESS) {
+        activeCbkMap_.erase(goalCallback);
+    }
+    return result;
+}
+
+void PrivacyManagerClient::InitProxy()
+{
+    std::lock_guard<std::mutex> lock(proxyMutex_);
+    if (proxy_ == nullptr) {
+        auto sam = SystemAbilityManagerClient::GetInstance().GetSystemAbilityManager();
+        if (sam == nullptr) {
+            ACCESSTOKEN_LOG_DEBUG(LABEL, "GetSystemAbilityManager is null");
+            return;
+        }
+        auto privacySa = sam->GetSystemAbility(IPrivacyManager::SA_ID_PRIVACY_MANAGER_SERVICE);
+        if (privacySa == nullptr) {
+            ACCESSTOKEN_LOG_DEBUG(LABEL, "GetSystemAbility %{public}d is null",
+                IPrivacyManager::SA_ID_PRIVACY_MANAGER_SERVICE);
+            return;
+        }
+
+        serviceDeathObserver_ = new (std::nothrow) PrivacyDeathRecipient();
+        if (serviceDeathObserver_ != nullptr) {
+            privacySa->AddDeathRecipient(serviceDeathObserver_);
+        }
+        proxy_ = iface_cast<IPrivacyManager>(privacySa);
+        if (proxy_ == nullptr) {
+            ACCESSTOKEN_LOG_DEBUG(LABEL, "iface_cast get null");
+        }
+    }
+}
+
+bool PrivacyManagerClient::IsAllowUsingPermission(AccessTokenID tokenID, const std::string& permissionName)
+{
+    auto proxy = GetProxy();
+    if (proxy == nullptr) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "proxy is null");
+        return false;
+    }
+
+    return proxy->IsAllowUsingPermission(tokenID, permissionName);
+}
+
+void PrivacyManagerClient::OnRemoteDiedHandle()
+{
+    {
+        std::lock_guard<std::mutex> lock(proxyMutex_);
+        proxy_ = nullptr;
+    }
+    InitProxy();
+}
+
+sptr<IPrivacyManager> PrivacyManagerClient::GetProxy()
+{
+    if (proxy_ == nullptr) {
+        InitProxy();
+    }
+    return proxy_;
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/interfaces/innerkits/privacy/src/privacy_manager_client.h b/interfaces/innerkits/privacy/src/privacy_manager_client.h
index ee288ad69046c9f73dca259255ab43a13e0366b2..df77b37e0a5740b29c99fd96ca3c8584287b21e1 100644
--- a/interfaces/innerkits/privacy/src/privacy_manager_client.h
+++ b/interfaces/innerkits/privacy/src/privacy_manager_client.h
@@ -1,70 +1,70 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef PRIVACY_MANAGER_CLIENT_H
-#define PRIVACY_MANAGER_CLIENT_H
-
-#include <map>
-#include <mutex>
-#include <string>
-#include <vector>
-
-#include "i_privacy_manager.h"
-#include "perm_active_status_change_callback.h"
-#include "perm_active_status_customized_cbk.h"
-#include "privacy_death_recipient.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class PrivacyManagerClient final {
-public:
-    static PrivacyManagerClient& GetInstance();
-
-    virtual ~PrivacyManagerClient();
-
-    int32_t AddPermissionUsedRecord(
-        AccessTokenID tokenID, const std::string& permissionName, int32_t successCount, int32_t failCount);
-    int32_t StartUsingPermission(AccessTokenID tokenID, const std::string& permissionName);
-    int32_t StopUsingPermission(AccessTokenID tokenID, const std::string& permissionName);
-    int32_t RemovePermissionUsedRecords(AccessTokenID tokenID, const std::string& deviceID);
-    int32_t GetPermissionUsedRecords(const PermissionUsedRequest& request, PermissionUsedResult& result);
-    int32_t GetPermissionUsedRecords(
-        const PermissionUsedRequest& request, const sptr<OnPermissionUsedRecordCallback>& callback);
-    std::string DumpRecordInfo(AccessTokenID tokenID, const std::string& permissionName);
-    int32_t RegisterPermActiveStatusCallback(const std::shared_ptr<PermActiveStatusCustomizedCbk>& callback);
-    int32_t UnRegisterPermActiveStatusCallback(const std::shared_ptr<PermActiveStatusCustomizedCbk>& callback);
-    int32_t CreateActiveStatusChangeCbk(
-        const std::shared_ptr<PermActiveStatusCustomizedCbk>& callback, sptr<IRemoteObject>& callbackObject);
-
-    void OnRemoteDiedHandle();
-private:
-    PrivacyManagerClient();
-
-    DISALLOW_COPY_AND_MOVE(PrivacyManagerClient);
-    std::mutex proxyMutex_;
-    sptr<IPrivacyManager> proxy_ = nullptr;
-    sptr<PrivacyDeathRecipient> serviceDeathObserver_ = nullptr;
-    void InitProxy();
-    sptr<IPrivacyManager> GetProxy();
-
-private:
-    std::mutex activeCbkMutex_;
-    std::map<std::shared_ptr<PermActiveStatusCustomizedCbk>, sptr<PermActiveStatusChangeCallback>> activeCbkMap_;
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-#endif // PRIVACY_MANAGER_CLIENT_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef PRIVACY_MANAGER_CLIENT_H
+#define PRIVACY_MANAGER_CLIENT_H
+
+#include <map>
+#include <mutex>
+#include <string>
+#include <vector>
+
+#include "i_privacy_manager.h"
+#include "perm_active_status_change_callback.h"
+#include "perm_active_status_customized_cbk.h"
+#include "privacy_death_recipient.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class PrivacyManagerClient final {
+public:
+    static PrivacyManagerClient& GetInstance();
+
+    virtual ~PrivacyManagerClient();
+
+    int32_t AddPermissionUsedRecord(
+        AccessTokenID tokenID, const std::string& permissionName, int32_t successCount, int32_t failCount);
+    int32_t StartUsingPermission(AccessTokenID tokenID, const std::string& permissionName);
+    int32_t StopUsingPermission(AccessTokenID tokenID, const std::string& permissionName);
+    int32_t RemovePermissionUsedRecords(AccessTokenID tokenID, const std::string& deviceID);
+    int32_t GetPermissionUsedRecords(const PermissionUsedRequest& request, PermissionUsedResult& result);
+    int32_t GetPermissionUsedRecords(
+        const PermissionUsedRequest& request, const sptr<OnPermissionUsedRecordCallback>& callback);
+    std::string DumpRecordInfo(AccessTokenID tokenID, const std::string& permissionName);
+    int32_t RegisterPermActiveStatusCallback(const std::shared_ptr<PermActiveStatusCustomizedCbk>& callback);
+    int32_t UnRegisterPermActiveStatusCallback(const std::shared_ptr<PermActiveStatusCustomizedCbk>& callback);
+    int32_t CreateActiveStatusChangeCbk(
+        const std::shared_ptr<PermActiveStatusCustomizedCbk>& callback, sptr<IRemoteObject>& callbackObject);
+    bool IsAllowUsingPermission(AccessTokenID tokenID, const std::string& permissionName);
+    void OnRemoteDiedHandle();
+private:
+    PrivacyManagerClient();
+
+    DISALLOW_COPY_AND_MOVE(PrivacyManagerClient);
+    std::mutex proxyMutex_;
+    sptr<IPrivacyManager> proxy_ = nullptr;
+    sptr<PrivacyDeathRecipient> serviceDeathObserver_ = nullptr;
+    void InitProxy();
+    sptr<IPrivacyManager> GetProxy();
+
+private:
+    std::mutex activeCbkMutex_;
+    std::map<std::shared_ptr<PermActiveStatusCustomizedCbk>, sptr<PermActiveStatusChangeCallback>> activeCbkMap_;
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+#endif // PRIVACY_MANAGER_CLIENT_H
diff --git a/interfaces/innerkits/privacy/src/privacy_manager_proxy.cpp b/interfaces/innerkits/privacy/src/privacy_manager_proxy.cpp
index 0014a3c02e8daa7e24f28dc6eb9c0fa2b28b52a2..b57f80e27e4031b56f2911029f9315ba66d70527 100644
--- a/interfaces/innerkits/privacy/src/privacy_manager_proxy.cpp
+++ b/interfaces/innerkits/privacy/src/privacy_manager_proxy.cpp
@@ -1,317 +1,340 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "privacy_manager_proxy.h"
-
-#include "accesstoken_log.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-namespace {
-static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
-    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "PrivacyManagerProxy"
-};
-}
-
-const static int32_t ERROR = -1;
-
-PrivacyManagerProxy::PrivacyManagerProxy(const sptr<IRemoteObject>& impl)
-    : IRemoteProxy<IPrivacyManager>(impl) {
-}
-
-PrivacyManagerProxy::~PrivacyManagerProxy()
-{}
-
-int32_t PrivacyManagerProxy::AddPermissionUsedRecord(AccessTokenID tokenID, const std::string& permissionName,
-    int32_t successCount, int32_t failCount)
-{
-    MessageParcel data;
-    data.WriteInterfaceToken(IPrivacyManager::GetDescriptor());
-    if (!data.WriteUint32(tokenID)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteUint32(%{public}d)", tokenID);
-        return ERROR;
-    }
-    if (!data.WriteString(permissionName)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteString(permissionName)");
-        return ERROR;
-    }
-    if (!data.WriteInt32(successCount)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteUint32(successCount)");
-        return ERROR;
-    }
-    if (!data.WriteInt32(failCount)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteUint32(failCount)");
-        return ERROR;
-    }
-
-    MessageParcel reply;
-    int32_t requestResult = SendRequest(IPrivacyManager::InterfaceCode::ADD_PERMISSION_USED_RECORD, data, reply);
-    if (!requestResult) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "add result fail, result: %{public}d", requestResult);
-    }
-    int32_t ret = reply.ReadInt32();
-    ACCESSTOKEN_LOG_DEBUG(LABEL, "get result from server data = %{public}d", ret);
-    return ret;
-}
-
-int32_t PrivacyManagerProxy::StartUsingPermission(AccessTokenID tokenID, const std::string& permissionName)
-{
-    MessageParcel data;
-    data.WriteInterfaceToken(IPrivacyManager::GetDescriptor());
-    if (!data.WriteUint32(tokenID)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteUint32(%{public}d)", tokenID);
-        return ERROR;
-    }
-    if (!data.WriteString(permissionName)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteString(permissionName)");
-        return ERROR;
-    }
-
-    MessageParcel reply;
-    int32_t requestResult = SendRequest(IPrivacyManager::InterfaceCode::START_USING_PERMISSION, data, reply);
-    if (!requestResult) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "add result fail, result: %{public}d", requestResult);
-    }
-    int32_t ret = reply.ReadInt32();
-    ACCESSTOKEN_LOG_DEBUG(LABEL, "get result from server data = %{public}d", ret);
-    return ret;
-}
-
-int32_t PrivacyManagerProxy::StopUsingPermission(AccessTokenID tokenID, const std::string& permissionName)
-{
-    MessageParcel data;
-    data.WriteInterfaceToken(IPrivacyManager::GetDescriptor());
-    if (!data.WriteUint32(tokenID)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteUint32(%{public}d)", tokenID);
-        return ERROR;
-    }
-    if (!data.WriteString(permissionName)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteString(permissionName)");
-        return ERROR;
-    }
-
-    MessageParcel reply;
-    int32_t requestResult = SendRequest(IPrivacyManager::InterfaceCode::STOP_USING_PERMISSION, data, reply);
-    if (!requestResult) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "add result fail, result: %{public}d", requestResult);
-    }
-    int32_t ret = reply.ReadInt32();
-    ACCESSTOKEN_LOG_DEBUG(LABEL, "get result from server data = %{public}d", ret);
-    return ret;
-}
-
-int32_t PrivacyManagerProxy::RemovePermissionUsedRecords(AccessTokenID tokenID, const std::string& deviceID)
-{
-    MessageParcel data;
-    data.WriteInterfaceToken(IPrivacyManager::GetDescriptor());
-    if (!data.WriteUint32(tokenID)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteUint32(%{public}d)", tokenID);
-        return ERROR;
-    }
-    if (!data.WriteString(deviceID)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteString(deviceID)");
-        return ERROR;
-    }
-
-    MessageParcel reply;
-    int32_t requestResult = SendRequest(IPrivacyManager::InterfaceCode::DELETE_PERMISSION_USED_RECORDS, data, reply);
-    if (!requestResult) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "add result fail, result: %{public}d", requestResult);
-    }
-    int32_t ret = reply.ReadInt32();
-    ACCESSTOKEN_LOG_DEBUG(LABEL, "get result from server data = %{public}d", ret);
-    return ret;
-}
-
-int32_t PrivacyManagerProxy::GetPermissionUsedRecords(const PermissionUsedRequestParcel& request,
-    PermissionUsedResultParcel& result)
-{
-    MessageParcel data;
-    data.WriteInterfaceToken(IPrivacyManager::GetDescriptor());
-    if (!data.WriteParcelable(&request)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteParcelable(request)");
-        return ERROR;
-    }
-
-    MessageParcel reply;
-    int32_t requestResult = SendRequest(IPrivacyManager::InterfaceCode::GET_PERMISSION_USED_RECORDS, data, reply);
-    if (!requestResult) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "send request fail, result: %{public}d", requestResult);
-        return ERROR;
-    }
-
-    sptr<PermissionUsedResultParcel> resultSptr = reply.ReadParcelable<PermissionUsedResultParcel>();
-    if (resultSptr == nullptr) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "ReadParcelable fail");
-        return ERROR;
-    }
-    result = *resultSptr;
-    int32_t ret = reply.ReadInt32();
-    ACCESSTOKEN_LOG_DEBUG(LABEL, "get result from server data = %{public}d", ret);
-    return ret;
-}
-
-int32_t PrivacyManagerProxy::GetPermissionUsedRecords(const PermissionUsedRequestParcel& request,
-    const sptr<OnPermissionUsedRecordCallback>& callback)
-{
-    MessageParcel data;
-    data.WriteInterfaceToken(IPrivacyManager::GetDescriptor());
-    if (!data.WriteParcelable(&request)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteParcelable(request)");
-        return ERROR;
-    }
-    if (!data.WriteRemoteObject(callback->AsObject())) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteRemoteObject(callback)");
-        return ERROR;
-    }
-
-    MessageParcel reply;
-    int32_t requestResult = SendRequest(IPrivacyManager::InterfaceCode::GET_PERMISSION_USED_RECORDS_ASYNC, data, reply);
-    if (!requestResult) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "send request fail, result: %{public}d", requestResult);
-        return ERROR;
-    }
-    int32_t ret = reply.ReadInt32();
-    ACCESSTOKEN_LOG_DEBUG(LABEL, "get result from server data = %{public}d", ret);
-    return ret;
-}
-
-std::string PrivacyManagerProxy::DumpRecordInfo(AccessTokenID tokenID, const std::string& permissionName)
-{
-    MessageParcel data;
-    MessageParcel reply;
-    data.WriteInterfaceToken(IPrivacyManager::GetDescriptor());
-    if (!data.WriteUint32(tokenID)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteUint32(%{public}d)", tokenID);
-        return "";
-    }
-    if (!data.WriteString(permissionName)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteString(%{public}s)", permissionName.c_str());
-        return "";
-    }
-    int32_t requestResult = SendRequest(IPrivacyManager::InterfaceCode::DUMP_RECORD_INFO, data, reply);
-    if (!requestResult) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "send request fail, result: %{public}d", requestResult);
-        return "";
-    }
-    std::string dumpInfo = reply.ReadString();
-    return dumpInfo;
-}
-
-int32_t PrivacyManagerProxy::RegisterPermActiveStatusCallback(
-    std::vector<std::string>& permList, const sptr<IRemoteObject>& callback)
-{
-    ACCESSTOKEN_LOG_INFO(LABEL, "called.");
-    MessageParcel data;
-    if (!data.WriteInterfaceToken(IPrivacyManager::GetDescriptor())) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to write WriteInterfaceToken.");
-        return ERROR;
-    }
-
-    uint32_t listSize = permList.size();
-    if (!data.WriteUint32(listSize)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to write listSize");
-        return ERROR;
-    }
-    for (uint32_t i = 0; i < listSize; i++) {
-        if (!data.WriteString(permList[i])) {
-            ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to write permList[%{public}d], %{public}s", i, permList[i].c_str());
-            return ERROR;
-        }
-    }
-
-    if (!data.WriteRemoteObject(callback)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to write remote object.");
-        return ERROR;
-    }
-    MessageParcel reply;
-    MessageOption option(MessageOption::TF_SYNC);
-    sptr<IRemoteObject> remote = Remote();
-    if (remote == nullptr) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "remote service null.");
-        return ERROR;
-    }
-    int32_t requestResult = remote->SendRequest(
-        static_cast<uint32_t>(IPrivacyManager::InterfaceCode::REGISTER_PERM_ACTIVE_STATUS_CHANGE_CALLBACK),
-        data, reply, option);
-    if (requestResult != NO_ERROR) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "request fail, result: %{public}d.", requestResult);
-        return ERROR;
-    }
-
-    int32_t result;
-    if (!reply.ReadInt32(result)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "ReadInt32 fail");
-        return ERROR;
-    }
-    return result;
-}
-
-int32_t PrivacyManagerProxy::UnRegisterPermActiveStatusCallback(const sptr<IRemoteObject>& callback)
-{
-    ACCESSTOKEN_LOG_INFO(LABEL, "called.");
-    MessageParcel data;
-    if (!data.WriteInterfaceToken(IPrivacyManager::GetDescriptor())) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to write WriteInterfaceToken.");
-        return ERROR;
-    }
-    if (!data.WriteRemoteObject(callback)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to write remote object.");
-        return ERROR;
-    }
-    MessageParcel reply;
-    MessageOption option(MessageOption::TF_SYNC);
-    sptr<IRemoteObject> remote = Remote();
-    if (remote == nullptr) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "remote service null.");
-        return ERROR;
-    }
-    int32_t requestResult = remote->SendRequest(
-        static_cast<uint32_t>(IPrivacyManager::InterfaceCode::UNREGISTER_PERM_ACTIVE_STATUS_CHANGE_CALLBACK),
-        data, reply, option);
-    if (requestResult != NO_ERROR) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "request fail, result: %{public}d.", requestResult);
-        return ERROR;
-    }
-
-    int32_t result;
-    if (!reply.ReadInt32(result)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "ReadInt32 fail");
-        return ERROR;
-    }
-    return result;
-}
-
-bool PrivacyManagerProxy::SendRequest(
-    IPrivacyManager::InterfaceCode code, MessageParcel& data, MessageParcel& reply)
-{
-    MessageOption option(MessageOption::TF_SYNC);
-    sptr<IRemoteObject> remote = Remote();
-    if (remote == nullptr) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "remote service null.");
-        return false;
-    }
-
-    int32_t result = remote->SendRequest(static_cast<uint32_t>(code), data, reply, option);
-    if (result != NO_ERROR) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "SendRequest fail, result: %{public}d", result);
-        return false;
-    }
-    return true;
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "privacy_manager_proxy.h"
+
+#include "accesstoken_log.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+namespace {
+static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
+    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "PrivacyManagerProxy"
+};
+}
+
+const static int32_t ERROR = -1;
+
+PrivacyManagerProxy::PrivacyManagerProxy(const sptr<IRemoteObject>& impl)
+    : IRemoteProxy<IPrivacyManager>(impl) {
+}
+
+PrivacyManagerProxy::~PrivacyManagerProxy()
+{}
+
+int32_t PrivacyManagerProxy::AddPermissionUsedRecord(AccessTokenID tokenID, const std::string& permissionName,
+    int32_t successCount, int32_t failCount)
+{
+    MessageParcel data;
+    data.WriteInterfaceToken(IPrivacyManager::GetDescriptor());
+    if (!data.WriteUint32(tokenID)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteUint32(%{public}d)", tokenID);
+        return ERROR;
+    }
+    if (!data.WriteString(permissionName)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteString(permissionName)");
+        return ERROR;
+    }
+    if (!data.WriteInt32(successCount)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteUint32(successCount)");
+        return ERROR;
+    }
+    if (!data.WriteInt32(failCount)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteUint32(failCount)");
+        return ERROR;
+    }
+
+    MessageParcel reply;
+    int32_t requestResult = SendRequest(IPrivacyManager::InterfaceCode::ADD_PERMISSION_USED_RECORD, data, reply);
+    if (!requestResult) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "add result fail, result: %{public}d", requestResult);
+    }
+    int32_t ret = reply.ReadInt32();
+    ACCESSTOKEN_LOG_DEBUG(LABEL, "get result from server data = %{public}d", ret);
+    return ret;
+}
+
+int32_t PrivacyManagerProxy::StartUsingPermission(AccessTokenID tokenID, const std::string& permissionName)
+{
+    MessageParcel data;
+    data.WriteInterfaceToken(IPrivacyManager::GetDescriptor());
+    if (!data.WriteUint32(tokenID)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteUint32(%{public}d)", tokenID);
+        return ERROR;
+    }
+    if (!data.WriteString(permissionName)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteString(permissionName)");
+        return ERROR;
+    }
+
+    MessageParcel reply;
+    int32_t requestResult = SendRequest(IPrivacyManager::InterfaceCode::START_USING_PERMISSION, data, reply);
+    if (!requestResult) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "add result fail, result: %{public}d", requestResult);
+    }
+    int32_t ret = reply.ReadInt32();
+    ACCESSTOKEN_LOG_DEBUG(LABEL, "get result from server data = %{public}d", ret);
+    return ret;
+}
+
+int32_t PrivacyManagerProxy::StopUsingPermission(AccessTokenID tokenID, const std::string& permissionName)
+{
+    MessageParcel data;
+    data.WriteInterfaceToken(IPrivacyManager::GetDescriptor());
+    if (!data.WriteUint32(tokenID)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteUint32(%{public}d)", tokenID);
+        return ERROR;
+    }
+    if (!data.WriteString(permissionName)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteString(permissionName)");
+        return ERROR;
+    }
+
+    MessageParcel reply;
+    int32_t requestResult = SendRequest(IPrivacyManager::InterfaceCode::STOP_USING_PERMISSION, data, reply);
+    if (!requestResult) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "add result fail, result: %{public}d", requestResult);
+    }
+    int32_t ret = reply.ReadInt32();
+    ACCESSTOKEN_LOG_DEBUG(LABEL, "get result from server data = %{public}d", ret);
+    return ret;
+}
+
+int32_t PrivacyManagerProxy::RemovePermissionUsedRecords(AccessTokenID tokenID, const std::string& deviceID)
+{
+    MessageParcel data;
+    data.WriteInterfaceToken(IPrivacyManager::GetDescriptor());
+    if (!data.WriteUint32(tokenID)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteUint32(%{public}d)", tokenID);
+        return ERROR;
+    }
+    if (!data.WriteString(deviceID)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteString(deviceID)");
+        return ERROR;
+    }
+
+    MessageParcel reply;
+    int32_t requestResult = SendRequest(IPrivacyManager::InterfaceCode::DELETE_PERMISSION_USED_RECORDS, data, reply);
+    if (!requestResult) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "add result fail, result: %{public}d", requestResult);
+    }
+    int32_t ret = reply.ReadInt32();
+    ACCESSTOKEN_LOG_DEBUG(LABEL, "get result from server data = %{public}d", ret);
+    return ret;
+}
+
+int32_t PrivacyManagerProxy::GetPermissionUsedRecords(const PermissionUsedRequestParcel& request,
+    PermissionUsedResultParcel& result)
+{
+    MessageParcel data;
+    data.WriteInterfaceToken(IPrivacyManager::GetDescriptor());
+    if (!data.WriteParcelable(&request)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteParcelable(request)");
+        return ERROR;
+    }
+
+    MessageParcel reply;
+    int32_t requestResult = SendRequest(IPrivacyManager::InterfaceCode::GET_PERMISSION_USED_RECORDS, data, reply);
+    if (!requestResult) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "send request fail, result: %{public}d", requestResult);
+        return ERROR;
+    }
+
+    sptr<PermissionUsedResultParcel> resultSptr = reply.ReadParcelable<PermissionUsedResultParcel>();
+    if (resultSptr == nullptr) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "ReadParcelable fail");
+        return ERROR;
+    }
+    result = *resultSptr;
+    int32_t ret = reply.ReadInt32();
+    ACCESSTOKEN_LOG_DEBUG(LABEL, "get result from server data = %{public}d", ret);
+    return ret;
+}
+
+int32_t PrivacyManagerProxy::GetPermissionUsedRecords(const PermissionUsedRequestParcel& request,
+    const sptr<OnPermissionUsedRecordCallback>& callback)
+{
+    MessageParcel data;
+    data.WriteInterfaceToken(IPrivacyManager::GetDescriptor());
+    if (!data.WriteParcelable(&request)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteParcelable(request)");
+        return ERROR;
+    }
+    if (!data.WriteRemoteObject(callback->AsObject())) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteRemoteObject(callback)");
+        return ERROR;
+    }
+
+    MessageParcel reply;
+    int32_t requestResult = SendRequest(IPrivacyManager::InterfaceCode::GET_PERMISSION_USED_RECORDS_ASYNC, data, reply);
+    if (!requestResult) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "send request fail, result: %{public}d", requestResult);
+        return ERROR;
+    }
+    int32_t ret = reply.ReadInt32();
+    ACCESSTOKEN_LOG_DEBUG(LABEL, "get result from server data = %{public}d", ret);
+    return ret;
+}
+
+std::string PrivacyManagerProxy::DumpRecordInfo(AccessTokenID tokenID, const std::string& permissionName)
+{
+    MessageParcel data;
+    MessageParcel reply;
+    data.WriteInterfaceToken(IPrivacyManager::GetDescriptor());
+    if (!data.WriteUint32(tokenID)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteUint32(%{public}d)", tokenID);
+        return "";
+    }
+    if (!data.WriteString(permissionName)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteString(%{public}s)", permissionName.c_str());
+        return "";
+    }
+    int32_t requestResult = SendRequest(IPrivacyManager::InterfaceCode::DUMP_RECORD_INFO, data, reply);
+    if (!requestResult) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "send request fail, result: %{public}d", requestResult);
+        return "";
+    }
+    std::string dumpInfo = reply.ReadString();
+    return dumpInfo;
+}
+
+int32_t PrivacyManagerProxy::RegisterPermActiveStatusCallback(
+    std::vector<std::string>& permList, const sptr<IRemoteObject>& callback)
+{
+    ACCESSTOKEN_LOG_INFO(LABEL, "called.");
+    MessageParcel data;
+    if (!data.WriteInterfaceToken(IPrivacyManager::GetDescriptor())) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to write WriteInterfaceToken.");
+        return ERROR;
+    }
+
+    uint32_t listSize = permList.size();
+    if (!data.WriteUint32(listSize)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to write listSize");
+        return ERROR;
+    }
+    for (uint32_t i = 0; i < listSize; i++) {
+        if (!data.WriteString(permList[i])) {
+            ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to write permList[%{public}d], %{public}s", i, permList[i].c_str());
+            return ERROR;
+        }
+    }
+
+    if (!data.WriteRemoteObject(callback)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to write remote object.");
+        return ERROR;
+    }
+    MessageParcel reply;
+    MessageOption option(MessageOption::TF_SYNC);
+    sptr<IRemoteObject> remote = Remote();
+    if (remote == nullptr) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "remote service null.");
+        return ERROR;
+    }
+    int32_t requestResult = remote->SendRequest(
+        static_cast<uint32_t>(IPrivacyManager::InterfaceCode::REGISTER_PERM_ACTIVE_STATUS_CHANGE_CALLBACK),
+        data, reply, option);
+    if (requestResult != NO_ERROR) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "request fail, result: %{public}d.", requestResult);
+        return ERROR;
+    }
+
+    int32_t result;
+    if (!reply.ReadInt32(result)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "ReadInt32 fail");
+        return ERROR;
+    }
+    return result;
+}
+
+int32_t PrivacyManagerProxy::UnRegisterPermActiveStatusCallback(const sptr<IRemoteObject>& callback)
+{
+    ACCESSTOKEN_LOG_INFO(LABEL, "called.");
+    MessageParcel data;
+    if (!data.WriteInterfaceToken(IPrivacyManager::GetDescriptor())) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to write WriteInterfaceToken.");
+        return ERROR;
+    }
+    if (!data.WriteRemoteObject(callback)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to write remote object.");
+        return ERROR;
+    }
+    MessageParcel reply;
+    MessageOption option(MessageOption::TF_SYNC);
+    sptr<IRemoteObject> remote = Remote();
+    if (remote == nullptr) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "remote service null.");
+        return ERROR;
+    }
+    int32_t requestResult = remote->SendRequest(
+        static_cast<uint32_t>(IPrivacyManager::InterfaceCode::UNREGISTER_PERM_ACTIVE_STATUS_CHANGE_CALLBACK),
+        data, reply, option);
+    if (requestResult != NO_ERROR) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "request fail, result: %{public}d.", requestResult);
+        return ERROR;
+    }
+
+    int32_t result;
+    if (!reply.ReadInt32(result)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "ReadInt32 fail");
+        return ERROR;
+    }
+    return result;
+}
+
+bool PrivacyManagerProxy::IsAllowUsingPermission(AccessTokenID tokenID, const std::string& permissionName)
+{
+    MessageParcel data;
+    MessageParcel reply;
+    data.WriteInterfaceToken(IPrivacyManager::GetDescriptor());
+    if (!data.WriteUint32(tokenID)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteUint32(%{public}d)", tokenID);
+        return false;
+    }
+    if (!data.WriteString(permissionName)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteString(%{public}s)", permissionName.c_str());
+        return false;
+    }
+    int32_t requestResult = SendRequest(IPrivacyManager::InterfaceCode::IS_ALLOW_USING_PERMISSION, data, reply);
+    if (!requestResult) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "send request fail, result: %{public}d", requestResult);
+        return false;
+    }
+    bool allowperInfo = reply.ReadBool();
+    return allowperInfo;
+}
+
+
+bool PrivacyManagerProxy::SendRequest(
+    IPrivacyManager::InterfaceCode code, MessageParcel& data, MessageParcel& reply)
+{
+    MessageOption option(MessageOption::TF_SYNC);
+    sptr<IRemoteObject> remote = Remote();
+    if (remote == nullptr) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "remote service null.");
+        return false;
+    }
+
+    int32_t result = remote->SendRequest(static_cast<uint32_t>(code), data, reply, option);
+    if (result != NO_ERROR) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "SendRequest fail, result: %{public}d", result);
+        return false;
+    }
+    return true;
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/interfaces/innerkits/privacy/src/privacy_manager_proxy.h b/interfaces/innerkits/privacy/src/privacy_manager_proxy.h
index 5ea5aaa615a6399bc22b7549e1c9f195924a0224..fff84d43d29a5e78844032012d1ed7edf0888de8 100644
--- a/interfaces/innerkits/privacy/src/privacy_manager_proxy.h
+++ b/interfaces/innerkits/privacy/src/privacy_manager_proxy.h
@@ -1,53 +1,53 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef PRIVACY_MANAGER_PROXY_H
-#define PRIVACY_MANAGER_PROXY_H
-
-#include <string>
-
-#include "i_privacy_manager.h"
-#include "iremote_proxy.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class PrivacyManagerProxy : public IRemoteProxy<IPrivacyManager> {
-public:
-    explicit PrivacyManagerProxy(const sptr<IRemoteObject>& impl);
-    ~PrivacyManagerProxy() override;
-
-    int32_t AddPermissionUsedRecord(
-        AccessTokenID tokenID, const std::string& permissionName, int32_t successCount, int32_t failCount) override;
-    int32_t StartUsingPermission(AccessTokenID tokenID, const std::string& permissionName) override;
-    int32_t StopUsingPermission(AccessTokenID tokenID, const std::string& permissionName) override;
-    int32_t RemovePermissionUsedRecords(AccessTokenID tokenID, const std::string& deviceID) override;
-    int32_t GetPermissionUsedRecords(
-        const PermissionUsedRequestParcel& request, PermissionUsedResultParcel& result) override;
-    int32_t GetPermissionUsedRecords(const PermissionUsedRequestParcel& request,
-        const sptr<OnPermissionUsedRecordCallback>& callback) override;
-    std::string DumpRecordInfo(AccessTokenID tokenID, const std::string& permissionName) override;
-    int32_t RegisterPermActiveStatusCallback(
-        std::vector<std::string>& permList, const sptr<IRemoteObject>& callback) override;
-    int32_t UnRegisterPermActiveStatusCallback(const sptr<IRemoteObject>& callback) override;
-
-private:
-    bool SendRequest(IPrivacyManager::InterfaceCode code, MessageParcel& data, MessageParcel& reply);
-    static inline BrokerDelegator<PrivacyManagerProxy> delegator_;
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef PRIVACY_MANAGER_PROXY_H
+#define PRIVACY_MANAGER_PROXY_H
+
+#include <string>
+
+#include "i_privacy_manager.h"
+#include "iremote_proxy.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class PrivacyManagerProxy : public IRemoteProxy<IPrivacyManager> {
+public:
+    explicit PrivacyManagerProxy(const sptr<IRemoteObject>& impl);
+    ~PrivacyManagerProxy() override;
+
+    int32_t AddPermissionUsedRecord(
+        AccessTokenID tokenID, const std::string& permissionName, int32_t successCount, int32_t failCount) override;
+    int32_t StartUsingPermission(AccessTokenID tokenID, const std::string& permissionName) override;
+    int32_t StopUsingPermission(AccessTokenID tokenID, const std::string& permissionName) override;
+    int32_t RemovePermissionUsedRecords(AccessTokenID tokenID, const std::string& deviceID) override;
+    int32_t GetPermissionUsedRecords(
+        const PermissionUsedRequestParcel& request, PermissionUsedResultParcel& result) override;
+    int32_t GetPermissionUsedRecords(const PermissionUsedRequestParcel& request,
+        const sptr<OnPermissionUsedRecordCallback>& callback) override;
+    std::string DumpRecordInfo(AccessTokenID tokenID, const std::string& permissionName) override;
+    int32_t RegisterPermActiveStatusCallback(
+        std::vector<std::string>& permList, const sptr<IRemoteObject>& callback) override;
+    int32_t UnRegisterPermActiveStatusCallback(const sptr<IRemoteObject>& callback) override;
+    bool IsAllowUsingPermission(AccessTokenID tokenID, const std::string& permissionName) override;
+private:
+    bool SendRequest(IPrivacyManager::InterfaceCode code, MessageParcel& data, MessageParcel& reply);
+    static inline BrokerDelegator<PrivacyManagerProxy> delegator_;
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
 #endif // PRIVACY_MANAGER_PROXY_H
\ No newline at end of file
diff --git a/interfaces/innerkits/privacy/test/BUILD.gn b/interfaces/innerkits/privacy/test/BUILD.gn
index e5c3925710cdce6cddcbdfd9d57d0a7cb89264d0..bdfae2c860af77a6d4d8d3bd12fed93c51f3bf1a 100644
--- a/interfaces/innerkits/privacy/test/BUILD.gn
+++ b/interfaces/innerkits/privacy/test/BUILD.gn
@@ -1,53 +1,53 @@
-# Copyright (c) 2022 Huawei Device Co., Ltd.
-# Licensed under the Apache License, Version 2.0 (the "License");
-# you may not use this file except in compliance with the License.
-# You may obtain a copy of the License at
-#
-#     http://www.apache.org/licenses/LICENSE-2.0
-#
-# Unless required by applicable law or agreed to in writing, software
-# distributed under the License is distributed on an "AS IS" BASIS,
-# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-# See the License for the specific language governing permissions and
-# limitations under the License.
-
-import("//build/test.gni")
-
-ohos_unittest("libprivacy_sdk_test") {
-  subsystem_name = "security"
-  part_name = "access_token"
-  module_out_path = part_name + "/" + part_name
-
-  include_dirs = [
-    "//commonlibrary/c_utils/base/include",
-    "//third_party/googletest/include",
-    "//base/security/access_token/interfaces/innerkits/accesstoken/include",
-    "//base/security/access_token/interfaces/innerkits/nativetoken/include",
-    "//base/security/access_token/interfaces/innerkits/privacy/include",
-    "//base/security/access_token/interfaces/innerkits/token_setproc/include",
-    "//base/security/access_token/services/privacymanager/include/record",
-  ]
-
-  sources = [ "unittest/src/privacy_kit_test.cpp" ]
-
-  cflags_cc = [ "-DHILOG_ENABLE" ]
-
-  deps = [
-    "//base/security/access_token/interfaces/innerkits/accesstoken:libaccesstoken_sdk",
-    "//base/security/access_token/interfaces/innerkits/nativetoken:libnativetoken",
-    "//base/security/access_token/interfaces/innerkits/privacy:libprivacy_sdk",
-    "//base/security/access_token/interfaces/innerkits/token_setproc:libtoken_setproc",
-    "//base/security/access_token/services/privacymanager:privacy_manager_service",
-  ]
-  external_deps = [
-    "c_utils:utils",
-    "init:libbegetutil",
-    "ipc:ipc_core",
-    "samgr:samgr_proxy",
-  ]
-}
-
-group("unittest") {
-  testonly = true
-  deps = [ ":libprivacy_sdk_test" ]
-}
+# Copyright (c) 2022 Huawei Device Co., Ltd.
+# Licensed under the Apache License, Version 2.0 (the "License");
+# you may not use this file except in compliance with the License.
+# You may obtain a copy of the License at
+#
+#     http://www.apache.org/licenses/LICENSE-2.0
+#
+# Unless required by applicable law or agreed to in writing, software
+# distributed under the License is distributed on an "AS IS" BASIS,
+# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+# See the License for the specific language governing permissions and
+# limitations under the License.
+
+import("//build/test.gni")
+
+ohos_unittest("libprivacy_sdk_test") {
+  subsystem_name = "security"
+  part_name = "access_token"
+  module_out_path = part_name + "/" + part_name
+
+  include_dirs = [
+    "//commonlibrary/c_utils/base/include",
+    "//third_party/googletest/include",
+    "//base/security/access_token/interfaces/innerkits/accesstoken/include",
+    "//base/security/access_token/interfaces/innerkits/nativetoken/include",
+    "//base/security/access_token/interfaces/innerkits/privacy/include",
+    "//base/security/access_token/interfaces/innerkits/token_setproc/include",
+    "//base/security/access_token/services/privacymanager/include/record",
+  ]
+
+  sources = [ "unittest/src/privacy_kit_test.cpp" ]
+
+  cflags_cc = [ "-DHILOG_ENABLE" ]
+
+  deps = [
+    "//base/security/access_token/interfaces/innerkits/accesstoken:libaccesstoken_sdk",
+    "//base/security/access_token/interfaces/innerkits/nativetoken:libnativetoken",
+    "//base/security/access_token/interfaces/innerkits/privacy:libprivacy_sdk",
+    "//base/security/access_token/interfaces/innerkits/token_setproc:libtoken_setproc",
+    "//base/security/access_token/services/privacymanager:privacy_manager_service",
+  ]
+  external_deps = [
+    "c_utils:utils",
+    "init:libbegetutil",
+    "ipc:ipc_core",
+    "samgr:samgr_proxy",
+  ]
+}
+
+group("unittest") {
+  testonly = true
+  deps = [ ":libprivacy_sdk_test" ]
+}
diff --git a/interfaces/innerkits/privacy/test/unittest/src/privacy_kit_test.cpp b/interfaces/innerkits/privacy/test/unittest/src/privacy_kit_test.cpp
index c19d79fb85a279cd0d86d3dee0e13c0528963649..2cf1fc252bb014a0316e8f9761659b4ec4b24618 100644
--- a/interfaces/innerkits/privacy/test/unittest/src/privacy_kit_test.cpp
+++ b/interfaces/innerkits/privacy/test/unittest/src/privacy_kit_test.cpp
@@ -1,921 +1,863 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "privacy_kit_test.h"
-
-#include "accesstoken_kit.h"
-#include "nativetoken_kit.h"
-#include "parameter.h"
-#include "privacy_kit.h"
-#include "token_setproc.h"
-
-using namespace testing::ext;
-using namespace OHOS::Security::AccessToken;
-
-const static int32_t RET_NO_ERROR = 0;
-const static int32_t RET_ERROR = -1;
-
-static HapPolicyParams g_PolicyPramsA = {
-    .apl = APL_NORMAL,
-    .domain = "test.domain.A",
-};
-
-static HapInfoParams g_InfoParmsA = {
-    .userID = 1,
-    .bundleName = "ohos.privacy_test.bundleA",
-    .instIndex = 0,
-    .appIDDesc = "privacy_test.bundleA"
-};
-
-static HapPolicyParams g_PolicyPramsB = {
-    .apl = APL_NORMAL,
-    .domain = "test.domain.B",
-};
-
-static HapInfoParams g_InfoParmsB = {
-    .userID = 1,
-    .bundleName = "ohos.privacy_test.bundleB",
-    .instIndex = 0,
-    .appIDDesc = "privacy_test.bundleB"
-};
-
-static PermissionStateFull g_infoManagerTestStateA = {
-    .permissionName = "ohos.permission.CAMERA",
-    .grantFlags = {1},
-    .grantStatus = {PermissionState::PERMISSION_GRANTED},
-    .isGeneral = true,
-    .resDeviceID = {"local"}
-};
-
-static PermissionStateFull g_infoManagerTestStateB = {
-    .permissionName = "ohos.permission.MICROPHONE",
-    .grantFlags = {1},
-    .grantStatus = {PermissionState::PERMISSION_GRANTED},
-    .isGeneral = true,
-    .resDeviceID = {"local"}
-};
-static HapPolicyParams g_PolicyPramsE = {
-    .apl = APL_NORMAL,
-    .domain = "test.domain",
-    .permList = {},
-    .permStateList = {g_infoManagerTestStateA, g_infoManagerTestStateB}
-};
-static HapInfoParams g_InfoParmsE = {
-    .userID = 1,
-    .bundleName = "ohos.privacy_test.bundleE",
-    .instIndex = 0,
-    .appIDDesc = "privacy_test.bundleE"
-};
-
-static AccessTokenID g_selfTokenId = 0;
-static AccessTokenID g_TokenId_A = 0;
-static AccessTokenID g_TokenId_B = 0;
-static AccessTokenID g_TokenId_E = 0;
-
-void PrivacyKitTest::SetUpTestCase()
-{
-    g_selfTokenId = GetSelfTokenID();
-}
-
-void PrivacyKitTest::TearDownTestCase()
-{
-}
-
-void PrivacyKitTest::SetUp()
-{
-    AccessTokenKit::AllocHapToken(g_InfoParmsA, g_PolicyPramsA);
-    AccessTokenKit::AllocHapToken(g_InfoParmsB, g_PolicyPramsB);
-    AccessTokenKit::AllocHapToken(g_InfoParmsE, g_PolicyPramsE);
-
-    g_TokenId_A = AccessTokenKit::GetHapTokenID(g_InfoParmsA.userID,
-                                                g_InfoParmsA.bundleName,
-                                                g_InfoParmsA.instIndex);
-    g_TokenId_B = AccessTokenKit::GetHapTokenID(g_InfoParmsB.userID,
-                                                g_InfoParmsB.bundleName,
-                                                g_InfoParmsB.instIndex);
-    g_TokenId_E = AccessTokenKit::GetHapTokenID(g_InfoParmsE.userID,
-                                                g_InfoParmsE.bundleName,
-                                                g_InfoParmsE.instIndex);
-
-    AccessTokenID tokenId = AccessTokenKit::GetHapTokenID(100, "com.ohos.permissionmanager", 0); // 100 is userID
-    SetSelfTokenID(tokenId);
-}
-
-void PrivacyKitTest::TearDown()
-{
-    SetSelfTokenID(g_selfTokenId);
-    AccessTokenID tokenId = AccessTokenKit::GetHapTokenID(g_InfoParmsA.userID,
-                                                          g_InfoParmsA.bundleName,
-                                                          g_InfoParmsA.instIndex);
-    AccessTokenKit::DeleteToken(tokenId);
-
-    tokenId = AccessTokenKit::GetHapTokenID(g_InfoParmsB.userID,
-                                            g_InfoParmsB.bundleName,
-                                            g_InfoParmsB.instIndex);
-    AccessTokenKit::DeleteToken(tokenId);
-
-    tokenId = AccessTokenKit::GetHapTokenID(g_InfoParmsE.userID,
-                                            g_InfoParmsE.bundleName,
-                                            g_InfoParmsE.instIndex);
-    AccessTokenKit::DeleteToken(tokenId);
-}
-
-std::string PrivacyKitTest::GetLocalDeviceUdid()
-{
-    const int32_t DEVICE_UUID_LENGTH = 65;
-    char udid[DEVICE_UUID_LENGTH] = {0};
-    GetDevUdid(udid, DEVICE_UUID_LENGTH);
-    return udid;
-}
-
-void PrivacyKitTest::BuildQueryRequest(AccessTokenID tokenId, const std::string deviceId, const std::string& bundleName,
-    const std::vector<std::string> permissionList, PermissionUsedRequest& request)
-{
-    request.tokenId = tokenId;
-    request.isRemote = false;
-    request.deviceId = deviceId;
-    request.bundleName = bundleName;
-    request.permissionList = permissionList;
-    request.beginTimeMillis = 0;
-    request.endTimeMillis = 0;
-    request.flag = FLAG_PERMISSION_USAGE_SUMMARY;
-}
-
-void PrivacyKitTest::CheckPermissionUsedResult(const PermissionUsedRequest& request, const PermissionUsedResult& result,
-    int32_t permRecordSize, int32_t totalSuccessCount, int32_t totalFailCount)
-{
-    int32_t successCount = 0;
-    int32_t failCount = 0;
-    ASSERT_EQ(request.tokenId, result.bundleRecords[0].tokenId);
-    ASSERT_EQ(request.isRemote, result.bundleRecords[0].isRemote);
-    ASSERT_EQ(request.deviceId, result.bundleRecords[0].deviceId);
-    ASSERT_EQ(request.bundleName, result.bundleRecords[0].bundleName);
-    ASSERT_EQ(permRecordSize, result.bundleRecords[0].permissionRecords.size());
-    for (int32_t i = 0; i < permRecordSize; i++) {
-        successCount += result.bundleRecords[0].permissionRecords[i].accessCount;
-        failCount += result.bundleRecords[0].permissionRecords[i].rejectCount;
-    }
-    ASSERT_EQ(totalSuccessCount, successCount);
-    ASSERT_EQ(totalFailCount, failCount);
-}
-
-static void SetTokenID(std::vector<HapInfoParams>& g_InfoParms_List,
-    std::vector<AccessTokenID>& g_TokenId_List, int32_t number)
-{
-    SetSelfTokenID(g_selfTokenId);
-    for (int32_t i = 0; i < number; i++) {
-        HapInfoParams g_InfoParmsTmp = {
-            .userID = i,
-            .bundleName = "ohos.privacy_test.bundle" + std::to_string(i),
-            .instIndex = i,
-            .appIDDesc = "privacy_test.bundle" + std::to_string(i)
-        };
-        g_InfoParms_List.push_back(g_InfoParmsTmp);
-        HapPolicyParams g_PolicyPramsTmp = {
-            .apl = APL_NORMAL,
-            .domain = "test.domain." + std::to_string(i)
-        };
-        AccessTokenKit::AllocHapToken(g_InfoParmsTmp, g_PolicyPramsTmp);
-        AccessTokenID g_TokenId_Tmp = AccessTokenKit::GetHapTokenID(g_InfoParmsTmp.userID,
-                                                                    g_InfoParmsTmp.bundleName,
-                                                                    g_InfoParmsTmp.instIndex);
-        g_TokenId_List.push_back(g_TokenId_Tmp);
-    }
-    AccessTokenID tokenId = AccessTokenKit::GetHapTokenID(100, "com.ohos.permissionmanager", 0);
-    SetSelfTokenID(tokenId);
-}
-
-static void DeleteTokenID(std::vector<HapInfoParams>& g_InfoParms_List)
-{
-    SetSelfTokenID(g_selfTokenId);
-    for (size_t i = 0; i < g_InfoParms_List.size(); i++) {
-        AccessTokenID g_TokenId_Tmp = AccessTokenKit::GetHapTokenID(g_InfoParms_List[i].userID,
-                                                                    g_InfoParms_List[i].bundleName,
-                                                                    g_InfoParms_List[i].instIndex);
-        AccessTokenKit::DeleteToken(g_TokenId_Tmp);
-    }
-    AccessTokenID tokenId = AccessTokenKit::GetHapTokenID(100, "com.ohos.permissionmanager", 0);
-    SetSelfTokenID(tokenId);
-}
-
-/**
- * @tc.name: AddPermissionUsedRecord001
- * @tc.desc: cannot AddPermissionUsedRecord with illegal tokenId and permission.
- * @tc.type: FUNC
- * @tc.require:Issue Number
- */
-HWTEST_F(PrivacyKitTest, AddPermissionUsedRecord001, TestSize.Level1)
-{
-    ASSERT_EQ(RET_ERROR, PrivacyKit::AddPermissionUsedRecord(
-        0, "ohos.permission.READ_CONTACTS", 1, 0));
-    ASSERT_EQ(RET_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "", 1, 0));
-    ASSERT_EQ(RET_ERROR, PrivacyKit::AddPermissionUsedRecord(
-        g_TokenId_A, "ohos.permission.READ_CONTACTS", -1, 0));
-
-    PermissionUsedRequest request;
-    PermissionUsedResult result;
-    std::vector<std::string> permissionList;
-    BuildQueryRequest(g_TokenId_A, GetLocalDeviceUdid(), g_InfoParmsA.bundleName, permissionList, request);
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
-    ASSERT_EQ(0, result.bundleRecords.size());
-}
-
-/**
- * @tc.name: AddPermissionUsedRecord002
- * @tc.desc: cannot AddPermissionUsedRecord with invalid tokenId and permission.
- * @tc.type: FUNC
- * @tc.require:Issue Number
- */
-HWTEST_F(PrivacyKitTest, AddPermissionUsedRecord002, TestSize.Level1)
-{
-    ASSERT_EQ(RET_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.test", 1, 0));
-    ASSERT_EQ(RET_ERROR, PrivacyKit::AddPermissionUsedRecord(123, "ohos.permission.CAMERA", 1, 0));
-    ASSERT_EQ(RET_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.READ_CONTACTS", 0, 0));
-
-    PermissionUsedRequest request;
-    PermissionUsedResult result;
-    std::vector<std::string> permissionList;
-    BuildQueryRequest(123, "", "", permissionList, request);
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
-    ASSERT_EQ(0, result.bundleRecords.size());
-
-    BuildQueryRequest(g_TokenId_A, GetLocalDeviceUdid(), g_InfoParmsA.bundleName, permissionList, request);
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
-    ASSERT_EQ(0, result.bundleRecords.size());
-}
-
-/**
- * @tc.name: AddPermissionUsedRecord003
- * @tc.desc: cannot AddPermissionUsedRecord with native tokenId.
- * @tc.type: FUNC
- * @tc.require:Issue Number
- */
-HWTEST_F(PrivacyKitTest, AddPermissionUsedRecord003, TestSize.Level1)
-{
-    const char **dcaps = new const char *[2];
-    dcaps[0] = "AT_CAP";
-    dcaps[1] = "ST_CAP";
-    uint64_t tokenId;
-    const char **acls = new const char *[2];
-    acls[0] = "ohos.permission.test1";
-    acls[1] = "ohos.permission.test2";
-    const char **perms = new const char *[2];
-    perms[0] = "ohos.permission.test1";
-    perms[1] = "ohos.permission.test2";
-    NativeTokenInfoParams infoInstance = {
-        .dcapsNum = 2,
-        .permsNum = 2,
-        .aclsNum = 2,
-        .dcaps = dcaps,
-        .perms = perms,
-        .acls = acls,
-        .processName = "GetAccessTokenId008",
-        .aplStr = "system_core",
-    };
-    tokenId = GetAccessTokenId(&infoInstance);
-    ASSERT_NE(tokenId, 0);
-
-    delete[] perms;
-    delete[] dcaps;
-    delete[] acls;
-
-    ASSERT_EQ(RET_ERROR, PrivacyKit::AddPermissionUsedRecord(
-        tokenId, "ohos.permission.READ_CONTACTS", 1, 0));
-
-    PermissionUsedRequest request;
-    PermissionUsedResult result;
-    std::vector<std::string> permissionList;
-    BuildQueryRequest(tokenId, "", "", permissionList, request);
-
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
-    ASSERT_EQ(0, result.bundleRecords.size());
-}
-
-/**
- * @tc.name: AddPermissionUsedRecord004
- * @tc.desc: AddPermissionUsedRecord user_grant permission.
- * @tc.type: FUNC
- * @tc.require:Issue Number
- */
-HWTEST_F(PrivacyKitTest, AddPermissionUsedRecord004, TestSize.Level1)
-{
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.CAMERA", 1, 0));
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.WRITE_CONTACTS", 0, 1));
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.LOCATION", 1, 1));
-
-    PermissionUsedRequest request;
-    PermissionUsedResult result;
-    std::vector<std::string> permissionList;
-    BuildQueryRequest(g_TokenId_A, GetLocalDeviceUdid(), g_InfoParmsA.bundleName, permissionList, request);
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
-
-    ASSERT_EQ(1, result.bundleRecords.size());
-    CheckPermissionUsedResult(request, result, 3, 2, 2);
-}
-
-/**
- * @tc.name: AddPermissionUsedRecord005
- * @tc.desc: AddPermissionUsedRecord user_grant permission.
- * @tc.type: FUNC
- * @tc.require:Issue Number
- */
-HWTEST_F(PrivacyKitTest, AddPermissionUsedRecord005, TestSize.Level1)
-{
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.CAMERA", 1, 0));
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.LOCATION", 0, 1));
-
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_B,  "ohos.permission.CAMERA", 0, 1));
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_B,  "ohos.permission.LOCATION", 1, 0));
-
-
-    PermissionUsedRequest request;
-    PermissionUsedResult result;
-    std::vector<std::string> permissionList;
-    BuildQueryRequest(g_TokenId_A, GetLocalDeviceUdid(), g_InfoParmsA.bundleName, permissionList, request);
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
-
-    ASSERT_EQ(1, result.bundleRecords.size());
-    CheckPermissionUsedResult(request, result, 2, 1, 1);
-
-    BuildQueryRequest(g_TokenId_B, GetLocalDeviceUdid(), g_InfoParmsB.bundleName, permissionList, request);
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
-
-    ASSERT_EQ(1, result.bundleRecords.size());
-    CheckPermissionUsedResult(request, result, 2, 1, 1);
-}
-
-/**
- * @tc.name: AddPermissionUsedRecord006
- * @tc.desc: AddPermissionUsedRecord permission combine records.
- * @tc.type: FUNC
- * @tc.require:Issue Number
- */
-HWTEST_F(PrivacyKitTest, AddPermissionUsedRecord006, TestSize.Level1)
-{
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.CAMERA", 1, 0));
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.CAMERA", 1, 0));
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.CAMERA", 1, 0));
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.CAMERA", 1, 0));
-
-    PermissionUsedRequest request;
-    PermissionUsedResult result;
-    std::vector<std::string> permissionList;
-    BuildQueryRequest(g_TokenId_A, GetLocalDeviceUdid(), g_InfoParmsA.bundleName, permissionList, request);
-    request.flag = FLAG_PERMISSION_USAGE_DETAIL;
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
-
-    ASSERT_EQ(1, result.bundleRecords.size());
-    ASSERT_EQ(1, result.bundleRecords[0].permissionRecords.size());
-    ASSERT_EQ(1, result.bundleRecords[0].permissionRecords[0].accessRecords.size());
-    CheckPermissionUsedResult(request, result, 1, 4, 0);
-
-    sleep(61);
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.CAMERA", 1, 0));
-   
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
-
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
-    ASSERT_EQ(1, result.bundleRecords.size());
-    ASSERT_EQ(1, result.bundleRecords[0].permissionRecords.size());
-    ASSERT_EQ(2, result.bundleRecords[0].permissionRecords[0].accessRecords.size());
-    CheckPermissionUsedResult(request, result, 1, 5, 0);
-}
-
-/**
- * @tc.name: AddPermissionUsedRecord007
- * @tc.desc: AddPermissionUsedRecord user_grant permission.
- * @tc.type: FUNC
- * @tc.require:Issue Number
- */
-HWTEST_F(PrivacyKitTest, AddPermissionUsedRecord007, TestSize.Level1)
-{
-    std::vector<HapInfoParams> g_InfoParms_List;
-    std::vector<AccessTokenID> g_TokenId_List;
-    SetTokenID(g_InfoParms_List, g_TokenId_List, 100);
-    std::vector<std::string> addPermissionList = {
-        "ohos.permission.ANSWER_CALL",
-        "ohos.permission.READ_CALENDAR",
-    };
-    for (int32_t i = 0; i < 200; i++) {
-        ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_List[i % 100],
-            addPermissionList[i % 2], 1, 0));
-
-        PermissionUsedRequest request;
-        PermissionUsedResult result;
-        std::vector<std::string> permissionList;
-        BuildQueryRequest(g_TokenId_List[i % 100], GetLocalDeviceUdid(),
-            g_InfoParms_List[i % 100].bundleName, permissionList, request);
-        request.flag = FLAG_PERMISSION_USAGE_DETAIL;
-        ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
-    }
-    sleep(70);
-    for (int32_t i = 0; i < 100; i++) {
-        PermissionUsedRequest request;
-        PermissionUsedResult result;
-        std::vector<std::string> permissionList;
-        BuildQueryRequest(g_TokenId_List[i], GetLocalDeviceUdid(),
-            g_InfoParms_List[i].bundleName, permissionList, request);
-        request.flag = FLAG_PERMISSION_USAGE_DETAIL;
-        
-        ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
-        ASSERT_EQ(1, result.bundleRecords.size());
-        ASSERT_EQ(1, result.bundleRecords[0].permissionRecords.size());
-        ASSERT_EQ(1, result.bundleRecords[0].permissionRecords[0].accessRecords.size());
-        CheckPermissionUsedResult(request, result, 1, 2, 0);
-    }
-    DeleteTokenID(g_InfoParms_List);
-}
-
-/**
- * @tc.name: RemovePermissionUsedRecords001
- * @tc.desc: cannot RemovePermissionUsedRecords with illegal tokenId and deviceID.
- * @tc.type: FUNC
- * @tc.require:Issue Number
- */
-HWTEST_F(PrivacyKitTest, RemovePermissionUsedRecords001, TestSize.Level1)
-{
-    ASSERT_EQ(RET_ERROR, PrivacyKit::RemovePermissionUsedRecords(0, ""));
-}
-
-/**
- * @tc.name: RemovePermissionUsedRecords002
- * @tc.desc: RemovePermissionUsedRecords with invalid tokenId and deviceID.
- * @tc.type: FUNC
- * @tc.require:Issue Number
- */
-HWTEST_F(PrivacyKitTest, RemovePermissionUsedRecords002, TestSize.Level1)
-{
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.CAMERA", 1, 0));
-    PermissionUsedRequest request;
-    PermissionUsedResult result;
-    std::vector<std::string> permissionList;
-    BuildQueryRequest(g_TokenId_A, GetLocalDeviceUdid(), g_InfoParmsA.bundleName, permissionList, request);
-
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::RemovePermissionUsedRecords(g_TokenId_A, "invalid_device"));
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
-    ASSERT_EQ(1, result.bundleRecords.size());
-
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::RemovePermissionUsedRecords(123, GetLocalDeviceUdid()));
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
-    ASSERT_EQ(1, result.bundleRecords.size());
-}
-
-/**
- * @tc.name: RemovePermissionUsedRecords003
- * @tc.desc: RemovePermissionUsedRecords with valid tokenId and deviceID.
- * @tc.type: FUNC
- * @tc.require:Issue Number
- */
-HWTEST_F(PrivacyKitTest, RemovePermissionUsedRecords003, TestSize.Level1)
-{
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.CAMERA", 1, 0));
-    PermissionUsedRequest request;
-    PermissionUsedResult result;
-    std::vector<std::string> permissionList;
-    BuildQueryRequest(g_TokenId_A, GetLocalDeviceUdid(), g_InfoParmsA.bundleName, permissionList, request);
-
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::RemovePermissionUsedRecords(g_TokenId_A, ""));
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
-    ASSERT_EQ(0, result.bundleRecords.size());
-}
-
-/**
- * @tc.name: GetPermissionUsedRecords001
- * @tc.desc: cannot GetPermissionUsedRecords with invalid query time.
- * @tc.type: FUNC
- * @tc.require:Issue Number
- */
-HWTEST_F(PrivacyKitTest, GetPermissionUsedRecords001, TestSize.Level1)
-{
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.MICROPHONE", 1, 0));
-    PermissionUsedRequest request;
-    PermissionUsedResult result;
-    std::vector<std::string> permissionList;
-    BuildQueryRequest(g_TokenId_A, GetLocalDeviceUdid(), g_InfoParmsA.bundleName, permissionList, request);
-    request.beginTimeMillis = -1;
-    request.endTimeMillis = -1;
-    ASSERT_EQ(RET_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
-
-    request.beginTimeMillis = 3;
-    request.endTimeMillis = 1;
-    ASSERT_EQ(RET_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
-
-    request.flag = (PermissionUsageFlag)-1;
-    ASSERT_EQ(RET_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
-}
-
-/**
- * @tc.name: GetPermissionUsedRecords002
- * @tc.desc: cannot GetPermissionUsedRecords with valid query time.
- * @tc.type: FUNC
- * @tc.require:Issue Number
- */
-HWTEST_F(PrivacyKitTest, GetPermissionUsedRecords002, TestSize.Level1)
-{
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.MICROPHONE", 1, 0));
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.CAMERA", 1, 0));
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.READ_CALENDAR", 1, 0));
-
-    PermissionUsedRequest request;
-    PermissionUsedResult result;
-    std::vector<std::string> permissionList;
-    // query by tokenId
-    BuildQueryRequest(g_TokenId_A, "", "", permissionList, request);
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
-    ASSERT_EQ(1, result.bundleRecords.size());
-    request.deviceId = GetLocalDeviceUdid();
-    request.bundleName = g_InfoParmsA.bundleName;
-    CheckPermissionUsedResult(request, result, 3, 3, 0);
-
-    // query by unmatched tokenId, deviceId and bundle Name
-    BuildQueryRequest(123, GetLocalDeviceUdid(), g_InfoParmsA.bundleName, permissionList, request);
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
-    ASSERT_EQ(0, result.bundleRecords.size());
-
-    // query by invalid permission Name
-    permissionList.clear();
-    permissionList.emplace_back("invalid permission");
-    BuildQueryRequest(g_TokenId_A, GetLocalDeviceUdid(), g_InfoParmsA.bundleName, permissionList, request);
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
-    ASSERT_EQ(0, result.bundleRecords.size());
-}
-
-/**
- * @tc.name: GetPermissionUsedRecords003
- * @tc.desc: can GetPermissionUsedRecords with valid query time.
- * @tc.type: FUNC
- * @tc.require:Issue Number
- */
-HWTEST_F(PrivacyKitTest, GetPermissionUsedRecords003, TestSize.Level1)
-{
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.MICROPHONE", 1, 0));
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.MICROPHONE", 1, 0));
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.MICROPHONE", 1, 0));
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.MICROPHONE", 1, 0));
-
-    PermissionUsedRequest request;
-    PermissionUsedResult result;
-    std::vector<std::string> permissionList;
-    BuildQueryRequest(g_TokenId_A, GetLocalDeviceUdid(), g_InfoParmsA.bundleName, permissionList, request);
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
-    ASSERT_EQ(1, result.bundleRecords.size());
-    CheckPermissionUsedResult(request, result, 1, 4, 0);
-
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.CAMERA", 1, 0));
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.READ_CALENDAR", 1, 0));
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.WRITE_CALENDAR", 1, 0));
-
-    BuildQueryRequest(g_TokenId_A, GetLocalDeviceUdid(), g_InfoParmsA.bundleName, permissionList, request);
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
-    ASSERT_EQ(1, result.bundleRecords.size());
-    CheckPermissionUsedResult(request, result, 4, 7, 0);
-}
-
-/**
- * @tc.name: GetPermissionUsedRecords004
- * @tc.desc: can GetPermissionUsedRecords with valid query time.
- * @tc.type: FUNC
- * @tc.require:Issue Number
- */
-HWTEST_F(PrivacyKitTest, GetPermissionUsedRecords004, TestSize.Level1)
-{
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.CAMERA", 1, 0));
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.READ_CALENDAR", 1, 0));
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_B, "ohos.permission.CAMERA", 1, 0));
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_B, "ohos.permission.READ_CALENDAR", 1, 0));
-
-    PermissionUsedRequest request;
-    PermissionUsedResult result;
-    std::vector<std::string> permissionList;
-    BuildQueryRequest(0, GetLocalDeviceUdid(), "", permissionList, request);
-
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
-    if (result.bundleRecords.size() < 2) {
-        ASSERT_EQ(RET_NO_ERROR, RET_ERROR);
-    }
-}
-
-/**
- * @tc.name: GetPermissionUsedRecordsAsync001
- * @tc.desc: cannot GetPermissionUsedRecordsAsync with invalid query time.
- * @tc.type: FUNC
- * @tc.require:Issue Number
- */
-HWTEST_F(PrivacyKitTest, GetPermissionUsedRecordsAsync001, TestSize.Level1)
-{
-    std::string permission = "ohos.permission.CAMERA";
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, permission, 1, 0));
-    PermissionUsedRequest request;
-    std::vector<std::string> permissionList;
-    BuildQueryRequest(g_TokenId_A, GetLocalDeviceUdid(), "", permissionList, request);
-    request.beginTimeMillis = -1;
-    request.endTimeMillis = -1;
-    OHOS::sptr<TestCallBack> callback(new TestCallBack());
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, callback));
-}
-
-/**
- * @tc.name: GetPermissionUsedRecordsAsync002
- * @tc.desc: cannot GetPermissionUsedRecordsAsync with valid query time.
- * @tc.type: FUNC
- * @tc.require:Issue Number
- */
-HWTEST_F(PrivacyKitTest, GetPermissionUsedRecordsAsync002, TestSize.Level1)
-{
-    std::string permission = "ohos.permission.CAMERA";
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, permission, 1, 0));
-    PermissionUsedRequest request;
-    std::vector<std::string> permissionList;
-    BuildQueryRequest(g_TokenId_A, GetLocalDeviceUdid(), "", permissionList, request);
-    OHOS::sptr<TestCallBack> callback(new TestCallBack());
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, callback));
-}
-
-/**
- * @tc.name: DumpRecordInfo001
- * @tc.desc: cannot DumpRecordInfo with invalid params.
- * @tc.type: FUNC
- * @tc.require:Issue Number
- */
-HWTEST_F(PrivacyKitTest, DumpRecordInfo001, TestSize.Level1)
-{
-    std::string permission = "ohos.permission.CAMERA";
-
-    // invalid tokenId
-    std::string info = PrivacyKit::DumpRecordInfo(123, permission);
-    ASSERT_EQ(true, info.empty());
-
-    // invalid permission
-    info = PrivacyKit::DumpRecordInfo(g_TokenId_A, "invalid permission");
-    ASSERT_EQ(true, info.empty());
-}
-
-/**
- * @tc.name: DumpRecordInfo002
- * @tc.desc: cannot DumpRecordInfo with no record.
- * @tc.type: FUNC
- * @tc.require:Issue Number
- */
-HWTEST_F(PrivacyKitTest, DumpRecordInfo002, TestSize.Level1)
-{
-    std::string permission = "ohos.permission.CAMERA";
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, permission, 1, 0));
-
-    std::string info = PrivacyKit::DumpRecordInfo(g_TokenId_A, "");
-    ASSERT_EQ(false, info.empty());
-
-    info = PrivacyKit::DumpRecordInfo(0, permission);
-    ASSERT_EQ(false, info.empty());
-
-    info = PrivacyKit::DumpRecordInfo(0, "");
-    ASSERT_EQ(false, info.empty());
-}
-
-/**
- * @tc.name: DumpRecordInfo003
- * @tc.desc: cannot DumpRecordInfo with record.
- * @tc.type: FUNC
- * @tc.require:Issue Number
- */
-HWTEST_F(PrivacyKitTest, DumpRecordInfo003, TestSize.Level1)
-{
-    std::string permission = "ohos.permission.CAMERA";
-
-    std::string info = PrivacyKit::DumpRecordInfo(g_TokenId_A, "");
-    ASSERT_EQ(true, info.empty());
-
-    info = PrivacyKit::DumpRecordInfo(0, "");
-    ASSERT_EQ(true, info.empty());
-}
-
-class CbCustomizeTest1 : public PermActiveStatusCustomizedCbk {
-public:
-    explicit CbCustomizeTest1(const std::vector<std::string> &permList)
-        : PermActiveStatusCustomizedCbk(permList)
-    {
-        GTEST_LOG_(INFO) << "CbCustomizeTest1 create";
-    }
-
-    ~CbCustomizeTest1()
-    {}
-
-    virtual void ActiveStatusChangeCallback(ActiveChangeResponse& result)
-    {
-        type_ = result.type;
-        GTEST_LOG_(INFO) << "CbCustomizeTest1 ActiveChangeResponse";
-        GTEST_LOG_(INFO) << "CbCustomizeTest1 tokenid " << result.tokenID;
-        GTEST_LOG_(INFO) << "CbCustomizeTest1 permissionName " << result.permissionName;
-        GTEST_LOG_(INFO) << "CbCustomizeTest1 deviceId " << result.deviceId;
-        GTEST_LOG_(INFO) << "CbCustomizeTest1 type " << result.type;
-    }
-
-    ActiveChangeType type_ = PERM_INACTIVE;
-};
-
-class CbCustomizeTest2 : public PermActiveStatusCustomizedCbk {
-public:
-    explicit CbCustomizeTest2(const std::vector<std::string> &permList)
-        : PermActiveStatusCustomizedCbk(permList)
-    {
-        GTEST_LOG_(INFO) << "CbCustomizeTest2 create";
-    }
-
-    ~CbCustomizeTest2()
-    {}
-
-    virtual void ActiveStatusChangeCallback(ActiveChangeResponse& result)
-    {
-        type_ = result.type;
-        GTEST_LOG_(INFO) << "CbCustomizeTest2 ActiveChangeResponse";
-        GTEST_LOG_(INFO) << "CbCustomizeTest2 tokenid " << result.tokenID;
-        GTEST_LOG_(INFO) << "CbCustomizeTest2 permissionName " << result.permissionName;
-        GTEST_LOG_(INFO) << "CbCustomizeTest2 deviceId " << result.deviceId;
-        GTEST_LOG_(INFO) << "CbCustomizeTest2 type " << result.type;
-    }
-
-    ActiveChangeType type_;
-};
-
-/**
- * @tc.name: RegisterPermActiveStatusCallback001
- * @tc.desc: RegisterPermActiveStatusCallback with valid permission.
- * @tc.type: FUNC
- * @tc.require: issueI5NT1X
- */
-HWTEST_F(PrivacyKitTest, RegisterPermActiveStatusCallback001, TestSize.Level1)
-{
-    std::vector<std::string> permList = {"ohos.permission.CAMERA"};
-
-    auto callbackPtr = std::make_shared<CbCustomizeTest1>(permList);
-    callbackPtr->type_ = PERM_INACTIVE;
-
-    int32_t res = PrivacyKit::RegisterPermActiveStatusCallback(callbackPtr);
-
-    res = PrivacyKit::StartUsingPermission(g_TokenId_E, "ohos.permission.CAMERA");
-    ASSERT_EQ(RET_NO_ERROR, res);
-
-    usleep(500000); // 500000us = 0.5s
-    ASSERT_EQ(PERM_ACTIVE_IN_FOREGROUND, callbackPtr->type_);
-
-    res = PrivacyKit::StopUsingPermission(g_TokenId_E, "ohos.permission.CAMERA");
-    ASSERT_EQ(RET_NO_ERROR, res);
-
-    usleep(500000); // 500000us = 0.5s
-    ASSERT_EQ(PERM_INACTIVE, callbackPtr->type_);
-
-    res = PrivacyKit::UnRegisterPermActiveStatusCallback(callbackPtr);
-    ASSERT_EQ(RET_NO_ERROR, res);
-    callbackPtr->type_ = PERM_INACTIVE;
-
-    res = PrivacyKit::StartUsingPermission(g_TokenId_E, "ohos.permission.CAMERA");
-    ASSERT_EQ(RET_NO_ERROR, res);
-    ASSERT_EQ(PERM_INACTIVE, callbackPtr->type_);
-
-    res = PrivacyKit::StopUsingPermission(g_TokenId_E, "ohos.permission.CAMERA");
-    ASSERT_EQ(RET_NO_ERROR, res);
-    ASSERT_EQ(PERM_INACTIVE, callbackPtr->type_);
-}
-
-/**
- * @tc.name: RegisterPermActiveStatusCallback002
- * @tc.desc: RegisterPermActiveStatusCallback with valid permission.
- * @tc.type: FUNC
- * @tc.require: issueI5NT1X
- */
-
-HWTEST_F(PrivacyKitTest, RegisterPermActiveStatusCallback002, TestSize.Level1)
-{
-    std::vector<std::string> permList1 = {"ohos.permission.CAMERA"};
-    auto callbackPtr1 = std::make_shared<CbCustomizeTest1>(permList1);
-    callbackPtr1->type_ = PERM_INACTIVE;
-
-    std::vector<std::string> permList2 = {"ohos.permission.MICROPHONE"};
-    auto callbackPtr2 = std::make_shared<CbCustomizeTest2>(permList2);
-    callbackPtr2->type_ = PERM_INACTIVE;
-
-    int32_t res = PrivacyKit::RegisterPermActiveStatusCallback(callbackPtr1);
-    res = PrivacyKit::RegisterPermActiveStatusCallback(callbackPtr2);
-
-    res = PrivacyKit::StartUsingPermission(g_TokenId_E, "ohos.permission.CAMERA");
-    ASSERT_EQ(RET_NO_ERROR, res);
-
-    usleep(500000); // 500000us = 0.5s
-    ASSERT_EQ(PERM_ACTIVE_IN_FOREGROUND, callbackPtr1->type_);
-    ASSERT_EQ(PERM_INACTIVE, callbackPtr2->type_);
-
-    res = PrivacyKit::StopUsingPermission(g_TokenId_E, "ohos.permission.CAMERA");
-    ASSERT_EQ(RET_NO_ERROR, res);
-
-    usleep(500000); // 500000us = 0.5s
-    ASSERT_EQ(PERM_INACTIVE, callbackPtr1->type_);
-
-    res = PrivacyKit::StartUsingPermission(g_TokenId_E, "ohos.permission.MICROPHONE");
-    ASSERT_EQ(RET_NO_ERROR, res);
-
-    usleep(500000); // 500000us = 0.5s
-    ASSERT_EQ(PERM_INACTIVE, callbackPtr1->type_);
-    ASSERT_EQ(PERM_ACTIVE_IN_FOREGROUND, callbackPtr2->type_);
-
-    res = PrivacyKit::StopUsingPermission(g_TokenId_E, "ohos.permission.MICROPHONE");
-    ASSERT_EQ(RET_NO_ERROR, res);
-
-    usleep(500000); // 500000us = 0.5s
-    ASSERT_EQ(PERM_INACTIVE, callbackPtr2->type_);
-
-    res = PrivacyKit::UnRegisterPermActiveStatusCallback(callbackPtr1);
-    ASSERT_EQ(RET_NO_ERROR, res);
-    res = PrivacyKit::UnRegisterPermActiveStatusCallback(callbackPtr2);
-    ASSERT_EQ(RET_NO_ERROR, res);
-}
-
-/**
- * @tc.name: StartUsingPermission001
- * @tc.desc: StartUsingPermission with invalid tokenId or permission.
- * @tc.type: FUNC
- * @tc.require: issueI5NT1X
- */
-HWTEST_F(PrivacyKitTest, StartUsingPermission001, TestSize.Level1)
-{
-    std::string permissionName = "ohos.permission.CAMERA";
-    int32_t ret = PrivacyKit::StartUsingPermission(0, permissionName);
-    ASSERT_EQ(RET_ERROR, ret);
-
-    ret = PrivacyKit::StartUsingPermission(0, "permissionName");
-    ASSERT_EQ(RET_ERROR, ret);
-}
-
-/**
- * @tc.name: StartUsingPermission002
- * @tc.desc: StartUsingPermission is called twice with same permission.
- * @tc.type: FUNC
- * @tc.require: issueI5NT1X
- */
-HWTEST_F(PrivacyKitTest, StartUsingPermission002, TestSize.Level1)
-{
-    std::string permissionName = "ohos.permission.CAMERA";
-    int32_t ret = PrivacyKit::StartUsingPermission(g_TokenId_E, permissionName);
-    ASSERT_EQ(RET_NO_ERROR, ret);
-
-    ret = PrivacyKit::StartUsingPermission(g_TokenId_E, permissionName);
-    ASSERT_EQ(RET_ERROR, ret);
-
-    ret = PrivacyKit::StopUsingPermission(g_TokenId_E, permissionName);
-    ASSERT_EQ(RET_NO_ERROR, ret);
-}
-
-
-/**
- * @tc.name: StopUsingPermission003
- * @tc.desc: Add record when StopUsingPermission is called.
- * @tc.type: FUNC
- * @tc.require: issueI5NT1X
- */
-HWTEST_F(PrivacyKitTest, StartUsingPermission003, TestSize.Level1)
-{
-    std::string permissionName = "ohos.permission.CAMERA";
-    int32_t ret = PrivacyKit::StartUsingPermission(g_TokenId_E, permissionName);
-    ASSERT_EQ(RET_NO_ERROR, ret);
-
-    usleep(500000); // 500000us = 0.5s
-    ret = PrivacyKit::StopUsingPermission(g_TokenId_E, permissionName);
-    ASSERT_EQ(RET_NO_ERROR, ret);
-
-    PermissionUsedRequest request;
-    PermissionUsedResult result;
-    std::vector<std::string> permissionList;
-    BuildQueryRequest(g_TokenId_E, GetLocalDeviceUdid(), g_InfoParmsE.bundleName, permissionList, request);
-    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
-    ASSERT_EQ(1, result.bundleRecords.size());
-    ASSERT_EQ(g_TokenId_E, result.bundleRecords[0].tokenId);
-    ASSERT_EQ(g_InfoParmsE.bundleName, result.bundleRecords[0].bundleName);
-    ASSERT_EQ(1, result.bundleRecords[0].permissionRecords.size());
-    ASSERT_EQ(1, result.bundleRecords[0].permissionRecords[0].accessCount);
-}
-
-/**
- * @tc.name: StopUsingPermission001
- * @tc.desc: StopUsingPermission with invalid tokenId or permission.
- * @tc.type: FUNC
- * @tc.require: issueI5NT1X
- */
-HWTEST_F(PrivacyKitTest, StopUsingPermission001, TestSize.Level1)
-{
-    std::string permissionName = "ohos.permission.CAMERA";
-    int32_t ret = PrivacyKit::StopUsingPermission(0, permissionName);
-    ASSERT_EQ(RET_ERROR, ret);
-
-    ret = PrivacyKit::StopUsingPermission(0, "permissionName");
-    ASSERT_EQ(RET_ERROR, ret);
-}
\ No newline at end of file
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "privacy_kit_test.h"
+
+#include "accesstoken_kit.h"
+#include "nativetoken_kit.h"
+#include "parameter.h"
+#include "privacy_kit.h"
+#include "token_setproc.h"
+
+using namespace testing::ext;
+using namespace OHOS::Security::AccessToken;
+
+const static int32_t RET_NO_ERROR = 0;
+const static int32_t RET_ERROR = -1;
+
+static HapPolicyParams g_PolicyPramsA = {
+    .apl = APL_NORMAL,
+    .domain = "test.domain.A",
+};
+
+static HapInfoParams g_InfoParmsA = {
+    .userID = 1,
+    .bundleName = "ohos.privacy_test.bundleA",
+    .instIndex = 0,
+    .appIDDesc = "privacy_test.bundleA"
+};
+
+static HapPolicyParams g_PolicyPramsB = {
+    .apl = APL_NORMAL,
+    .domain = "test.domain.B",
+};
+
+static HapInfoParams g_InfoParmsB = {
+    .userID = 1,
+    .bundleName = "ohos.privacy_test.bundleB",
+    .instIndex = 0,
+    .appIDDesc = "privacy_test.bundleB"
+};
+
+static PermissionStateFull g_infoManagerTestStateA = {
+    .permissionName = "ohos.permission.CAMERA",
+    .grantFlags = {1},
+    .grantStatus = {PermissionState::PERMISSION_GRANTED},
+    .isGeneral = true,
+    .resDeviceID = {"local"}
+};
+
+static PermissionStateFull g_infoManagerTestStateB = {
+    .permissionName = "ohos.permission.MICROPHONE",
+    .grantFlags = {1},
+    .grantStatus = {PermissionState::PERMISSION_GRANTED},
+    .isGeneral = true,
+    .resDeviceID = {"local"}
+};
+static HapPolicyParams g_PolicyPramsE = {
+    .apl = APL_NORMAL,
+    .domain = "test.domain",
+    .permList = {},
+    .permStateList = {g_infoManagerTestStateA, g_infoManagerTestStateB}
+};
+static HapInfoParams g_InfoParmsE = {
+    .userID = 1,
+    .bundleName = "ohos.privacy_test.bundleE",
+    .instIndex = 0,
+    .appIDDesc = "privacy_test.bundleE"
+};
+
+static AccessTokenID g_selfTokenId = 0;
+static AccessTokenID g_TokenId_A = 0;
+static AccessTokenID g_TokenId_B = 0;
+static AccessTokenID g_TokenId_E = 0;
+
+void PrivacyKitTest::SetUpTestCase()
+{
+    g_selfTokenId = GetSelfTokenID();
+}
+
+void PrivacyKitTest::TearDownTestCase()
+{
+}
+
+void PrivacyKitTest::SetUp()
+{
+    AccessTokenKit::AllocHapToken(g_InfoParmsA, g_PolicyPramsA);
+    AccessTokenKit::AllocHapToken(g_InfoParmsB, g_PolicyPramsB);
+    AccessTokenKit::AllocHapToken(g_InfoParmsE, g_PolicyPramsE);
+
+    g_TokenId_A = AccessTokenKit::GetHapTokenID(g_InfoParmsA.userID,
+                                                g_InfoParmsA.bundleName,
+                                                g_InfoParmsA.instIndex);
+    g_TokenId_B = AccessTokenKit::GetHapTokenID(g_InfoParmsB.userID,
+                                                g_InfoParmsB.bundleName,
+                                                g_InfoParmsB.instIndex);
+    g_TokenId_E = AccessTokenKit::GetHapTokenID(g_InfoParmsE.userID,
+                                                g_InfoParmsE.bundleName,
+                                                g_InfoParmsE.instIndex);
+
+    AccessTokenID tokenId = AccessTokenKit::GetHapTokenID(100, "com.ohos.permissionmanager", 0); // 100 is userID
+    SetSelfTokenID(tokenId);
+}
+
+void PrivacyKitTest::TearDown()
+{
+    SetSelfTokenID(g_selfTokenId);
+    AccessTokenID tokenId = AccessTokenKit::GetHapTokenID(g_InfoParmsA.userID,
+                                                          g_InfoParmsA.bundleName,
+                                                          g_InfoParmsA.instIndex);
+    AccessTokenKit::DeleteToken(tokenId);
+
+    tokenId = AccessTokenKit::GetHapTokenID(g_InfoParmsB.userID,
+                                            g_InfoParmsB.bundleName,
+                                            g_InfoParmsB.instIndex);
+    AccessTokenKit::DeleteToken(tokenId);
+
+    tokenId = AccessTokenKit::GetHapTokenID(g_InfoParmsE.userID,
+                                            g_InfoParmsE.bundleName,
+                                            g_InfoParmsE.instIndex);
+    AccessTokenKit::DeleteToken(tokenId);
+}
+
+std::string PrivacyKitTest::GetLocalDeviceUdid()
+{
+    const int32_t DEVICE_UUID_LENGTH = 65;
+    char udid[DEVICE_UUID_LENGTH] = {0};
+    GetDevUdid(udid, DEVICE_UUID_LENGTH);
+    return udid;
+}
+
+void PrivacyKitTest::BuildQueryRequest(AccessTokenID tokenId, const std::string deviceId, const std::string& bundleName,
+    const std::vector<std::string> permissionList, PermissionUsedRequest& request)
+{
+    request.tokenId = tokenId;
+    request.isRemote = false;
+    request.deviceId = deviceId;
+    request.bundleName = bundleName;
+    request.permissionList = permissionList;
+    request.beginTimeMillis = 0;
+    request.endTimeMillis = 0;
+    request.flag = FLAG_PERMISSION_USAGE_SUMMARY;
+}
+
+void PrivacyKitTest::CheckPermissionUsedResult(const PermissionUsedRequest& request, const PermissionUsedResult& result,
+    int32_t permRecordSize, int32_t totalSuccessCount, int32_t totalFailCount)
+{
+    int32_t successCount = 0;
+    int32_t failCount = 0;
+    ASSERT_EQ(request.tokenId, result.bundleRecords[0].tokenId);
+    ASSERT_EQ(request.isRemote, result.bundleRecords[0].isRemote);
+    ASSERT_EQ(request.deviceId, result.bundleRecords[0].deviceId);
+    ASSERT_EQ(request.bundleName, result.bundleRecords[0].bundleName);
+    ASSERT_EQ(permRecordSize, result.bundleRecords[0].permissionRecords.size());
+    for (int32_t i = 0; i < permRecordSize; i++) {
+        successCount += result.bundleRecords[0].permissionRecords[i].accessCount;
+        failCount += result.bundleRecords[0].permissionRecords[i].rejectCount;
+    }
+    ASSERT_EQ(totalSuccessCount, successCount);
+    ASSERT_EQ(totalFailCount, failCount);
+}
+
+static void SetTokenID(std::vector<HapInfoParams>& g_InfoParms_List,
+    std::vector<AccessTokenID>& g_TokenId_List, int32_t number)
+{
+    SetSelfTokenID(g_selfTokenId);
+    for (int32_t i = 0; i < number; i++) {
+        HapInfoParams g_InfoParmsTmp = {
+            .userID = i,
+            .bundleName = "ohos.privacy_test.bundle" + std::to_string(i),
+            .instIndex = i,
+            .appIDDesc = "privacy_test.bundle" + std::to_string(i)
+        };
+        g_InfoParms_List.push_back(g_InfoParmsTmp);
+        HapPolicyParams g_PolicyPramsTmp = {
+            .apl = APL_NORMAL,
+            .domain = "test.domain." + std::to_string(i)
+        };
+        AccessTokenKit::AllocHapToken(g_InfoParmsTmp, g_PolicyPramsTmp);
+        AccessTokenID g_TokenId_Tmp = AccessTokenKit::GetHapTokenID(g_InfoParmsTmp.userID,
+                                                                    g_InfoParmsTmp.bundleName,
+                                                                    g_InfoParmsTmp.instIndex);
+        g_TokenId_List.push_back(g_TokenId_Tmp);
+    }
+    AccessTokenID tokenId = AccessTokenKit::GetHapTokenID(100, "com.ohos.permissionmanager", 0);
+    SetSelfTokenID(tokenId);
+}
+
+static void DeleteTokenID(std::vector<HapInfoParams>& g_InfoParms_List)
+{
+    SetSelfTokenID(g_selfTokenId);
+    for (size_t i = 0; i < g_InfoParms_List.size(); i++) {
+        AccessTokenID g_TokenId_Tmp = AccessTokenKit::GetHapTokenID(g_InfoParms_List[i].userID,
+                                                                    g_InfoParms_List[i].bundleName,
+                                                                    g_InfoParms_List[i].instIndex);
+        AccessTokenKit::DeleteToken(g_TokenId_Tmp);
+    }
+    AccessTokenID tokenId = AccessTokenKit::GetHapTokenID(100, "com.ohos.permissionmanager", 0);
+    SetSelfTokenID(tokenId);
+}
+
+/**
+ * @tc.name: AddPermissionUsedRecord001
+ * @tc.desc: cannot AddPermissionUsedRecord with illegal tokenId and permission.
+ * @tc.type: FUNC
+ * @tc.require:Issue Number
+ */
+HWTEST_F(PrivacyKitTest, AddPermissionUsedRecord001, TestSize.Level1)
+{
+    ASSERT_EQ(RET_ERROR, PrivacyKit::AddPermissionUsedRecord(
+        0, "ohos.permission.READ_CONTACTS", 1, 0));
+    ASSERT_EQ(RET_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "", 1, 0));
+    ASSERT_EQ(RET_ERROR, PrivacyKit::AddPermissionUsedRecord(
+        g_TokenId_A, "ohos.permission.READ_CONTACTS", -1, 0));
+
+    PermissionUsedRequest request;
+    PermissionUsedResult result;
+    std::vector<std::string> permissionList;
+    BuildQueryRequest(g_TokenId_A, GetLocalDeviceUdid(), g_InfoParmsA.bundleName, permissionList, request);
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
+    ASSERT_EQ(0, result.bundleRecords.size());
+}
+
+/**
+ * @tc.name: AddPermissionUsedRecord002
+ * @tc.desc: cannot AddPermissionUsedRecord with invalid tokenId and permission.
+ * @tc.type: FUNC
+ * @tc.require:Issue Number
+ */
+HWTEST_F(PrivacyKitTest, AddPermissionUsedRecord002, TestSize.Level1)
+{
+    ASSERT_EQ(RET_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.test", 1, 0));
+    ASSERT_EQ(RET_ERROR, PrivacyKit::AddPermissionUsedRecord(123, "ohos.permission.CAMERA", 1, 0));
+    ASSERT_EQ(RET_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.READ_CONTACTS", 0, 0));
+
+    PermissionUsedRequest request;
+    PermissionUsedResult result;
+    std::vector<std::string> permissionList;
+    BuildQueryRequest(123, "", "", permissionList, request);
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
+    ASSERT_EQ(0, result.bundleRecords.size());
+
+    BuildQueryRequest(g_TokenId_A, GetLocalDeviceUdid(), g_InfoParmsA.bundleName, permissionList, request);
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
+    ASSERT_EQ(0, result.bundleRecords.size());
+}
+
+/**
+ * @tc.name: AddPermissionUsedRecord003
+ * @tc.desc: cannot AddPermissionUsedRecord with native tokenId.
+ * @tc.type: FUNC
+ * @tc.require:Issue Number
+ */
+HWTEST_F(PrivacyKitTest, AddPermissionUsedRecord003, TestSize.Level1)
+{
+    const char **dcaps = new const char *[2];
+    dcaps[0] = "AT_CAP";
+    dcaps[1] = "ST_CAP";
+    uint64_t tokenId;
+    const char **acls = new const char *[2];
+    acls[0] = "ohos.permission.test1";
+    acls[1] = "ohos.permission.test2";
+    const char **perms = new const char *[2];
+    perms[0] = "ohos.permission.test1";
+    perms[1] = "ohos.permission.test2";
+    NativeTokenInfoParams infoInstance = {
+        .dcapsNum = 2,
+        .permsNum = 2,
+        .aclsNum = 2,
+        .dcaps = dcaps,
+        .perms = perms,
+        .acls = acls,
+        .processName = "GetAccessTokenId008",
+        .aplStr = "system_core",
+    };
+    tokenId = GetAccessTokenId(&infoInstance);
+    ASSERT_NE(tokenId, 0);
+
+    delete[] perms;
+    delete[] dcaps;
+    delete[] acls;
+
+    ASSERT_EQ(RET_ERROR, PrivacyKit::AddPermissionUsedRecord(
+        tokenId, "ohos.permission.READ_CONTACTS", 1, 0));
+
+    PermissionUsedRequest request;
+    PermissionUsedResult result;
+    std::vector<std::string> permissionList;
+    BuildQueryRequest(tokenId, "", "", permissionList, request);
+
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
+    ASSERT_EQ(0, result.bundleRecords.size());
+}
+
+/**
+ * @tc.name: AddPermissionUsedRecord004
+ * @tc.desc: AddPermissionUsedRecord user_grant permission.
+ * @tc.type: FUNC
+ * @tc.require:Issue Number
+ */
+HWTEST_F(PrivacyKitTest, AddPermissionUsedRecord004, TestSize.Level1)
+{
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.CAMERA", 1, 0));
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.WRITE_CONTACTS", 0, 1));
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.LOCATION", 1, 1));
+
+    PermissionUsedRequest request;
+    PermissionUsedResult result;
+    std::vector<std::string> permissionList;
+    BuildQueryRequest(g_TokenId_A, GetLocalDeviceUdid(), g_InfoParmsA.bundleName, permissionList, request);
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
+
+    ASSERT_EQ(1, result.bundleRecords.size());
+    CheckPermissionUsedResult(request, result, 3, 2, 2);
+}
+
+/**
+ * @tc.name: AddPermissionUsedRecord005
+ * @tc.desc: AddPermissionUsedRecord user_grant permission.
+ * @tc.type: FUNC
+ * @tc.require:Issue Number
+ */
+HWTEST_F(PrivacyKitTest, AddPermissionUsedRecord005, TestSize.Level1)
+{
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.CAMERA", 1, 0));
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.LOCATION", 0, 1));
+
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_B,  "ohos.permission.CAMERA", 0, 1));
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_B,  "ohos.permission.LOCATION", 1, 0));
+
+
+    PermissionUsedRequest request;
+    PermissionUsedResult result;
+    std::vector<std::string> permissionList;
+    BuildQueryRequest(g_TokenId_A, GetLocalDeviceUdid(), g_InfoParmsA.bundleName, permissionList, request);
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
+
+    ASSERT_EQ(1, result.bundleRecords.size());
+    CheckPermissionUsedResult(request, result, 2, 1, 1);
+
+    BuildQueryRequest(g_TokenId_B, GetLocalDeviceUdid(), g_InfoParmsB.bundleName, permissionList, request);
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
+
+    ASSERT_EQ(1, result.bundleRecords.size());
+    CheckPermissionUsedResult(request, result, 2, 1, 1);
+}
+
+/**
+ * @tc.name: AddPermissionUsedRecord006
+ * @tc.desc: AddPermissionUsedRecord permission combine records.
+ * @tc.type: FUNC
+ * @tc.require:Issue Number
+ */
+HWTEST_F(PrivacyKitTest, AddPermissionUsedRecord006, TestSize.Level1)
+{
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.CAMERA", 1, 0));
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.CAMERA", 1, 0));
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.CAMERA", 1, 0));
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.CAMERA", 1, 0));
+
+    PermissionUsedRequest request;
+    PermissionUsedResult result;
+    std::vector<std::string> permissionList;
+    BuildQueryRequest(g_TokenId_A, GetLocalDeviceUdid(), g_InfoParmsA.bundleName, permissionList, request);
+    request.flag = FLAG_PERMISSION_USAGE_DETAIL;
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
+
+    ASSERT_EQ(1, result.bundleRecords.size());
+    ASSERT_EQ(1, result.bundleRecords[0].permissionRecords.size());
+    ASSERT_EQ(1, result.bundleRecords[0].permissionRecords[0].accessRecords.size());
+    CheckPermissionUsedResult(request, result, 1, 4, 0);
+
+    sleep(61);
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.CAMERA", 1, 0));
+   
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
+
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
+    ASSERT_EQ(1, result.bundleRecords.size());
+    ASSERT_EQ(1, result.bundleRecords[0].permissionRecords.size());
+    ASSERT_EQ(2, result.bundleRecords[0].permissionRecords[0].accessRecords.size());
+    CheckPermissionUsedResult(request, result, 1, 5, 0);
+}
+
+/**
+ * @tc.name: AddPermissionUsedRecord007
+ * @tc.desc: AddPermissionUsedRecord user_grant permission.
+ * @tc.type: FUNC
+ * @tc.require:Issue Number
+ */
+HWTEST_F(PrivacyKitTest, AddPermissionUsedRecord007, TestSize.Level1)
+{
+    std::vector<HapInfoParams> g_InfoParms_List;
+    std::vector<AccessTokenID> g_TokenId_List;
+    SetTokenID(g_InfoParms_List, g_TokenId_List, 100);
+    std::vector<std::string> addPermissionList = {
+        "ohos.permission.ANSWER_CALL",
+        "ohos.permission.READ_CALENDAR",
+    };
+    for (int32_t i = 0; i < 200; i++) {
+        ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_List[i % 100],
+            addPermissionList[i % 2], 1, 0));
+
+        PermissionUsedRequest request;
+        PermissionUsedResult result;
+        std::vector<std::string> permissionList;
+        BuildQueryRequest(g_TokenId_List[i % 100], GetLocalDeviceUdid(),
+            g_InfoParms_List[i % 100].bundleName, permissionList, request);
+        request.flag = FLAG_PERMISSION_USAGE_DETAIL;
+        ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
+    }
+    sleep(70);
+    for (int32_t i = 0; i < 100; i++) {
+        PermissionUsedRequest request;
+        PermissionUsedResult result;
+        std::vector<std::string> permissionList;
+        BuildQueryRequest(g_TokenId_List[i], GetLocalDeviceUdid(),
+            g_InfoParms_List[i].bundleName, permissionList, request);
+        request.flag = FLAG_PERMISSION_USAGE_DETAIL;
+        
+        ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
+        ASSERT_EQ(1, result.bundleRecords.size());
+        ASSERT_EQ(1, result.bundleRecords[0].permissionRecords.size());
+        ASSERT_EQ(1, result.bundleRecords[0].permissionRecords[0].accessRecords.size());
+        CheckPermissionUsedResult(request, result, 1, 2, 0);
+    }
+    DeleteTokenID(g_InfoParms_List);
+}
+
+/**
+ * @tc.name: RemovePermissionUsedRecords001
+ * @tc.desc: cannot RemovePermissionUsedRecords with illegal tokenId and deviceID.
+ * @tc.type: FUNC
+ * @tc.require:Issue Number
+ */
+HWTEST_F(PrivacyKitTest, RemovePermissionUsedRecords001, TestSize.Level1)
+{
+    ASSERT_EQ(RET_ERROR, PrivacyKit::RemovePermissionUsedRecords(0, ""));
+}
+
+/**
+ * @tc.name: RemovePermissionUsedRecords002
+ * @tc.desc: RemovePermissionUsedRecords with invalid tokenId and deviceID.
+ * @tc.type: FUNC
+ * @tc.require:Issue Number
+ */
+HWTEST_F(PrivacyKitTest, RemovePermissionUsedRecords002, TestSize.Level1)
+{
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.CAMERA", 1, 0));
+    PermissionUsedRequest request;
+    PermissionUsedResult result;
+    std::vector<std::string> permissionList;
+    BuildQueryRequest(g_TokenId_A, GetLocalDeviceUdid(), g_InfoParmsA.bundleName, permissionList, request);
+
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::RemovePermissionUsedRecords(g_TokenId_A, "invalid_device"));
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
+    ASSERT_EQ(1, result.bundleRecords.size());
+
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::RemovePermissionUsedRecords(123, GetLocalDeviceUdid()));
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
+    ASSERT_EQ(1, result.bundleRecords.size());
+}
+
+/**
+ * @tc.name: RemovePermissionUsedRecords003
+ * @tc.desc: RemovePermissionUsedRecords with valid tokenId and deviceID.
+ * @tc.type: FUNC
+ * @tc.require:Issue Number
+ */
+HWTEST_F(PrivacyKitTest, RemovePermissionUsedRecords003, TestSize.Level1)
+{
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.CAMERA", 1, 0));
+    PermissionUsedRequest request;
+    PermissionUsedResult result;
+    std::vector<std::string> permissionList;
+    BuildQueryRequest(g_TokenId_A, GetLocalDeviceUdid(), g_InfoParmsA.bundleName, permissionList, request);
+
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::RemovePermissionUsedRecords(g_TokenId_A, ""));
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
+    ASSERT_EQ(0, result.bundleRecords.size());
+}
+
+/**
+ * @tc.name: GetPermissionUsedRecords001
+ * @tc.desc: cannot GetPermissionUsedRecords with invalid query time.
+ * @tc.type: FUNC
+ * @tc.require:Issue Number
+ */
+HWTEST_F(PrivacyKitTest, GetPermissionUsedRecords001, TestSize.Level1)
+{
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.MICROPHONE", 1, 0));
+    PermissionUsedRequest request;
+    PermissionUsedResult result;
+    std::vector<std::string> permissionList;
+    BuildQueryRequest(g_TokenId_A, GetLocalDeviceUdid(), g_InfoParmsA.bundleName, permissionList, request);
+    request.beginTimeMillis = -1;
+    request.endTimeMillis = -1;
+    ASSERT_EQ(RET_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
+
+    request.beginTimeMillis = 3;
+    request.endTimeMillis = 1;
+    ASSERT_EQ(RET_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
+
+    request.flag = (PermissionUsageFlag)-1;
+    ASSERT_EQ(RET_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
+}
+
+/**
+ * @tc.name: GetPermissionUsedRecords002
+ * @tc.desc: cannot GetPermissionUsedRecords with valid query time.
+ * @tc.type: FUNC
+ * @tc.require:Issue Number
+ */
+HWTEST_F(PrivacyKitTest, GetPermissionUsedRecords002, TestSize.Level1)
+{
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.MICROPHONE", 1, 0));
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.CAMERA", 1, 0));
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.READ_CALENDAR", 1, 0));
+
+    PermissionUsedRequest request;
+    PermissionUsedResult result;
+    std::vector<std::string> permissionList;
+    // query by tokenId
+    BuildQueryRequest(g_TokenId_A, "", "", permissionList, request);
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
+    ASSERT_EQ(1, result.bundleRecords.size());
+    request.deviceId = GetLocalDeviceUdid();
+    request.bundleName = g_InfoParmsA.bundleName;
+    CheckPermissionUsedResult(request, result, 3, 3, 0);
+
+    // query by unmatched tokenId, deviceId and bundle Name
+    BuildQueryRequest(123, GetLocalDeviceUdid(), g_InfoParmsA.bundleName, permissionList, request);
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
+    ASSERT_EQ(0, result.bundleRecords.size());
+
+    // query by invalid permission Name
+    permissionList.clear();
+    permissionList.emplace_back("invalid permission");
+    BuildQueryRequest(g_TokenId_A, GetLocalDeviceUdid(), g_InfoParmsA.bundleName, permissionList, request);
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
+    ASSERT_EQ(0, result.bundleRecords.size());
+}
+
+/**
+ * @tc.name: GetPermissionUsedRecords003
+ * @tc.desc: can GetPermissionUsedRecords with valid query time.
+ * @tc.type: FUNC
+ * @tc.require:Issue Number
+ */
+HWTEST_F(PrivacyKitTest, GetPermissionUsedRecords003, TestSize.Level1)
+{
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.MICROPHONE", 1, 0));
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.MICROPHONE", 1, 0));
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.MICROPHONE", 1, 0));
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.MICROPHONE", 1, 0));
+
+    PermissionUsedRequest request;
+    PermissionUsedResult result;
+    std::vector<std::string> permissionList;
+    BuildQueryRequest(g_TokenId_A, GetLocalDeviceUdid(), g_InfoParmsA.bundleName, permissionList, request);
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
+    ASSERT_EQ(1, result.bundleRecords.size());
+    CheckPermissionUsedResult(request, result, 1, 4, 0);
+
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.CAMERA", 1, 0));
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.READ_CALENDAR", 1, 0));
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.WRITE_CALENDAR", 1, 0));
+
+    BuildQueryRequest(g_TokenId_A, GetLocalDeviceUdid(), g_InfoParmsA.bundleName, permissionList, request);
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
+    ASSERT_EQ(1, result.bundleRecords.size());
+    CheckPermissionUsedResult(request, result, 4, 7, 0);
+}
+
+/**
+ * @tc.name: GetPermissionUsedRecords004
+ * @tc.desc: can GetPermissionUsedRecords with valid query time.
+ * @tc.type: FUNC
+ * @tc.require:Issue Number
+ */
+HWTEST_F(PrivacyKitTest, GetPermissionUsedRecords004, TestSize.Level1)
+{
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.CAMERA", 1, 0));
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, "ohos.permission.READ_CALENDAR", 1, 0));
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_B, "ohos.permission.CAMERA", 1, 0));
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_B, "ohos.permission.READ_CALENDAR", 1, 0));
+
+    PermissionUsedRequest request;
+    PermissionUsedResult result;
+    std::vector<std::string> permissionList;
+    BuildQueryRequest(0, GetLocalDeviceUdid(), "", permissionList, request);
+
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, result));
+    if (result.bundleRecords.size() < 2) {
+        ASSERT_EQ(RET_NO_ERROR, RET_ERROR);
+    }
+}
+
+/**
+ * @tc.name: GetPermissionUsedRecordsAsync001
+ * @tc.desc: cannot GetPermissionUsedRecordsAsync with invalid query time.
+ * @tc.type: FUNC
+ * @tc.require:Issue Number
+ */
+HWTEST_F(PrivacyKitTest, GetPermissionUsedRecordsAsync001, TestSize.Level1)
+{
+    std::string permission = "ohos.permission.CAMERA";
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, permission, 1, 0));
+    PermissionUsedRequest request;
+    std::vector<std::string> permissionList;
+    BuildQueryRequest(g_TokenId_A, GetLocalDeviceUdid(), "", permissionList, request);
+    request.beginTimeMillis = -1;
+    request.endTimeMillis = -1;
+    OHOS::sptr<TestCallBack> callback(new TestCallBack());
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, callback));
+}
+
+/**
+ * @tc.name: GetPermissionUsedRecordsAsync002
+ * @tc.desc: cannot GetPermissionUsedRecordsAsync with valid query time.
+ * @tc.type: FUNC
+ * @tc.require:Issue Number
+ */
+HWTEST_F(PrivacyKitTest, GetPermissionUsedRecordsAsync002, TestSize.Level1)
+{
+    std::string permission = "ohos.permission.CAMERA";
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, permission, 1, 0));
+    PermissionUsedRequest request;
+    std::vector<std::string> permissionList;
+    BuildQueryRequest(g_TokenId_A, GetLocalDeviceUdid(), "", permissionList, request);
+    OHOS::sptr<TestCallBack> callback(new TestCallBack());
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::GetPermissionUsedRecords(request, callback));
+}
+
+/**
+ * @tc.name: DumpRecordInfo001
+ * @tc.desc: cannot DumpRecordInfo with invalid params.
+ * @tc.type: FUNC
+ * @tc.require:Issue Number
+ */
+HWTEST_F(PrivacyKitTest, DumpRecordInfo001, TestSize.Level1)
+{
+    std::string permission = "ohos.permission.CAMERA";
+
+    // invalid tokenId
+    std::string info = PrivacyKit::DumpRecordInfo(123, permission);
+    ASSERT_EQ(true, info.empty());
+
+    // invalid permission
+    info = PrivacyKit::DumpRecordInfo(g_TokenId_A, "invalid permission");
+    ASSERT_EQ(true, info.empty());
+}
+
+/**
+ * @tc.name: DumpRecordInfo002
+ * @tc.desc: cannot DumpRecordInfo with no record.
+ * @tc.type: FUNC
+ * @tc.require:Issue Number
+ */
+HWTEST_F(PrivacyKitTest, DumpRecordInfo002, TestSize.Level1)
+{
+    std::string permission = "ohos.permission.CAMERA";
+    ASSERT_EQ(RET_NO_ERROR, PrivacyKit::AddPermissionUsedRecord(g_TokenId_A, permission, 1, 0));
+
+    std::string info = PrivacyKit::DumpRecordInfo(g_TokenId_A, "");
+    ASSERT_EQ(false, info.empty());
+
+    info = PrivacyKit::DumpRecordInfo(0, permission);
+    ASSERT_EQ(false, info.empty());
+
+    info = PrivacyKit::DumpRecordInfo(0, "");
+    ASSERT_EQ(false, info.empty());
+}
+
+/**
+ * @tc.name: DumpRecordInfo003
+ * @tc.desc: cannot DumpRecordInfo with record.
+ * @tc.type: FUNC
+ * @tc.require:Issue Number
+ */
+HWTEST_F(PrivacyKitTest, DumpRecordInfo003, TestSize.Level1)
+{
+    std::string permission = "ohos.permission.CAMERA";
+
+    std::string info = PrivacyKit::DumpRecordInfo(g_TokenId_A, "");
+    ASSERT_EQ(true, info.empty());
+
+    info = PrivacyKit::DumpRecordInfo(0, "");
+    ASSERT_EQ(true, info.empty());
+}
+
+
+HWTEST_F(PrivacyKitTest, IsAllowUsingPermission001, TestSize.Level1)
+{
+    std::string permission = "ohos.permission.CAMERA";
+    // invalid tokenId
+    bool info = PrivacyKit::IsAllowUsingPermission(123, "ohos.permission.CAMERA");
+    ASSERT_EQ(false, info);
+
+    // invalid permission
+    info = PrivacyKit::IsAllowUsingPermission(g_TokenId_A, "invalid permission");
+    ASSERT_EQ(false, info);
+}
+
+
+class CbCustomizeTest1 : public PermActiveStatusCustomizedCbk {
+public:
+    explicit CbCustomizeTest1(const std::vector<std::string> &permList)
+        : PermActiveStatusCustomizedCbk(permList)
+    {
+        GTEST_LOG_(INFO) << "CbCustomizeTest1 create";
+    }
+
+    ~CbCustomizeTest1()
+    {}
+
+    virtual void ActiveStatusChangeCallback(ActiveChangeResponse& result)
+    {
+        type_ = result.type;
+        GTEST_LOG_(INFO) << "CbCustomizeTest1 ActiveChangeResponse";
+        GTEST_LOG_(INFO) << "CbCustomizeTest1 tokenid " << result.tokenID;
+        GTEST_LOG_(INFO) << "CbCustomizeTest1 permissionName " << result.permissionName;
+        GTEST_LOG_(INFO) << "CbCustomizeTest1 deviceId " << result.deviceId;
+        GTEST_LOG_(INFO) << "CbCustomizeTest1 type " << result.type;
+    }
+
+    ActiveChangeType type_ = PERM_INACTIVE;
+};
+
+class CbCustomizeTest2 : public PermActiveStatusCustomizedCbk {
+public:
+    explicit CbCustomizeTest2(const std::vector<std::string> &permList)
+        : PermActiveStatusCustomizedCbk(permList)
+    {
+        GTEST_LOG_(INFO) << "CbCustomizeTest2 create";
+    }
+
+    ~CbCustomizeTest2()
+    {}
+
+    virtual void ActiveStatusChangeCallback(ActiveChangeResponse& result)
+    {
+        type_ = result.type;
+        GTEST_LOG_(INFO) << "CbCustomizeTest2 ActiveChangeResponse";
+        GTEST_LOG_(INFO) << "CbCustomizeTest2 tokenid " << result.tokenID;
+        GTEST_LOG_(INFO) << "CbCustomizeTest2 permissionName " << result.permissionName;
+        GTEST_LOG_(INFO) << "CbCustomizeTest2 deviceId " << result.deviceId;
+        GTEST_LOG_(INFO) << "CbCustomizeTest2 type " << result.type;
+    }
+
+    ActiveChangeType type_;
+};
+
+/**
+ * @tc.name: RegisterPermActiveStatusCallback001
+ * @tc.desc: RegisterPermActiveStatusCallback with valid permission.
+ * @tc.type: FUNC
+ * @tc.require:Issue Number
+ */
+HWTEST_F(PrivacyKitTest, RegisterPermActiveStatusCallback001, TestSize.Level1)
+{
+    std::vector<std::string> permList = {"ohos.permission.CAMERA"};
+
+    auto callbackPtr = std::make_shared<CbCustomizeTest1>(permList);
+    callbackPtr->type_ = PERM_INACTIVE;
+
+    int32_t res = PrivacyKit::RegisterPermActiveStatusCallback(callbackPtr);
+
+    res = PrivacyKit::StartUsingPermission(g_TokenId_E, "ohos.permission.CAMERA");
+    ASSERT_EQ(RET_NO_ERROR, res);
+
+    usleep(500000); // 500000us = 0.5s
+    ASSERT_EQ(PERM_ACTIVE_IN_FOREGROUND, callbackPtr->type_);
+
+    res = PrivacyKit::StopUsingPermission(g_TokenId_E, "ohos.permission.CAMERA");
+    ASSERT_EQ(RET_NO_ERROR, res);
+
+    usleep(500000); // 500000us = 0.5s
+    ASSERT_EQ(PERM_INACTIVE, callbackPtr->type_);
+
+    res = PrivacyKit::UnRegisterPermActiveStatusCallback(callbackPtr);
+    ASSERT_EQ(RET_NO_ERROR, res);
+    callbackPtr->type_ = PERM_INACTIVE;
+
+    res = PrivacyKit::StartUsingPermission(g_TokenId_E, "ohos.permission.CAMERA");
+    ASSERT_EQ(RET_NO_ERROR, res);
+    ASSERT_EQ(PERM_INACTIVE, callbackPtr->type_);
+
+    res = PrivacyKit::StopUsingPermission(g_TokenId_E, "ohos.permission.CAMERA");
+    ASSERT_EQ(RET_NO_ERROR, res);
+    ASSERT_EQ(PERM_INACTIVE, callbackPtr->type_);
+}
+
+/**
+ * @tc.name: RegisterPermActiveStatusCallback002
+ * @tc.desc: RegisterPermActiveStatusCallback with valid permission.
+ * @tc.type: FUNC
+ * @tc.require:Issue Number
+ */
+
+HWTEST_F(PrivacyKitTest, RegisterPermActiveStatusCallback002, TestSize.Level1)
+{
+    std::vector<std::string> permList1 = {"ohos.permission.CAMERA"};
+    auto callbackPtr1 = std::make_shared<CbCustomizeTest1>(permList1);
+    callbackPtr1->type_ = PERM_INACTIVE;
+
+    std::vector<std::string> permList2 = {"ohos.permission.MICROPHONE"};
+    auto callbackPtr2 = std::make_shared<CbCustomizeTest2>(permList2);
+    callbackPtr2->type_ = PERM_INACTIVE;
+
+    int32_t res = PrivacyKit::RegisterPermActiveStatusCallback(callbackPtr1);
+    res = PrivacyKit::RegisterPermActiveStatusCallback(callbackPtr2);
+
+    res = PrivacyKit::StartUsingPermission(g_TokenId_E, "ohos.permission.CAMERA");
+    ASSERT_EQ(RET_NO_ERROR, res);
+
+    usleep(500000); // 500000us = 0.5s
+    ASSERT_EQ(PERM_ACTIVE_IN_FOREGROUND, callbackPtr1->type_);
+    ASSERT_EQ(PERM_INACTIVE, callbackPtr2->type_);
+
+    res = PrivacyKit::StopUsingPermission(g_TokenId_E, "ohos.permission.CAMERA");
+    ASSERT_EQ(RET_NO_ERROR, res);
+
+    usleep(500000); // 500000us = 0.5s
+    ASSERT_EQ(PERM_INACTIVE, callbackPtr1->type_);
+
+    res = PrivacyKit::StartUsingPermission(g_TokenId_E, "ohos.permission.MICROPHONE");
+    ASSERT_EQ(RET_NO_ERROR, res);
+
+    usleep(500000); // 500000us = 0.5s
+    ASSERT_EQ(PERM_INACTIVE, callbackPtr1->type_);
+    ASSERT_EQ(PERM_ACTIVE_IN_FOREGROUND, callbackPtr2->type_);
+
+    res = PrivacyKit::StopUsingPermission(g_TokenId_E, "ohos.permission.MICROPHONE");
+    ASSERT_EQ(RET_NO_ERROR, res);
+
+    usleep(500000); // 500000us = 0.5s
+    ASSERT_EQ(PERM_INACTIVE, callbackPtr2->type_);
+
+    res = PrivacyKit::UnRegisterPermActiveStatusCallback(callbackPtr1);
+    ASSERT_EQ(RET_NO_ERROR, res);
+    res = PrivacyKit::UnRegisterPermActiveStatusCallback(callbackPtr2);
+    ASSERT_EQ(RET_NO_ERROR, res);
+}
+
+/**
+ * @tc.name: IsAllowUsingPermission001
+ * @tc.desc: IsAllowUsingPermission with valid permission.
+ * @tc.type: FUNC
+ * @tc.require:Issue Number
+ */
+
diff --git a/interfaces/innerkits/privacy/test/unittest/src/privacy_kit_test.h b/interfaces/innerkits/privacy/test/unittest/src/privacy_kit_test.h
index 03729b70806778f17b3b573a97043b02ef7747a6..9e66e0176faa9d5ec3c9c1e64c4ebf2199a94fed 100644
--- a/interfaces/innerkits/privacy/test/unittest/src/privacy_kit_test.h
+++ b/interfaces/innerkits/privacy/test/unittest/src/privacy_kit_test.h
@@ -1,58 +1,58 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef PRIVACY_KIT_TEST_H
-#define PRIVACY_KIT_TEST_H
-
-#include <gtest/gtest.h>
-#include <cstdint>
-
-#include "on_permission_used_record_callback_stub.h"
-#include "permission_used_request.h"
-#include "permission_used_result.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class PrivacyKitTest : public testing::Test {
-public:
-    static void SetUpTestCase();
-
-    static void TearDownTestCase();
-
-    void SetUp();
-
-    void TearDown();
-
-    class TestCallBack : public OnPermissionUsedRecordCallbackStub {
-    public:
-        TestCallBack() = default;
-        virtual ~TestCallBack() = default;
-
-        void OnQueried(ErrCode code, PermissionUsedResult& result)
-        {
-            GTEST_LOG_(INFO) << "TestCallBack, code :" << code << ", bundleSize :" << result.bundleRecords.size();
-        }
-    };
-    std::string GetLocalDeviceUdid();
-    void BuildQueryRequest(AccessTokenID tokenId, const std::string deviceId, const std::string& bundleName,
-        const std::vector<std::string> permissionList, PermissionUsedRequest& request);
-    void CheckPermissionUsedResult(const PermissionUsedRequest& request, const PermissionUsedResult& result,
-        int32_t permRecordSize, int32_t totalSuccessCount, int32_t totalFailCount);
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-#endif // PRIVACY_KIT_TEST_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef PRIVACY_KIT_TEST_H
+#define PRIVACY_KIT_TEST_H
+
+#include <gtest/gtest.h>
+#include <cstdint>
+
+#include "on_permission_used_record_callback_stub.h"
+#include "permission_used_request.h"
+#include "permission_used_result.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class PrivacyKitTest : public testing::Test {
+public:
+    static void SetUpTestCase();
+
+    static void TearDownTestCase();
+
+    void SetUp();
+
+    void TearDown();
+
+    class TestCallBack : public OnPermissionUsedRecordCallbackStub {
+    public:
+        TestCallBack() = default;
+        virtual ~TestCallBack() = default;
+
+        void OnQueried(ErrCode code, PermissionUsedResult& result)
+        {
+            GTEST_LOG_(INFO) << "TestCallBack, code :" << code << ", bundleSize :" << result.bundleRecords.size();
+        }
+    };
+    std::string GetLocalDeviceUdid();
+    void BuildQueryRequest(AccessTokenID tokenId, const std::string deviceId, const std::string& bundleName,
+        const std::vector<std::string> permissionList, PermissionUsedRequest& request);
+    void CheckPermissionUsedResult(const PermissionUsedRequest& request, const PermissionUsedResult& result,
+        int32_t permRecordSize, int32_t totalSuccessCount, int32_t totalFailCount);
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+#endif // PRIVACY_KIT_TEST_H
diff --git a/services/privacymanager/BUILD.gn b/services/privacymanager/BUILD.gn
index f2278527d971c6daf553263c30778f7709da143d..f7e6378a5d31adc24469ff1de03433306203d847 100644
--- a/services/privacymanager/BUILD.gn
+++ b/services/privacymanager/BUILD.gn
@@ -1,80 +1,82 @@
-# Copyright (c) 2022 Huawei Device Co., Ltd.
-# Licensed under the Apache License, Version 2.0 (the "License");
-# you may not use this file except in compliance with the License.
-# You may obtain a copy of the License at
-#
-#     http://www.apache.org/licenses/LICENSE-2.0
-#
-# Unless required by applicable law or agreed to in writing, software
-# distributed under the License is distributed on an "AS IS" BASIS,
-# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-# See the License for the specific language governing permissions and
-# limitations under the License.
-
-import("//build/ohos.gni")
-
-ohos_prebuilt_etc("privacy.rc") {
-  source = "privacy.cfg"
-  relative_install_dir = "init"
-  subsystem_name = "security"
-  part_name = "access_token"
-}
-
-if (is_standard_system) {
-  ohos_shared_library("privacy_manager_service") {
-    subsystem_name = "security"
-    part_name = "access_token"
-
-    include_dirs = [
-      "include/active",
-      "include/common",
-      "include/database",
-      "include/record",
-      "include/service",
-      "//base/security/access_token/frameworks/privacy/include",
-      "//base/security/access_token/frameworks/common/include",
-      "//base/security/access_token/interfaces/innerkits/accesstoken/include",
-      "//base/security/access_token/interfaces/innerkits/privacy/include",
-      "//base/security/access_token/services/common/database/include",
-      "//third_party/json/include",
-      "//third_party/sqlite/include/",
-    ]
-
-    sources = [
-      "src/active/active_status_callback_manager.cpp",
-      "src/active/perm_active_status_callback_death_recipient.cpp",
-      "src/active/perm_active_status_change_callback_proxy.cpp",
-      "src/common/constant.cpp",
-      "src/common/time_util.cpp",
-      "src/common/to_string.cpp",
-      "src/database/data_translator.cpp",
-      "src/database/permission_used_record_db.cpp",
-      "src/record/on_permission_used_record_callback_proxy.cpp",
-      "src/record/on_permission_used_record_callback_stub.cpp",
-      "src/record/permission_record.cpp",
-      "src/record/permission_record_manager.cpp",
-      "src/record/permission_record_repository.cpp",
-      "src/record/permission_used_record_cache.cpp",
-      "src/service/privacy_manager_service.cpp",
-      "src/service/privacy_manager_stub.cpp",
-    ]
-
-    cflags_cc = [ "-DHILOG_ENABLE" ]
-
-    deps = [
-      "//base/security/access_token/frameworks/common:accesstoken_common_cxx",
-      "//base/security/access_token/frameworks/privacy:privacy_communication_adapter_cxx",
-      "//base/security/access_token/interfaces/innerkits/accesstoken:libaccesstoken_sdk",
-      "//base/security/access_token/services/common/database:accesstoken_database_cxx",
-      "//base/security/access_token/services/privacymanager:privacy.rc",
-    ]
-
-    external_deps = [
-      "c_utils:utils",
-      "hiviewdfx_hilog_native:libhilog",
-      "ipc:ipc_core",
-      "safwk:system_ability_fwk",
-      "samgr:samgr_proxy",
-    ]
-  }
-}
+# Copyright (c) 2022 Huawei Device Co., Ltd.
+# Licensed under the Apache License, Version 2.0 (the "License");
+# you may not use this file except in compliance with the License.
+# You may obtain a copy of the License at
+#
+#     http://www.apache.org/licenses/LICENSE-2.0
+#
+# Unless required by applicable law or agreed to in writing, software
+# distributed under the License is distributed on an "AS IS" BASIS,
+# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+# See the License for the specific language governing permissions and
+# limitations under the License.
+
+import("//build/ohos.gni")
+
+ohos_prebuilt_etc("privacy.rc") {
+  source = "privacy.cfg"
+  relative_install_dir = "init"
+  subsystem_name = "security"
+  part_name = "access_token"
+}
+
+if (is_standard_system) {
+  ohos_shared_library("privacy_manager_service") {
+    subsystem_name = "security"
+    part_name = "access_token"
+
+    include_dirs = [
+      "include/active",
+      "include/common",
+      "include/database",
+      "include/record",
+      "include/service",
+      "//base/security/access_token/frameworks/privacy/include",
+      "//base/security/access_token/frameworks/common/include",
+      "//base/security/access_token/interfaces/innerkits/accesstoken/include",
+      "//base/security/access_token/interfaces/innerkits/privacy/include",
+      "//base/security/access_token/services/common/database/include",
+      "//third_party/json/include",
+    ]
+
+    sources = [
+      "src/active/active_status_callback_manager.cpp",
+      "src/active/perm_active_status_callback_death_recipient.cpp",
+      "src/active/perm_active_status_change_callback_proxy.cpp",
+      "src/common/constant.cpp",
+      "src/common/time_util.cpp",
+      "src/common/to_string.cpp",
+      "src/database/data_translator.cpp",
+      "src/database/permission_used_record_db.cpp",
+      "src/record/on_permission_used_record_callback_proxy.cpp",
+      "src/record/on_permission_used_record_callback_stub.cpp",
+      "src/record/permission_record.cpp",
+      "src/record/permission_record_manager.cpp",
+      "src/record/permission_record_repository.cpp",
+      "src/record/permission_used_record_cache.cpp",
+      "src/service/privacy_manager_service.cpp",
+      "src/service/privacy_manager_stub.cpp",
+    ]
+
+    cflags_cc = [ "-DHILOG_ENABLE" ]
+
+    deps = [
+      "//base/security/access_token/frameworks/common:accesstoken_common_cxx",
+      "//base/security/access_token/frameworks/privacy:privacy_communication_adapter_cxx",
+      "//base/security/access_token/interfaces/innerkits/accesstoken:libaccesstoken_sdk",
+      "//base/security/access_token/services/common/database:accesstoken_database_cxx",
+      "//base/security/access_token/services/privacymanager:privacy.rc",
+      "//third_party/sqlite:sqlite",
+      "//utils/native/base:utils",
+    ]
+
+    external_deps = [
+      "c_utils:utils",
+      "hiviewdfx_hilog_native:libhilog",
+      "init:libbegetutil",
+      "ipc:ipc_core",
+      "safwk:system_ability_fwk",
+      "samgr:samgr_proxy",
+    ]
+  }
+}
diff --git a/services/privacymanager/include/active/active_status_callback_manager.h b/services/privacymanager/include/active/active_status_callback_manager.h
index df6d801ae67a1b9e5c5f3488715a66fe9a9b06bd..fd7caa5a0fefd8c1470bb36b5428b2ff6735dd58 100644
--- a/services/privacymanager/include/active/active_status_callback_manager.h
+++ b/services/privacymanager/include/active/active_status_callback_manager.h
@@ -1,62 +1,62 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef ACTIVE_STATUS_CHANGE_CALLBACK_MANAGER_H
-#define ACTIVE_STATUS_CHANGE_CALLBACK_MANAGER_H
-
-#include <mutex>
-#include <vector>
-
-#include "access_token.h"
-#include "accesstoken_log.h"
-#include "perm_active_status_callback_death_recipient.h"
-#include "perm_active_status_change_callback_proxy.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-struct CallbackData {
-    CallbackData() : permList_(), callbackObject_(nullptr)
-    {}
-    CallbackData(const std::vector<std::string>& permList, sptr<IRemoteObject> callback)
-        : permList_(permList), callbackObject_(callback)
-    {}
-
-    std::vector<std::string> permList_;
-    sptr<IRemoteObject> callbackObject_;
-};
-
-class ActiveStatusCallbackManager {
-public:
-    virtual ~ActiveStatusCallbackManager();
-    ActiveStatusCallbackManager();
-    static ActiveStatusCallbackManager& GetInstance();
-
-    int32_t AddCallback(
-        const std::vector<std::string>& permList, const sptr<IRemoteObject>& callback);
-    int32_t RemoveCallback(const sptr<IRemoteObject>& callback);
-    bool NeedCalled(const std::vector<std::string>& permList, const std::string& permName);
-    void ExecuteCallbackAsync(
-        AccessTokenID tokenId, const std::string& permName, const std::string& deviceId, ActiveChangeType changeType);
-
-private:
-    std::mutex mutex_;
-    std::vector<CallbackData> callbackDataList_;
-    sptr<IRemoteObject::DeathRecipient> callbackDeathRecipient_;
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-#endif // ACTIVE_STATUS_CHANGE_CALLBACK_MANAGER_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef ACTIVE_STATUS_CHANGE_CALLBACK_MANAGER_H
+#define ACTIVE_STATUS_CHANGE_CALLBACK_MANAGER_H
+
+#include <mutex>
+#include <vector>
+
+#include "access_token.h"
+#include "accesstoken_log.h"
+#include "perm_active_status_callback_death_recipient.h"
+#include "perm_active_status_change_callback_proxy.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+struct CallbackData {
+    CallbackData() : permList_(), callbackObject_(nullptr)
+    {}
+    CallbackData(const std::vector<std::string>& permList, sptr<IRemoteObject> callback)
+        : permList_(permList), callbackObject_(callback)
+    {}
+
+    std::vector<std::string> permList_;
+    sptr<IRemoteObject> callbackObject_;
+};
+
+class ActiveStatusCallbackManager {
+public:
+    virtual ~ActiveStatusCallbackManager();
+    ActiveStatusCallbackManager();
+    static ActiveStatusCallbackManager& GetInstance();
+
+    int32_t AddCallback(
+        const std::vector<std::string>& permList, const sptr<IRemoteObject>& callback);
+    int32_t RemoveCallback(const sptr<IRemoteObject>& callback);
+    bool NeedCalled(const std::vector<std::string>& permList, const std::string& permName);
+    void ExecuteCallbackAsync(
+        AccessTokenID tokenId, const std::string& permName, const std::string& deviceId, ActiveChangeType changeType);
+
+private:
+    std::mutex mutex_;
+    std::vector<CallbackData> callbackDataList_;
+    sptr<IRemoteObject::DeathRecipient> callbackDeathRecipient_;
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+#endif // ACTIVE_STATUS_CHANGE_CALLBACK_MANAGER_H
diff --git a/services/privacymanager/include/active/perm_active_status_callback_death_recipient.h b/services/privacymanager/include/active/perm_active_status_callback_death_recipient.h
index c69e05e3e5ecfab5a4f746c7bcb1567b40285abb..fb49b6ff02d69710870e76ac315adff877e55e04 100644
--- a/services/privacymanager/include/active/perm_active_status_callback_death_recipient.h
+++ b/services/privacymanager/include/active/perm_active_status_callback_death_recipient.h
@@ -1,35 +1,35 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef PERM_ACTIVE_STATUS_CALLBACK_DEATH_RECIPIENT_H
-#define PERM_ACTIVE_STATUS_CALLBACK_DEATH_RECIPIENT_H
-
-
-#include "iremote_object.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class PermActiveStatusCallbackDeathRecipient : public IRemoteObject::DeathRecipient {
-public:
-    PermActiveStatusCallbackDeathRecipient() = default;
-    virtual ~PermActiveStatusCallbackDeathRecipient() = default;
-
-    virtual void OnRemoteDied(const wptr<IRemoteObject> &remote);
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-#endif // PERM_ACTIVE_STATUS_CALLBACK_DEATH_RECIPIENT_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef PERM_ACTIVE_STATUS_CALLBACK_DEATH_RECIPIENT_H
+#define PERM_ACTIVE_STATUS_CALLBACK_DEATH_RECIPIENT_H
+
+
+#include "iremote_object.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class PermActiveStatusCallbackDeathRecipient : public IRemoteObject::DeathRecipient {
+public:
+    PermActiveStatusCallbackDeathRecipient() = default;
+    virtual ~PermActiveStatusCallbackDeathRecipient() = default;
+
+    virtual void OnRemoteDied(const wptr<IRemoteObject> &remote);
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+#endif // PERM_ACTIVE_STATUS_CALLBACK_DEATH_RECIPIENT_H
diff --git a/services/privacymanager/include/active/perm_active_status_change_callback_proxy.h b/services/privacymanager/include/active/perm_active_status_change_callback_proxy.h
index db358c94be9367bd3cf740bfb01c501d861ce4d1..97a60376ad820ef8aedee4eba502cb2207c9aa51 100644
--- a/services/privacymanager/include/active/perm_active_status_change_callback_proxy.h
+++ b/services/privacymanager/include/active/perm_active_status_change_callback_proxy.h
@@ -1,40 +1,40 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef PERM_ACTIVE_STATUS_CHANGE_CALLBACK_PROXY_H
-#define PERM_ACTIVE_STATUS_CHANGE_CALLBACK_PROXY_H
-
-
-#include "i_perm_active_status_callback.h"
-
-#include "iremote_proxy.h"
-#include "nocopyable.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class PermActiveStatusChangeCallbackProxy : public IRemoteProxy<IPermActiveStatusCallback> {
-public:
-    explicit PermActiveStatusChangeCallbackProxy(const sptr<IRemoteObject>& impl);
-    ~PermActiveStatusChangeCallbackProxy() override;
-
-    virtual void ActiveStatusChangeCallback(ActiveChangeResponse& result) override;
-private:
-    static inline BrokerDelegator<PermActiveStatusChangeCallbackProxy> delegator_;
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-#endif // PERM_ACTIVE_STATUS_CHANGE_CALLBACK_PROXY_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef PERM_ACTIVE_STATUS_CHANGE_CALLBACK_PROXY_H
+#define PERM_ACTIVE_STATUS_CHANGE_CALLBACK_PROXY_H
+
+
+#include "i_perm_active_status_callback.h"
+
+#include "iremote_proxy.h"
+#include "nocopyable.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class PermActiveStatusChangeCallbackProxy : public IRemoteProxy<IPermActiveStatusCallback> {
+public:
+    explicit PermActiveStatusChangeCallbackProxy(const sptr<IRemoteObject>& impl);
+    ~PermActiveStatusChangeCallbackProxy() override;
+
+    virtual void ActiveStatusChangeCallback(ActiveChangeResponse& result) override;
+private:
+    static inline BrokerDelegator<PermActiveStatusChangeCallbackProxy> delegator_;
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+#endif // PERM_ACTIVE_STATUS_CHANGE_CALLBACK_PROXY_H
diff --git a/services/privacymanager/include/common/constant.h b/services/privacymanager/include/common/constant.h
index 6e3602ac6997e3bb12487543d7179de4991567ad..8b061eff5fc94eba971a5e4fbb1ce61a361f3f4e 100644
--- a/services/privacymanager/include/common/constant.h
+++ b/services/privacymanager/include/common/constant.h
@@ -1,75 +1,76 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef CONSTANT_H
-#define CONSTANT_H
-
-#include <map>
-#include <string>
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class Constant {
-public:
-    enum OpCode {
-        OP_INVALID = -1,
-        OP_ANSWER_CALL = 0,
-        OP_READ_CALENDAR = 1,
-        OP_WRITE_CALENDAR = 2,
-        OP_SEND_MESSAGES = 3,
-        OP_WRITE_CALL_LOG = 4,
-        OP_READ_CALL_LOG = 5,
-        OP_READ_CELL_MESSAGES = 6,
-        OP_MICROPHONE = 7,
-        OP_RECEIVE_WAP_MESSAGES = 8,
-        OP_RECEIVE_SMS = 9,
-        OP_RECEIVE_MMS = 10,
-        OP_READ_MESSAGES = 11,
-        OP_READ_CONTACTS = 12,
-        OP_WRITE_CONTACTS = 13,
-        OP_LOCATION_IN_BACKGROUND = 14,
-        OP_LOCATION = 15,
-        OP_MEDIA_LOCATION = 16,
-        OP_CAMERA = 17,
-        OP_READ_MEDIA = 18,
-        OP_WRITE_MEDIA = 19,
-        OP_ACTIVITY_MOTION = 20,
-        OP_READ_HEALTH_DATA = 21,
-        OP_MANAGE_VOICEMAIL = 22,
-        OP_DISTRIBUTED_DATASYNC = 23,
-    };
-
-    enum ErrorCode {
-        FAILURE = -1,
-        SUCCESS = 0,
-    };
-
-    const static int32_t MAX_TOTAL_RECORD = 10000;
-    const static int32_t MAX_DETAIL_RECORD = 10;
-    const static int32_t RECORD_DELETE_TIME = 30 * 86400;
-    const static int32_t PRECISE = 60;
-    const static int32_t LATEST_RECORD_TIME = 7 * 86400;
-
-    const static std::map<std::string, int32_t> PERMISSION_OPCODE_MAP;
-public:
-    static bool TransferPermissionToOpcode(const std::string& permissionName, int32_t& opCode);
-    static bool TransferOpcodeToPermission(int32_t opCode, std::string& permissionName);
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-
-#endif // CONSTANT_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef CONSTANT_H
+#define CONSTANT_H
+
+#include <map>
+#include <string>
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class Constant {
+public:
+    enum OpCode {
+        OP_INVALID = -1,
+        OP_ANSWER_CALL = 0,
+        OP_READ_CALENDAR = 1,
+        OP_WRITE_CALENDAR = 2,
+        OP_SEND_MESSAGES = 3,
+        OP_WRITE_CALL_LOG = 4,
+        OP_READ_CALL_LOG = 5,
+        OP_READ_CELL_MESSAGES = 6,
+        OP_MICROPHONE = 7,
+        OP_RECEIVE_WAP_MESSAGES = 8,
+        OP_RECEIVE_SMS = 9,
+        OP_RECEIVE_MMS = 10,
+        OP_READ_MESSAGES = 11,
+        OP_READ_CONTACTS = 12,
+        OP_WRITE_CONTACTS = 13,
+        OP_LOCATION_IN_BACKGROUND = 14,
+        OP_LOCATION = 15,
+        OP_MEDIA_LOCATION = 16,
+        OP_CAMERA = 17,
+        OP_READ_MEDIA = 18,
+        OP_WRITE_MEDIA = 19,
+        OP_ACTIVITY_MOTION = 20,
+        OP_READ_HEALTH_DATA = 21,
+        OP_MANAGE_VOICEMAIL = 22,
+        OP_DISTRIBUTED_DATASYNC = 23,
+    };
+
+    enum ErrorCode {
+        FAILURE = -1,
+        SUCCESS = 0,
+    };
+
+    const static int32_t MAX_TOTAL_RECORD = 10000;
+    const static int32_t MAX_DETAIL_RECORD = 10;
+    const static int32_t RECORD_DELETE_TIME = 30 * 86400;
+    const static int32_t PRECISE = 60;
+    const static int32_t LATEST_RECORD_TIME = 7 * 86400;
+    const static std::string COUNT_CMD;
+
+    const static std::map<std::string, int32_t> PERMISSION_OPCODE_MAP;
+public:
+    static bool TransferPermissionToOpcode(const std::string& permissionName, int32_t& opCode);
+    static bool TransferOpcodeToPermission(int32_t opCode, std::string& permissionName);
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+
+#endif // CONSTANT_H
diff --git a/services/privacymanager/include/common/time_util.h b/services/privacymanager/include/common/time_util.h
index 064e68486d9dd4cfcadc84affbe47c0f146daa6b..394be3a1c2bcc32849d0d3bfc0b886e23c59426a 100644
--- a/services/privacymanager/include/common/time_util.h
+++ b/services/privacymanager/include/common/time_util.h
@@ -1,30 +1,30 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef TIME_UTIL_H
-#define TIME_UTIL_H
-#include <string>
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class TimeUtil {
-public:
-    static int64_t GetCurrentTimestamp();
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-
-#endif // TIME_UTIL_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef TIME_UTIL_H
+#define TIME_UTIL_H
+#include <string>
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class TimeUtil {
+public:
+    static int64_t GetCurrentTimestamp();
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+
+#endif // TIME_UTIL_H
diff --git a/services/privacymanager/include/common/to_string.h b/services/privacymanager/include/common/to_string.h
index de6dd9290b58dfca38066e8edd51a9536061c198..a18ac75f151e427beb6b71625cce66947c59ec0c 100644
--- a/services/privacymanager/include/common/to_string.h
+++ b/services/privacymanager/include/common/to_string.h
@@ -1,38 +1,38 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef TO_STRING_H
-#define TO_STRING_H
-
-#include <string>
-#include "permission_used_request.h"
-#include "permission_used_result.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class ToString {
-public:
-    static void DetailUsedRecordToString(
-        bool isAccessDetail, const std::vector<UsedRecordDetail>& detailRecord, std::string& infos);
-    static void PermissionUsedRecordToString(
-        const std::vector<PermissionUsedRecord>& permissionRecords, std::string& infos);
-    static void BundleUsedRecordToString(const BundleUsedRecord& bundleRecord, std::string& infos);
-    static void PermissionUsedResultToString(const PermissionUsedResult& result, std::string& infos);
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-#endif // TO_STRING_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef TO_STRING_H
+#define TO_STRING_H
+
+#include <string>
+#include "permission_used_request.h"
+#include "permission_used_result.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class ToString {
+public:
+    static void DetailUsedRecordToString(
+        bool isAccessDetail, const std::vector<UsedRecordDetail>& detailRecord, std::string& infos);
+    static void PermissionUsedRecordToString(
+        const std::vector<PermissionUsedRecord>& permissionRecords, std::string& infos);
+    static void BundleUsedRecordToString(const BundleUsedRecord& bundleRecord, std::string& infos);
+    static void PermissionUsedResultToString(const PermissionUsedResult& result, std::string& infos);
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+#endif // TO_STRING_H
diff --git a/services/privacymanager/include/database/data_translator.h b/services/privacymanager/include/database/data_translator.h
index 488d887fff8c95759488ded9784fc850cb4939f5..6f2b02a34c50856bbf86468f043c947179b7cd6c 100644
--- a/services/privacymanager/include/database/data_translator.h
+++ b/services/privacymanager/include/database/data_translator.h
@@ -1,38 +1,38 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef DATA_TRANSLATOR_H
-#define DATA_TRANSLATOR_H
-
-#include <string>
-
-#include "permission_used_request.h"
-#include "permission_used_result.h"
-#include "generic_values.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class DataTranslator final {
-public:
-    static int32_t TranslationIntoGenericValues(const PermissionUsedRequest& request,
-        GenericValues& andGenericValues, GenericValues& orGenericValues);
-    static int32_t TranslationGenericValuesIntoPermissionUsedRecord(
-        const GenericValues& inGenericValues, PermissionUsedRecord& permissionRecord);
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-#endif // DATA_TRANSLATOR_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef DATA_TRANSLATOR_H
+#define DATA_TRANSLATOR_H
+
+#include <string>
+
+#include "permission_used_request.h"
+#include "permission_used_result.h"
+#include "generic_values.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class DataTranslator final {
+public:
+    static int32_t TranslationIntoGenericValues(const PermissionUsedRequest& request,
+        GenericValues& andGenericValues, GenericValues& orGenericValues);
+    static int32_t TranslationGenericValuesIntoPermissionUsedRecord(
+        const GenericValues& inGenericValues, PermissionUsedRecord& permissionRecord);
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+#endif // DATA_TRANSLATOR_H
diff --git a/services/privacymanager/include/database/permission_used_record_db.h b/services/privacymanager/include/database/permission_used_record_db.h
index 3ae7d5bb5db1838987d7717ac55b5a3cb56b3502..ef7126bd0b2ffb666809fb37bcc6ec411df215ba 100644
--- a/services/privacymanager/include/database/permission_used_record_db.h
+++ b/services/privacymanager/include/database/permission_used_record_db.h
@@ -1,88 +1,88 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef PERMISSION_USED_RECORD_DB_H
-#define PERMISSION_USED_RECORD_DB_H
-
-#include "generic_values.h"
-#include "sqlite_helper.h"
-
-#include "nocopyable.h"
-#include "rwlock.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-struct SqliteTable {
-public:
-    std::string tableName_;
-    std::vector<std::string> tableColumnNames_;
-};
-class PermissionUsedRecordDb : public SqliteHelper {
-public:
-    enum DataType {
-        PERMISSION_RECORD,
-    };
-    enum ExecuteResult { FAILURE = -1, SUCCESS };
-    static PermissionUsedRecordDb& GetInstance();
-
-    ~PermissionUsedRecordDb() override;
-
-    int32_t Add(DataType type, const std::vector<GenericValues>& values);
-    int32_t Remove(DataType type, const GenericValues& conditions);
-    int32_t FindByConditions(DataType type, const GenericValues& andConditions,
-        const GenericValues& orConditions, std::vector<GenericValues>& results);
-    int32_t Modify(DataType type, const GenericValues& modifyValues, const GenericValues& conditions);
-    void Count(DataType type, GenericValues& result);
-    int32_t DeleteExpireRecords(DataType type, const GenericValues& andConditions);
-    int32_t DeleteExcessiveRecords(DataType type, uint32_t excessiveSize);
-    int32_t GetDistinctValue(DataType type, const std::string& condition, std::vector<GenericValues>& results);
-
-    void OnCreate() override;
-    void OnUpdate() override;
-
-private:
-    PermissionUsedRecordDb();
-    DISALLOW_COPY_AND_MOVE(PermissionUsedRecordDb);
-
-    std::map<DataType, SqliteTable> dataTypeToSqlTable_;
-    OHOS::Utils::RWLock rwLock_;
-
-    int32_t CreatePermissionRecordTable() const;
-
-    std::string CreateInsertPrepareSqlCmd(DataType type) const;
-    std::string CreateDeletePrepareSqlCmd(
-        DataType type, const std::vector<std::string>& columnNames = std::vector<std::string>()) const;
-    std::string CreateSelectByConditionPrepareSqlCmd(DataType type,
-        const std::vector<std::string>& andColumns, const std::vector<std::string>& orColumns) const;
-    std::string CreateUpdatePrepareSqlCmd(DataType type, const std::vector<std::string>& modifyColumns,
-        const std::vector<std::string>& conditionColumns) const;
-    std::string CreateCountPrepareSqlCmd(DataType type) const;
-    std::string CreateDeleteExpireRecordsPrepareSqlCmd(DataType type,
-        const std::vector<std::string>& andColumns) const;
-    std::string CreateDeleteExcessiveRecordsPrepareSqlCmd(DataType type, uint32_t excessiveSize) const;
-    std::string CreateGetDistinctValue(DataType type, const std::string conditionColumns) const;
-
-private:
-    inline static const std::string PERMISSION_RECORD_TABLE = "permission_record_table";
-    inline static const std::string DATABASE_NAME = "permission_used_record.db";
-    inline static const std::string DATABASE_PATH = "/data/service/el1/public/access_token/";
-    static const int32_t DATABASE_VERSION = 1;
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-
-#endif // PERMISSION_USED_RECORD_DB_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef PERMISSION_USED_RECORD_DB_H
+#define PERMISSION_USED_RECORD_DB_H
+
+#include "generic_values.h"
+#include "sqlite_helper.h"
+
+#include "nocopyable.h"
+#include "rwlock.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+struct SqliteTable {
+public:
+    std::string tableName_;
+    std::vector<std::string> tableColumnNames_;
+};
+class PermissionUsedRecordDb : public SqliteHelper {
+public:
+    enum DataType {
+        PERMISSION_RECORD,
+    };
+    enum ExecuteResult { FAILURE = -1, SUCCESS };
+    static PermissionUsedRecordDb& GetInstance();
+
+    ~PermissionUsedRecordDb() override;
+
+    int32_t Add(DataType type, const std::vector<GenericValues>& values);
+    int32_t Remove(DataType type, const GenericValues& conditions);
+    int32_t FindByConditions(DataType type, const GenericValues& andConditions,
+        const GenericValues& orConditions, std::vector<GenericValues>& results);
+    int32_t Modify(DataType type, const GenericValues& modifyValues, const GenericValues& conditions);
+    int32_t Count(DataType type, GenericValues& result);
+    int32_t DeleteExpireRecords(DataType type, const GenericValues& andConditions);
+    int32_t DeleteExcessiveRecords(DataType type, unsigned excessiveSize);
+    int32_t GetDistinctValue(DataType type, const std::string& condition, std::vector<GenericValues>& results);
+
+    void OnCreate() override;
+    void OnUpdate() override;
+
+private:
+    PermissionUsedRecordDb();
+    DISALLOW_COPY_AND_MOVE(PermissionUsedRecordDb);
+
+    std::map<DataType, SqliteTable> dataTypeToSqlTable_;
+    OHOS::Utils::RWLock rwLock_;
+
+    int32_t CreatePermissionRecordTable() const;
+
+    std::string CreateInsertPrepareSqlCmd(DataType type) const;
+    std::string CreateDeletePrepareSqlCmd(
+        DataType type, const std::vector<std::string>& columnNames = std::vector<std::string>()) const;
+    std::string CreateSelectByConditionPrepareSqlCmd(DataType type,
+        const std::vector<std::string>& andColumns, const std::vector<std::string>& orColumns) const;
+    std::string CreateUpdatePrepareSqlCmd(DataType type, const std::vector<std::string>& modifyColumns,
+        const std::vector<std::string>& conditionColumns) const;
+    std::string CreateCountPrepareSqlCmd(DataType type) const;
+    std::string CreateDeleteExpireRecordsPrepareSqlCmd(DataType type,
+        const std::vector<std::string>& andColumns) const;
+    std::string CreateDeleteExcessiveRecordsPrepareSqlCmd(DataType type, uint32_t excessiveSize) const;
+    std::string CreateGetDistinctValue(DataType type, const std::string conditionColumns) const;
+
+private:
+    inline static const std::string PERMISSION_RECORD_TABLE = "permission_record_table";
+    inline static const std::string DATABASE_NAME = "permission_used_record.db";
+    inline static const std::string DATABASE_PATH = "/data/service/el1/public/access_token/";
+    static const int32_t DATABASE_VERSION = 1;
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+
+#endif // PERMISSION_USED_RECORD_DB_H
diff --git a/services/privacymanager/include/record/on_permission_used_record_callback_proxy.h b/services/privacymanager/include/record/on_permission_used_record_callback_proxy.h
index 3a6975bd064b279622d4956ecad1a97f09e18bd9..0ec964bd151d75a1abf59e65e84f45cb4fe0c312 100644
--- a/services/privacymanager/include/record/on_permission_used_record_callback_proxy.h
+++ b/services/privacymanager/include/record/on_permission_used_record_callback_proxy.h
@@ -1,40 +1,40 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef ON_PERMISSION_USED_RECORD_CALLBACK_PROXY_H
-#define ON_PERMISSION_USED_RECORD_CALLBACK_PROXY_H
-
-
-#include "on_permission_used_record_callback.h"
-
-#include "iremote_proxy.h"
-#include "nocopyable.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class OnPermissionUsedRecordCallbackProxy : public IRemoteProxy<OnPermissionUsedRecordCallback> {
-public:
-    explicit OnPermissionUsedRecordCallbackProxy(const sptr<IRemoteObject>& impl);
-    ~OnPermissionUsedRecordCallbackProxy() override;
-
-    virtual void OnQueried(ErrCode code, PermissionUsedResult& result) override;
-private:
-    static inline BrokerDelegator<OnPermissionUsedRecordCallbackProxy> delegator_;
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-#endif // ON_PERMISSION_USED_RECORD_CALLBACK_PROXY_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef ON_PERMISSION_USED_RECORD_CALLBACK_PROXY_H
+#define ON_PERMISSION_USED_RECORD_CALLBACK_PROXY_H
+
+
+#include "on_permission_used_record_callback.h"
+
+#include "iremote_proxy.h"
+#include "nocopyable.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class OnPermissionUsedRecordCallbackProxy : public IRemoteProxy<OnPermissionUsedRecordCallback> {
+public:
+    explicit OnPermissionUsedRecordCallbackProxy(const sptr<IRemoteObject>& impl);
+    ~OnPermissionUsedRecordCallbackProxy() override;
+
+    virtual void OnQueried(ErrCode code, PermissionUsedResult& result) override;
+private:
+    static inline BrokerDelegator<OnPermissionUsedRecordCallbackProxy> delegator_;
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+#endif // ON_PERMISSION_USED_RECORD_CALLBACK_PROXY_H
diff --git a/services/privacymanager/include/record/on_permission_used_record_callback_stub.h b/services/privacymanager/include/record/on_permission_used_record_callback_stub.h
index b6120fe1b3a26bff9b674dde77fab0e3ff3caba2..5088ca032f84fc48de6f41b7ec6e83c1a292e694 100644
--- a/services/privacymanager/include/record/on_permission_used_record_callback_stub.h
+++ b/services/privacymanager/include/record/on_permission_used_record_callback_stub.h
@@ -1,38 +1,38 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef ON_PERMISSION_USED_RECORD_CALLBACK_STUB_H
-#define ON_PERMISSION_USED_RECORD_CALLBACK_STUB_H
-
-
-#include "on_permission_used_record_callback.h"
-
-#include "iremote_stub.h"
-#include "nocopyable.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class OnPermissionUsedRecordCallbackStub : public IRemoteStub<OnPermissionUsedRecordCallback> {
-public:
-    OnPermissionUsedRecordCallbackStub() = default;
-    virtual ~OnPermissionUsedRecordCallbackStub() = default;
-
-    int32_t OnRemoteRequest(uint32_t code, MessageParcel& data, MessageParcel& reply, MessageOption& option) override;
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-#endif // ON_PERMISSION_USED_RECORD_CALLBACK_STUB_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef ON_PERMISSION_USED_RECORD_CALLBACK_STUB_H
+#define ON_PERMISSION_USED_RECORD_CALLBACK_STUB_H
+
+
+#include "on_permission_used_record_callback.h"
+
+#include "iremote_stub.h"
+#include "nocopyable.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class OnPermissionUsedRecordCallbackStub : public IRemoteStub<OnPermissionUsedRecordCallback> {
+public:
+    OnPermissionUsedRecordCallbackStub() = default;
+    virtual ~OnPermissionUsedRecordCallbackStub() = default;
+
+    int32_t OnRemoteRequest(uint32_t code, MessageParcel& data, MessageParcel& reply, MessageOption& option) override;
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+#endif // ON_PERMISSION_USED_RECORD_CALLBACK_STUB_H
diff --git a/services/privacymanager/include/record/permission_record.h b/services/privacymanager/include/record/permission_record.h
index f2c0abb0731e3b70c4b03e8408a1eeb80ba12f3c..56148a79e0587da4de1dff6df7605802d6bfae1c 100644
--- a/services/privacymanager/include/record/permission_record.h
+++ b/services/privacymanager/include/record/permission_record.h
@@ -1,41 +1,41 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef PERMISSION_RECORD_H
-#define PERMISSION_RECORD_H
-
-#include "generic_values.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-struct PermissionRecord {
-    uint32_t tokenId = 0;
-    int32_t opCode = 0;
-    int32_t status = 0;
-    int64_t timestamp = 0L;
-    int64_t accessDuration = 0L;
-    int32_t accessCount = 0;
-    int32_t rejectCount = 0;
-
-    PermissionRecord() = default;
-
-    static void TranslationIntoGenericValues(const PermissionRecord& record, GenericValues& values);
-    static void TranslationIntoPermissionRecord(const GenericValues& values, PermissionRecord& record);
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-#endif // PERMISSION_RECORD_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef PERMISSION_RECORD_H
+#define PERMISSION_RECORD_H
+
+#include "generic_values.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+struct PermissionRecord {
+    uint32_t tokenId = 0;
+    int32_t opCode = 0;
+    int32_t status = 0;
+    int64_t timestamp = 0L;
+    int64_t accessDuration = 0L;
+    int32_t accessCount = 0;
+    int32_t rejectCount = 0;
+
+    PermissionRecord() = default;
+
+    static void TranslationIntoGenericValues(const PermissionRecord& record, GenericValues& values);
+    static void TranslationIntoPermissionRecord(const GenericValues& values, PermissionRecord& record);
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+#endif // PERMISSION_RECORD_H
diff --git a/services/privacymanager/include/record/permission_record_manager.h b/services/privacymanager/include/record/permission_record_manager.h
index ae3c6706768fa26b4d2a7577b61ca28a88ed94a2..84bab127ffa9cea4a556976d973189e590a5c4e9 100644
--- a/services/privacymanager/include/record/permission_record_manager.h
+++ b/services/privacymanager/include/record/permission_record_manager.h
@@ -1,92 +1,80 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef PERMISSION_RECORD_MANAGER_H
-#define PERMISSION_RECORD_MANAGER_H
-
-#include <vector>
-#include <set>
-#include <string>
-
-#include "access_token.h"
-#include "active_change_response_info.h"
-#include "hap_token_info.h"
-#include "nocopyable.h"
-#include "on_permission_used_record_callback.h"
-#include "permission_record.h"
-#include "permission_used_request.h"
-#include "permission_used_result.h"
-
-#include "rwlock.h"
-#include "thread_pool.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class PermissionRecordManager final {
-public:
-    static PermissionRecordManager& GetInstance();
-    virtual ~PermissionRecordManager();
-
-    void Init();
-    int32_t AddPermissionUsedRecord(
-        AccessTokenID tokenId, const std::string& permissionName, int32_t successCount, int32_t failCount);
-    void RemovePermissionUsedRecords(AccessTokenID tokenId, const std::string& deviceID);
-    int32_t GetPermissionUsedRecords(const PermissionUsedRequest& request, PermissionUsedResult& result);
-    int32_t GetPermissionUsedRecordsAsync(
-        const PermissionUsedRequest& request, const sptr<OnPermissionUsedRecordCallback>& callback);
-    std::string DumpRecordInfo(AccessTokenID tokenId, const std::string& permissionName);
-    int32_t StartUsingPermission(AccessTokenID tokenId, const std::string& permissionName);
-    int32_t StopUsingPermission(AccessTokenID tokenId, const std::string& permissionName);
-    int32_t RegisterPermActiveStatusCallback(
-        std::vector<std::string>& permList, const sptr<IRemoteObject>& callback);
-    int32_t UnRegisterPermActiveStatusCallback(const sptr<IRemoteObject>& callback);
-
-    void CallbackExecute(AccessTokenID tokenId, const std::string& permissionName, int32_t status);
-
-private:
-    PermissionRecordManager();
-    DISALLOW_COPY_AND_MOVE(PermissionRecordManager);
-
-    bool GetLocalRecordTokenIdList(std::set<AccessTokenID>& tokenIdList);
-    void AddRecord(const PermissionRecord& record);
-    bool GetPermissionRecord(AccessTokenID tokenId, const std::string& permissionName,
-        int32_t successCount, int32_t failCount, PermissionRecord& record);
-    bool CreateBundleUsedRecord(const AccessTokenID tokenId, BundleUsedRecord& bundleRecord);
-    void ExecuteDeletePermissionRecordTask();
-    int32_t DeletePermissionRecord(int32_t days);
-    bool GetRecordsFromLocalDB(const PermissionUsedRequest& request, PermissionUsedResult& result);
-    bool GetRecords(int32_t flag, std::vector<GenericValues> recordValues,
-        BundleUsedRecord& bundleRecord, PermissionUsedResult& result);
-    void UpdateRecords(int32_t flag, const PermissionUsedRecord& inBundleRecord, PermissionUsedRecord& outBundleRecord);
-
-    void AddRecordToStartList(const PermissionRecord& record);
-    bool GetRecordFromStartList(uint32_t tokenId,  int32_t opCode, PermissionRecord& record);
-    void ResetRecord(PermissionRecord& record, int32_t status);
-    bool HasStarted(const PermissionRecord& record);
-    std::vector<PermissionRecord> GetRecordsAndReset(uint32_t tokenId, int32_t status);
-
-    std::string GetDeviceId(AccessTokenID tokenId);
-
-    OHOS::ThreadPool deleteTaskWorker_;
-    bool hasInited_;
-    OHOS::Utils::RWLock rwLock_;
-    OHOS::Utils::RWLock startRecordListRWLock_;
-    std::vector<PermissionRecord> startRecordList_;
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-#endif // PERMISSION_RECORD_MANAGER_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef PERMISSION_RECORD_MANAGER_H
+#define PERMISSION_RECORD_MANAGER_H
+
+#include <vector>
+#include <set>
+#include <string>
+
+#include "access_token.h"
+#include "hap_token_info.h"
+#include "nocopyable.h"
+#include "on_permission_used_record_callback.h"
+#include "permission_record.h"
+#include "permission_used_request.h"
+#include "permission_used_result.h"
+
+#include "rwlock.h"
+#include "thread_pool.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class PermissionRecordManager final {
+public:
+    static PermissionRecordManager& GetInstance();
+    virtual ~PermissionRecordManager();
+
+    void Init();
+    int32_t AddPermissionUsedRecord(
+        AccessTokenID tokenId, const std::string& permissionName, int32_t successCount, int32_t failCount);
+    void RemovePermissionUsedRecords(AccessTokenID tokenId, const std::string& deviceID);
+    int32_t GetPermissionUsedRecords(const PermissionUsedRequest& request, PermissionUsedResult& result);
+    int32_t GetPermissionUsedRecordsAsync(
+        const PermissionUsedRequest& request, const sptr<OnPermissionUsedRecordCallback>& callback);
+    std::string DumpRecordInfo(AccessTokenID tokenId, const std::string& permissionName);
+    int32_t StartUsingPermission(AccessTokenID tokenId, const std::string& permissionName);
+    int32_t StopUsingPermission(AccessTokenID tokenId, const std::string& permissionName);
+    int32_t RegisterPermActiveStatusCallback(
+        std::vector<std::string>& permList, const sptr<IRemoteObject>& callback);
+    int32_t UnRegisterPermActiveStatusCallback(const sptr<IRemoteObject>& callback);
+private:
+    PermissionRecordManager();
+    DISALLOW_COPY_AND_MOVE(PermissionRecordManager);
+
+    bool GetLocalRecordTokenIdList(std::set<AccessTokenID>& tokenIdList);
+    int32_t AddRecord(const PermissionRecord& record);
+    bool GetPermissionsRecord(AccessTokenID tokenId, const std::string& permissionName,
+        int32_t successCount, int32_t failCount, PermissionRecord& record);
+    bool CreateBundleUsedRecord(const AccessTokenID tokenId, BundleUsedRecord& bundleRecord);
+    void ExecuteDeletePermissionRecordTask();
+    int32_t DeletePermissionRecord(int32_t days);
+    bool GetRecordsFromLocalDB(const PermissionUsedRequest& request, PermissionUsedResult& result);
+    bool GetRecords(int32_t flag, std::vector<GenericValues> recordValues,
+        BundleUsedRecord& bundleRecord, PermissionUsedResult& result);
+    void UpdateRecords(int32_t flag, const PermissionUsedRecord& inBundleRecord, PermissionUsedRecord& outBundleRecord);
+
+    std::string GetDeviceId(AccessTokenID tokenId);
+
+    OHOS::ThreadPool deleteTaskWorker_;
+    bool hasInited_;
+    OHOS::Utils::RWLock rwLock_;
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+#endif // PERMISSION_RECORD_MANAGER_H
diff --git a/services/privacymanager/include/record/permission_record_node.h b/services/privacymanager/include/record/permission_record_node.h
index d56b3d80083cd0c2f0b297aad08ef2a5b9cbe9e0..abd0af8ca16d069104a82aa3485f077a40aa38e6 100644
--- a/services/privacymanager/include/record/permission_record_node.h
+++ b/services/privacymanager/include/record/permission_record_node.h
@@ -1,35 +1,35 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef PERMISSION_UESD_RECORD_NODE_H
-#define PERMISSION_UESD_RECORD_NODE_H
-
-#include <memory>
-#include "permission_record.h"
-#include "rwlock.h"
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-struct PermissionUsedRecordNode {
-    std::weak_ptr<PermissionUsedRecordNode> pre;
-    std::shared_ptr<PermissionUsedRecordNode> next;
-    PermissionRecord record;
-    
-    PermissionUsedRecordNode() = default;
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-#endif // PERMISSION_UESD_RECORD_NODE_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef PERMISSION_UESD_RECORD_NODE_H
+#define PERMISSION_UESD_RECORD_NODE_H
+
+#include <memory>
+#include "permission_record.h"
+#include "rwlock.h"
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+struct PermissionUsedRecordNode {
+    std::weak_ptr<PermissionUsedRecordNode> pre;
+    std::shared_ptr<PermissionUsedRecordNode> next;
+    PermissionRecord record;
+    
+    PermissionUsedRecordNode() = default;
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+#endif // PERMISSION_UESD_RECORD_NODE_H
diff --git a/services/privacymanager/include/record/permission_record_repository.h b/services/privacymanager/include/record/permission_record_repository.h
index 1ca8caee907aa98710b5b9b1e38da2516c8b2542..385f30fab93553daaa5e773c5cc9ea0f85b8d639 100644
--- a/services/privacymanager/include/record/permission_record_repository.h
+++ b/services/privacymanager/include/record/permission_record_repository.h
@@ -1,44 +1,44 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef PERMISSION_RECORD_REPOSITORY_H
-#define PERMISSION_RECORD_REPOSITORY_H
-
-#include <vector>
-#include "generic_values.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class PermissionRecordRepository final {
-public:
-    virtual ~PermissionRecordRepository();
-    PermissionRecordRepository();
-
-    static PermissionRecordRepository& GetInstance();
-
-    bool AddRecordValues(const std::vector<GenericValues>& recordValues);
-    bool FindRecordValues(const GenericValues& andConditionValues,
-        const GenericValues& orConditionValues, std::vector<GenericValues>& recordValues);
-    bool RemoveRecordValues(const GenericValues& conditionValues);
-    bool GetAllRecordValuesByKey(const std::string& condition, std::vector<GenericValues>& resultValues);
-    void CountRecordValues(GenericValues& resultValues);
-    bool DeleteExpireRecordsValues(const GenericValues& andConditions);
-    bool DeleteExcessiveSizeRecordValues(uint32_t excessiveSize);
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-#endif // PERMISSION_RECORD_REPOSITORY_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef PERMISSION_RECORD_REPOSITORY_H
+#define PERMISSION_RECORD_REPOSITORY_H
+
+#include <vector>
+#include "generic_values.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class PermissionRecordRepository final {
+public:
+    virtual ~PermissionRecordRepository();
+    PermissionRecordRepository();
+
+    static PermissionRecordRepository& GetInstance();
+
+    bool AddRecordValues(const std::vector<GenericValues>& recordValues);
+    bool FindRecordValues(const GenericValues& andConditionValues,
+        const GenericValues& orConditionValues, std::vector<GenericValues>& recordValues);
+    bool RemoveRecordValues(const GenericValues& conditionValues);
+    bool GetAllRecordValuesByKey(const std::string& condition, std::vector<GenericValues>& resultValues);
+    int32_t CountRecordValues(GenericValues& resultValues);
+    bool DeleteExpireRecordsValues(const GenericValues& andConditions);
+    bool DeleteExcessiveSizeRecordValues(uint32_t excessiveSize);
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+#endif // PERMISSION_RECORD_REPOSITORY_H
diff --git a/services/privacymanager/include/record/permission_used_record_cache.h b/services/privacymanager/include/record/permission_used_record_cache.h
index 272bef4716fc953a84c376292c4e21fbcf296d72..f4ec94aa4819bded61664466f77d9cdb24320edd 100644
--- a/services/privacymanager/include/record/permission_used_record_cache.h
+++ b/services/privacymanager/include/record/permission_used_record_cache.h
@@ -1,77 +1,78 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef PERMISSION_USED_RECORD_CACHE_H
-#define PERMISSION_USED_RECORD_CACHE_H
-
-#include <map>
-#include <memory>
-#include <string>
-#include <set>
-#include <vector>
-#include "accesstoken_kit.h"
-#include "nocopyable.h"
-#include "permission_record.h"
-#include "permission_record_node.h"
-#include "rwlock.h"
-#include "thread_pool.h"
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class PermissionUsedRecordCache {
-public:
-    static PermissionUsedRecordCache& GetInstance();
-    void AddRecordToBuffer(PermissionRecord& record);
-    void MergeRecord(PermissionRecord& record, std::shared_ptr<PermissionUsedRecordNode> curFindMergePos);
-    void AddToPersistQueue(const std::shared_ptr<PermissionUsedRecordNode> persistPendingBufferHead);
-    void ExecuteReadRecordBufferTask();
-    int32_t PersistPendingRecords();
-    void GetPersistPendingRecordsAndReset();
-    int32_t RemoveRecords(const AccessTokenID tokenId);
-    void RemoveRecordsFromPersistPendingBufferQueue(const AccessTokenID tokenId,
-        std::shared_ptr<PermissionUsedRecordNode> persistPendingBufferHead,
-        std::shared_ptr<PermissionUsedRecordNode> persistPendingBufferEnd);
-    void GetRecords(const std::vector<std::string>& permissionList,
-        const GenericValues& andConditionValues, const GenericValues& orConditionValues,
-        std::vector<GenericValues>& findRecordsValues);
-    void GetRecordsFromPersistPendingBufferQueue(const std::set<int32_t>& opCodeList,
-        const GenericValues& andConditionValues, const GenericValues& orConditionValues,
-        std::vector<GenericValues>& findRecordsValues);
-    bool RecordCompare(const AccessTokenID tokenId, const std::set<int32_t>& opCodeList,
-        const GenericValues& andConditionValues, const PermissionRecord& record);
-    void FindTokenIdList(std::set<AccessTokenID>& tokenIdList);
-    void TransferToOpcode(std::set<int32_t>& opCodeList,
-        const std::vector<std::string>& permissionList);
-    void ResetRecordBuffer(const int32_t remainCount,
-        std::shared_ptr<PermissionUsedRecordNode>& persistPendingBufferEnd);
-    void AddRecordNode(const PermissionRecord& record);
-    void DeleteRecordNode(std::shared_ptr<PermissionUsedRecordNode> deleteRecordNode);
-	    
-private:
-    int32_t readableSize_ = 0;
-    std::shared_ptr<PermissionUsedRecordNode> recordBufferHead_ = std::make_shared<PermissionUsedRecordNode>();
-    std::shared_ptr<PermissionUsedRecordNode> curRecordBufferPos_ = recordBufferHead_;
-    std::vector<std::shared_ptr<PermissionUsedRecordNode>> persistPendingBufferQueue_;
-    int64_t nextPersistTimestamp_ = 0L;
-    const static int32_t INTERVAL = 60 * 15;
-    const static int32_t MAX_PERSIST_SIZE = 100;
-    int32_t persistIsRunning_ = 0;
-    OHOS::Utils::RWLock cacheLock_;
-    OHOS::ThreadPool readRecordBufferTaskWorker_;
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-#endif // PERMISSION_USED_RECORD_CACHE_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef PERMISSION_USED_RECORD_CACHE_H
+#define PERMISSION_USED_RECORD_CACHE_H
+
+#include <map>
+#include <memory>
+#include <string>
+#include <set>
+#include <vector>
+#include "accesstoken_kit.h"
+#include "nocopyable.h"
+#include "permission_record.h"
+#include "permission_record_node.h"
+#include "rwlock.h"
+#include "thread_pool.h"
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class PermissionUsedRecordCache {
+public:
+    static PermissionUsedRecordCache& GetInstance();
+    int32_t AddRecordToBuffer(PermissionRecord& record);
+    void MergeRecord(PermissionRecord& record, std::shared_ptr<PermissionUsedRecordNode> curFindMergePos);
+    void AddToPersistQueue(const std::shared_ptr<PermissionUsedRecordNode> persistPendingBufferHead);
+    void ExecuteReadRecordBufferTask();
+    int32_t PersistPendingRecords();
+    void GetPersistPendingRecordsAndReset();
+    int32_t RemoveRecords(const GenericValues &record);
+    void RemoveRecordsFromPersistPendingBufferQueue(const GenericValues &record,
+        std::shared_ptr<PermissionUsedRecordNode> persistPendingBufferHead,
+        std::shared_ptr<PermissionUsedRecordNode> persistPendingBufferEnd);
+    void GetRecords(const std::vector<std::string>& permissionList,
+        const GenericValues &andConditionValues, const GenericValues& orConditionValues,
+        std::vector<GenericValues>& findRecordsValues);
+    void GetAllRecords(const std::vector<std::string>& permissionList,
+        const GenericValues &andConditionValues, const GenericValues& orConditionValues,
+        std::vector<GenericValues>& findRecordsValues);
+    void GetRecordsFromPersistPendingBufferQueue(const std::vector<std::string>& permissionList,
+        const GenericValues& andConditionValues, const GenericValues& orConditionValues,
+        std::vector<GenericValues>& findRecordsValues, const std::set<int32_t>& opCodeList);
+    bool RecordCompare(const AccessTokenID tokenId, const std::set<int32_t>& opCodeList,
+        const GenericValues &andConditionValues, const PermissionRecord &record);
+    void FindTokenIdList(std::set<AccessTokenID>& tokenIdList);
+    void TransferToOpcode(std::set<int32_t>& opCodeList,
+        const std::vector<std::string>& permissionList);
+    void AddRecordNode(const PermissionRecord& record);
+    void DeleteRecordNode(std::shared_ptr<PermissionUsedRecordNode> deleteRecordNode);
+	    
+private:
+    int32_t readableSize_ = 0;
+    std::shared_ptr<PermissionUsedRecordNode> recordBufferHead_ = std::make_shared<PermissionUsedRecordNode>();
+    std::shared_ptr<PermissionUsedRecordNode> curRecordBufferPos_ = recordBufferHead_;
+    std::vector<std::shared_ptr<PermissionUsedRecordNode>> persistPendingBufferQueue_;
+    int64_t nextPersistTimestamp_ = 0L;
+    const static int32_t INTERVAL = 60 * 15;
+    const static int32_t MAX_PERSIST_SIZE = 100;
+    int32_t persistIsRunning_ = 0;
+    OHOS::Utils::RWLock cacheLock_;
+    OHOS::ThreadPool readRecordBufferTaskWorker_;
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+#endif // PERMISSION_USED_RECORD_CACHE_H
diff --git a/services/privacymanager/include/service/privacy_manager_service.h b/services/privacymanager/include/service/privacy_manager_service.h
index ce276d297ecefa5984f0e7b0cedd97a9d6908e6a..854a28365e29364302db6ee35fd11941116ffb4e 100644
--- a/services/privacymanager/include/service/privacy_manager_service.h
+++ b/services/privacymanager/include/service/privacy_manager_service.h
@@ -1,61 +1,61 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef PRIVACY_MANAGER_SERVICE_H
-#define PRIVACY_MANAGER_SERVICE_H
-
-#include <string>
-
-#include "privacy_manager_stub.h"
-#include "iremote_object.h"
-#include "nocopyable.h"
-#include "singleton.h"
-#include "system_ability.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-enum class ServiceRunningState { STATE_NOT_START, STATE_RUNNING };
-class PrivacyManagerService final : public SystemAbility, public PrivacyManagerStub {
-    DECLARE_DELAYED_SINGLETON(PrivacyManagerService);
-    DECLEAR_SYSTEM_ABILITY(PrivacyManagerService);
-
-public:
-    void OnStart() override;
-    void OnStop() override;
-
-    int32_t AddPermissionUsedRecord(
-        AccessTokenID tokenId, const std::string& permissionName, int32_t successCount, int32_t failCount) override;
-    int32_t StartUsingPermission(AccessTokenID tokenId, const std::string& permissionName) override;
-    int32_t StopUsingPermission(AccessTokenID tokenId, const std::string& permissionName) override;
-    int32_t RemovePermissionUsedRecords(AccessTokenID tokenId, const std::string& deviceID) override;
-    int32_t GetPermissionUsedRecords(
-        const PermissionUsedRequestParcel& request, PermissionUsedResultParcel& result) override;
-    int32_t GetPermissionUsedRecords(
-        const PermissionUsedRequestParcel& request, const sptr<OnPermissionUsedRecordCallback>& callback) override;
-    std::string DumpRecordInfo(AccessTokenID tokenId, const std::string& permissionName) override;
-    int32_t RegisterPermActiveStatusCallback(
-        std::vector<std::string>& permList, const sptr<IRemoteObject>& callback) override;
-    int32_t UnRegisterPermActiveStatusCallback(const sptr<IRemoteObject>& callback) override;
-
-private:
-    bool Initialize() const;
-
-    ServiceRunningState state_;
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-#endif // PRIVACY_MANAGER_SERVICE_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef PRIVACY_MANAGER_SERVICE_H
+#define PRIVACY_MANAGER_SERVICE_H
+
+#include <string>
+
+#include "privacy_manager_stub.h"
+#include "iremote_object.h"
+#include "nocopyable.h"
+#include "singleton.h"
+#include "system_ability.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+enum class ServiceRunningState { STATE_NOT_START, STATE_RUNNING };
+class PrivacyManagerService final : public SystemAbility, public PrivacyManagerStub {
+    DECLARE_DELAYED_SINGLETON(PrivacyManagerService);
+    DECLEAR_SYSTEM_ABILITY(PrivacyManagerService);
+
+public:
+    void OnStart() override;
+    void OnStop() override;
+
+    int32_t AddPermissionUsedRecord(
+        AccessTokenID tokenId, const std::string& permissionName, int32_t successCount, int32_t failCount) override;
+    int32_t StartUsingPermission(AccessTokenID tokenId, const std::string& permissionName) override;
+    int32_t StopUsingPermission(AccessTokenID tokenId, const std::string& permissionName) override;
+    int32_t RemovePermissionUsedRecords(AccessTokenID tokenId, const std::string& deviceID) override;
+    int32_t GetPermissionUsedRecords(
+        const PermissionUsedRequestParcel& request, PermissionUsedResultParcel& result) override;
+    int32_t GetPermissionUsedRecords(
+        const PermissionUsedRequestParcel& request, const sptr<OnPermissionUsedRecordCallback>& callback) override;
+    std::string DumpRecordInfo(AccessTokenID tokenId, const std::string& permissionName) override;
+    int32_t RegisterPermActiveStatusCallback(
+        std::vector<std::string>& permList, const sptr<IRemoteObject>& callback) override;
+    int32_t UnRegisterPermActiveStatusCallback(const sptr<IRemoteObject>& callback) override;
+    bool IsAllowUsingPermission(AccessTokenID tokenId, const std::string& permissionName) override;
+private:
+    bool Initialize() const;
+
+    ServiceRunningState state_;
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+#endif // PRIVACY_MANAGER_SERVICE_H
diff --git a/services/privacymanager/include/service/privacy_manager_stub.h b/services/privacymanager/include/service/privacy_manager_stub.h
index 17f592436b386e52ffd31ebc9528acb30db5edb4..767cdbee5205621665f23145d1cd8e0bd68e0f2e 100644
--- a/services/privacymanager/include/service/privacy_manager_stub.h
+++ b/services/privacymanager/include/service/privacy_manager_stub.h
@@ -1,50 +1,51 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef PRIVACY_MANAGER_STUB_H
-#define PRIVACY_MANAGER_STUB_H
-
-#include "i_privacy_manager.h"
-
-#include "iremote_stub.h"
-#include "nocopyable.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class PrivacyManagerStub : public IRemoteStub<IPrivacyManager> {
-public:
-    PrivacyManagerStub() = default;
-    virtual ~PrivacyManagerStub() = default;
-
-    int32_t OnRemoteRequest(uint32_t code, MessageParcel& data, MessageParcel& reply, MessageOption& option) override;
-
-private:
-    void AddPermissionUsedRecordInner(MessageParcel& data, MessageParcel& reply);
-    void StartUsingPermissionInner(MessageParcel& data, MessageParcel& reply);
-    void StopUsingPermissionInner(MessageParcel& data, MessageParcel& reply);
-    void RemovePermissionUsedRecordsInner(MessageParcel& data, MessageParcel& reply);
-    void GetPermissionUsedRecordsInner(MessageParcel& data, MessageParcel& reply);
-    void GetPermissionUsedRecordsAsyncInner(MessageParcel& data, MessageParcel& reply);
-    void DumpRecordInfoInner(MessageParcel& data, MessageParcel& reply);
-    void RegisterPermActiveStatusCallbackInner(MessageParcel& data, MessageParcel& reply);
-    void UnRegisterPermActiveStatusCallbackInner(MessageParcel& data, MessageParcel& reply);
-    bool IsAccessTokenCalling() const;
-    static const int32_t ACCESSTOKEN_UID = 3020;
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-#endif // PRIVACY_MANAGER_STUB_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef PRIVACY_MANAGER_STUB_H
+#define PRIVACY_MANAGER_STUB_H
+
+#include "i_privacy_manager.h"
+
+#include "iremote_stub.h"
+#include "nocopyable.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class PrivacyManagerStub : public IRemoteStub<IPrivacyManager> {
+public:
+    PrivacyManagerStub() = default;
+    virtual ~PrivacyManagerStub() = default;
+
+    int32_t OnRemoteRequest(uint32_t code, MessageParcel& data, MessageParcel& reply, MessageOption& option) override;
+
+private:
+    void AddPermissionUsedRecordInner(MessageParcel& data, MessageParcel& reply);
+    void StartUsingPermissionInner(MessageParcel& data, MessageParcel& reply);
+    void StopUsingPermissionInner(MessageParcel& data, MessageParcel& reply);
+    void RemovePermissionUsedRecordsInner(MessageParcel& data, MessageParcel& reply);
+    void GetPermissionUsedRecordsInner(MessageParcel& data, MessageParcel& reply);
+    void GetPermissionUsedRecordsAsyncInner(MessageParcel& data, MessageParcel& reply);
+    void DumpRecordInfoInner(MessageParcel& data, MessageParcel& reply);
+    void RegisterPermActiveStatusCallbackInner(MessageParcel& data, MessageParcel& reply);
+    void UnRegisterPermActiveStatusCallbackInner(MessageParcel& data, MessageParcel& reply);
+    void IsAllowUsingPermissionInner(MessageParcel& data, MessageParcel& reply);
+    bool IsAccessTokenCalling() const;
+    static const int32_t ACCESSTOKEN_UID = 3020;
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+#endif // PRIVACY_MANAGER_STUB_H
diff --git a/services/privacymanager/privacy.cfg b/services/privacymanager/privacy.cfg
index 30d01427cab02273c043be171670f6ce81a61aa6..bb9d71e062521b38e4bfcf2c61ed3b29e4b15d03 100644
--- a/services/privacymanager/privacy.cfg
+++ b/services/privacymanager/privacy.cfg
@@ -1,11 +1,11 @@
-{
-    "services" : [{
-            "name" : "privacy_service",
-            "path" : ["/system/bin/sa_main", "/system/profile/privacy_service.xml"],
-            "importance" : -20,
-            "uid" : "access_token",
-            "gid" : ["access_token"],
-            "secon" : "u:r:privacy_service:s0"
-        }
-    ]
-}
+{
+    "services" : [{
+            "name" : "privacy_service",
+            "path" : ["/system/bin/sa_main", "/system/profile/privacy_service.xml"],
+            "importance" : -20,
+            "uid" : "access_token",
+            "gid" : ["access_token"],
+            "secon" : "u:r:privacy_service:s0"
+        }
+    ]
+}
diff --git a/services/privacymanager/privacy.rc b/services/privacymanager/privacy.rc
index 9757637549b395e7ba088daf158e5a75af787ebc..40f5e6b8a3eb25199d8d11092ea43fc975124367 100644
--- a/services/privacymanager/privacy.rc
+++ b/services/privacymanager/privacy.rc
@@ -1,22 +1,22 @@
-# Copyright (c) 2022 Huawei Device Co., Ltd.
-# Licensed under the Apache License, Version 2.0 (the "License");
-# you may not use this file except in compliance with the License.
-# You may obtain a copy of the License at
-#
-#     http://www.apache.org/licenses/LICENSE-2.0
-#
-# Unless required by applicable law or agreed to in writing, software
-# distributed under the License is distributed on an "AS IS" BASIS,
-# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-# See the License for the specific language governing permissions and
-# limitations under the License.
-
-on late-fs
-    start privacy_service
-
-service privacy_service /system/bin/sa_main /system/profile/privacy_service.xml
-    class privacy_service
-    priority -20
-    user access_token
-    group access_token
-    seclabel u:r:privacy_service:s0
+# Copyright (c) 2022 Huawei Device Co., Ltd.
+# Licensed under the Apache License, Version 2.0 (the "License");
+# you may not use this file except in compliance with the License.
+# You may obtain a copy of the License at
+#
+#     http://www.apache.org/licenses/LICENSE-2.0
+#
+# Unless required by applicable law or agreed to in writing, software
+# distributed under the License is distributed on an "AS IS" BASIS,
+# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+# See the License for the specific language governing permissions and
+# limitations under the License.
+
+on late-fs
+    start privacy_service
+
+service privacy_service /system/bin/sa_main /system/profile/privacy_service.xml
+    class privacy_service
+    priority -20
+    user access_token
+    group access_token
+    seclabel u:r:privacy_service:s0
diff --git a/services/privacymanager/sa_profile/3505.xml b/services/privacymanager/sa_profile/3505.xml
index 60b5eae50adee6518181101826cda8b7f4b6e8a3..16f0bc779c05fb4944de4ecf9da890cdec468df1 100644
--- a/services/privacymanager/sa_profile/3505.xml
+++ b/services/privacymanager/sa_profile/3505.xml
@@ -1,24 +1,24 @@
-<?xml version="1.0" encoding="utf-8"?>
-<!-- Copyright (c) 2022 Huawei Device Co., Ltd.
-     Licensed under the Apache License, Version 2.0 (the "License");
-     you may not use this file except in compliance with the License.
-     You may obtain a copy of the License at
-
-         http://www.apache.org/licenses/LICENSE-2.0
-
-     Unless required by applicable law or agreed to in writing, software
-     distributed under the License is distributed on an "AS IS" BASIS,
-     WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-     See the License for the specific language governing permissions and
-     limitations under the License.
--->
-<info>
-    <process>privacy_service</process>
-    <systemability>
-        <name>3505</name>
-        <libpath>libprivacy_manager_service.z.so</libpath>
-        <run-on-create>true</run-on-create>
-        <distributed>true</distributed>
-        <dump-level>1</dump-level>
-    </systemability>
-</info>
+<?xml version="1.0" encoding="utf-8"?>
+<!-- Copyright (c) 2022 Huawei Device Co., Ltd.
+     Licensed under the Apache License, Version 2.0 (the "License");
+     you may not use this file except in compliance with the License.
+     You may obtain a copy of the License at
+
+         http://www.apache.org/licenses/LICENSE-2.0
+
+     Unless required by applicable law or agreed to in writing, software
+     distributed under the License is distributed on an "AS IS" BASIS,
+     WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+     See the License for the specific language governing permissions and
+     limitations under the License.
+-->
+<info>
+    <process>privacy_service</process>
+    <systemability>
+        <name>3505</name>
+        <libpath>libprivacy_manager_service.z.so</libpath>
+        <run-on-create>true</run-on-create>
+        <distributed>true</distributed>
+        <dump-level>1</dump-level>
+    </systemability>
+</info>
diff --git a/services/privacymanager/sa_profile/BUILD.gn b/services/privacymanager/sa_profile/BUILD.gn
index 1bf6fc36a2b69832f8235d7267bedc68cc879f91..d44a4cd6132b57bb0799ede16819055106007261 100644
--- a/services/privacymanager/sa_profile/BUILD.gn
+++ b/services/privacymanager/sa_profile/BUILD.gn
@@ -1,23 +1,23 @@
-# Copyright (c) 2022 Huawei Device Co., Ltd.
-# Licensed under the Apache License, Version 2.0 (the "License");
-# you may not use this file except in compliance with the License.
-# You may obtain a copy of the License at
-#
-#     http://www.apache.org/licenses/LICENSE-2.0
-#
-# Unless required by applicable law or agreed to in writing, software
-# distributed under the License is distributed on an "AS IS" BASIS,
-# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
-# See the License for the specific language governing permissions and
-# limitations under the License.
-
-import("//build/ohos.gni")
-import("//build/ohos/sa_profile/sa_profile.gni")
-
-if (is_standard_system) {
-  ohos_sa_profile("privacy_sa_profile_standard") {
-    part_name = "access_token"
-
-    sources = [ "3505.xml" ]
-  }
-}
+# Copyright (c) 2022 Huawei Device Co., Ltd.
+# Licensed under the Apache License, Version 2.0 (the "License");
+# you may not use this file except in compliance with the License.
+# You may obtain a copy of the License at
+#
+#     http://www.apache.org/licenses/LICENSE-2.0
+#
+# Unless required by applicable law or agreed to in writing, software
+# distributed under the License is distributed on an "AS IS" BASIS,
+# WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+# See the License for the specific language governing permissions and
+# limitations under the License.
+
+import("//build/ohos.gni")
+import("//build/ohos/sa_profile/sa_profile.gni")
+
+if (is_standard_system) {
+  ohos_sa_profile("privacy_sa_profile_standard") {
+    part_name = "access_token"
+
+    sources = [ "3505.xml" ]
+  }
+}
diff --git a/services/privacymanager/src/active/active_status_callback_manager.cpp b/services/privacymanager/src/active/active_status_callback_manager.cpp
index b14bcd6e249557823696e4d66e9926cdad95368d..9b7a68b4fe83fab65157aa71965ecd8830550e2f 100644
--- a/services/privacymanager/src/active/active_status_callback_manager.cpp
+++ b/services/privacymanager/src/active/active_status_callback_manager.cpp
@@ -1,154 +1,154 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "active_status_callback_manager.h"
-
-#include <future>
-#include <thread>
-#include <datetime_ex.h>
-
-#include "accesstoken_log.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-namespace {
-static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
-    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "ActiveStatusCallbackManager"
-};
-static const time_t MAX_TIMEOUT_SEC = 30;
-static const time_t MAX_CALLBACK_SIZE = 200;
-}
-
-ActiveStatusCallbackManager& ActiveStatusCallbackManager::GetInstance()
-{
-    static ActiveStatusCallbackManager instance;
-    return instance;
-}
-
-ActiveStatusCallbackManager::ActiveStatusCallbackManager()
-    : callbackDeathRecipient_(sptr<IRemoteObject::DeathRecipient>(
-        new (std::nothrow) PermActiveStatusCallbackDeathRecipient()))
-{
-}
-
-ActiveStatusCallbackManager::~ActiveStatusCallbackManager()
-{
-}
-
-int32_t ActiveStatusCallbackManager::AddCallback(
-    const std::vector<std::string>& permList, const sptr<IRemoteObject>& callback)
-{
-    ACCESSTOKEN_LOG_INFO(LABEL, "callback %{public}p ", (IRemoteObject *)callback);
-    if (callback == nullptr) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "input is nullptr");
-        return RET_FAILED;
-    }
-
-    callback->AddDeathRecipient(callbackDeathRecipient_);
-
-    CallbackData recordInstance;
-    recordInstance.callbackObject_ = callback;
-    recordInstance.permList_ = permList;
-
-    std::lock_guard<std::mutex> lock(mutex_);
-    if (callbackDataList_.size() > MAX_CALLBACK_SIZE) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "list size has reached max value");
-        return RET_FAILED;
-    }
-    callbackDataList_.emplace_back(recordInstance);
-
-    ACCESSTOKEN_LOG_INFO(LABEL, "recordInstance is added");
-    return RET_SUCCESS;
-}
-
-int32_t ActiveStatusCallbackManager::RemoveCallback(const sptr<IRemoteObject>& callback)
-{
-    ACCESSTOKEN_LOG_INFO(LABEL, "called");
-    if (callback == nullptr) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "callback is nullptr");
-        return RET_FAILED;
-    }
-
-    std::lock_guard<std::mutex> lock(mutex_);
-
-    for (auto it = callbackDataList_.begin(); it != callbackDataList_.end(); ++it) {
-        if (callback == (*it).callbackObject_) {
-            ACCESSTOKEN_LOG_INFO(LABEL, "find callback");
-            if (callbackDeathRecipient_ != nullptr) {
-                callback->RemoveDeathRecipient(callbackDeathRecipient_);
-            }
-            (*it).callbackObject_ = nullptr;
-            callbackDataList_.erase(it);
-            break;
-        }
-    }
-    return RET_SUCCESS;
-}
-
-bool ActiveStatusCallbackManager::NeedCalled(const std::vector<std::string>& permList, const std::string& permName)
-{
-    if (permList.empty()) {
-        return true;
-    }
-    for (const auto& perm : permList) {
-        if (perm == permName) {
-            return true;
-        }
-    }
-    return false;
-}
-
-void ActiveStatusCallbackManager::ExecuteCallbackAsync(
-    AccessTokenID tokenId, const std::string& permName, const std::string& deviceId, ActiveChangeType changeType)
-{
-    ACCESSTOKEN_LOG_INFO(LABEL, "entry");
-
-    auto callbackFunc = [&]() {
-        ACCESSTOKEN_LOG_INFO(LABEL, "callbackStart");
-        std::lock_guard<std::mutex> lock(mutex_);
-        for (auto it = callbackDataList_.begin(); it != callbackDataList_.end(); ++it) {
-            std::vector<std::string> permList = (*it).permList_;
-            if (!NeedCalled(permList, permName)) {
-                ACCESSTOKEN_LOG_INFO(LABEL, "tokenId %{public}u, permName %{public}s", tokenId, permName.c_str());
-                continue;
-            }
-            auto callback = iface_cast<IPermActiveStatusCallback>((*it).callbackObject_);
-            if (callback != nullptr) {
-                ActiveChangeResponse resInfo;
-                resInfo.type = changeType;
-                resInfo.permissionName = permName;
-                resInfo.tokenID = tokenId;
-                resInfo.deviceId = deviceId;
-                ACCESSTOKEN_LOG_INFO(LABEL, "callback excute changeType %{public}d", changeType);
-                callback->ActiveStatusChangeCallback(resInfo);
-            }
-        }
-    };
-
-    std::packaged_task<void()> callbackTask(callbackFunc);
-    std::future<void> fut = callbackTask.get_future();
-    std::make_unique<std::thread>(std::move(callbackTask))->detach();
-
-    ACCESSTOKEN_LOG_INFO(LABEL, "Waiting for the callback execution complete...");
-    std::future_status status = fut.wait_for(std::chrono::seconds(MAX_TIMEOUT_SEC));
-    if (status == std::future_status::timeout) {
-        ACCESSTOKEN_LOG_WARN(LABEL, "callbackTask callback execution timeout");
-    }
-    ACCESSTOKEN_LOG_INFO(LABEL, "The callback execution is complete");
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "active_status_callback_manager.h"
+
+#include <future>
+#include <thread>
+#include <datetime_ex.h>
+
+#include "accesstoken_log.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+namespace {
+static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
+    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "ActiveStatusCallbackManager"
+};
+static const time_t MAX_TIMEOUT_SEC = 30;
+static const time_t MAX_CALLBACK_SIZE = 200;
+}
+
+ActiveStatusCallbackManager& ActiveStatusCallbackManager::GetInstance()
+{
+    static ActiveStatusCallbackManager instance;
+    return instance;
+}
+
+ActiveStatusCallbackManager::ActiveStatusCallbackManager()
+    : callbackDeathRecipient_(sptr<IRemoteObject::DeathRecipient>(
+        new (std::nothrow) PermActiveStatusCallbackDeathRecipient()))
+{
+}
+
+ActiveStatusCallbackManager::~ActiveStatusCallbackManager()
+{
+}
+
+int32_t ActiveStatusCallbackManager::AddCallback(
+    const std::vector<std::string>& permList, const sptr<IRemoteObject>& callback)
+{
+    ACCESSTOKEN_LOG_INFO(LABEL, "callback %{public}p ", (IRemoteObject *)callback);
+    if (callback == nullptr) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "input is nullptr");
+        return RET_FAILED;
+    }
+
+    callback->AddDeathRecipient(callbackDeathRecipient_);
+
+    CallbackData recordInstance;
+    recordInstance.callbackObject_ = callback;
+    recordInstance.permList_ = permList;
+
+    std::lock_guard<std::mutex> lock(mutex_);
+    if (callbackDataList_.size() > MAX_CALLBACK_SIZE) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "list size has reached max value");
+        return RET_FAILED;
+    }
+    callbackDataList_.emplace_back(recordInstance);
+
+    ACCESSTOKEN_LOG_INFO(LABEL, "recordInstance is added");
+    return RET_SUCCESS;
+}
+
+int32_t ActiveStatusCallbackManager::RemoveCallback(const sptr<IRemoteObject>& callback)
+{
+    ACCESSTOKEN_LOG_INFO(LABEL, "called");
+    if (callback == nullptr) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "callback is nullptr");
+        return RET_FAILED;
+    }
+
+    std::lock_guard<std::mutex> lock(mutex_);
+
+    for (auto it = callbackDataList_.begin(); it != callbackDataList_.end(); ++it) {
+        if (callback == (*it).callbackObject_) {
+            ACCESSTOKEN_LOG_INFO(LABEL, "find callback");
+            if (callbackDeathRecipient_ != nullptr) {
+                callback->RemoveDeathRecipient(callbackDeathRecipient_);
+            }
+            (*it).callbackObject_ = nullptr;
+            callbackDataList_.erase(it);
+            break;
+        }
+    }
+    return RET_SUCCESS;
+}
+
+bool ActiveStatusCallbackManager::NeedCalled(const std::vector<std::string>& permList, const std::string& permName)
+{
+    if (permList.empty()) {
+        return true;
+    }
+    for (const auto& perm : permList) {
+        if (perm == permName) {
+            return true;
+        }
+    }
+    return false;
+}
+
+void ActiveStatusCallbackManager::ExecuteCallbackAsync(
+    AccessTokenID tokenId, const std::string& permName, const std::string& deviceId, ActiveChangeType changeType)
+{
+    ACCESSTOKEN_LOG_INFO(LABEL, "entry");
+
+    auto callbackFunc = [&]() {
+        ACCESSTOKEN_LOG_INFO(LABEL, "callbackStart");
+        std::lock_guard<std::mutex> lock(mutex_);
+        for (auto it = callbackDataList_.begin(); it != callbackDataList_.end(); ++it) {
+            std::vector<std::string> permList = (*it).permList_;
+            if (!NeedCalled(permList, permName)) {
+                ACCESSTOKEN_LOG_INFO(LABEL, "tokenId %{public}u, permName %{public}s", tokenId, permName.c_str());
+                continue;
+            }
+            auto callback = iface_cast<IPermActiveStatusCallback>((*it).callbackObject_);
+            if (callback != nullptr) {
+                ActiveChangeResponse resInfo;
+                resInfo.type = changeType;
+                resInfo.permissionName = permName;
+                resInfo.tokenID = tokenId;
+                resInfo.deviceId = deviceId;
+                ACCESSTOKEN_LOG_INFO(LABEL, "callback excute changeType %{public}d", changeType);
+                callback->ActiveStatusChangeCallback(resInfo);
+            }
+        }
+    };
+
+    std::packaged_task<void()> callbackTask(callbackFunc);
+    std::future<void> fut = callbackTask.get_future();
+    std::make_unique<std::thread>(std::move(callbackTask))->detach();
+
+    ACCESSTOKEN_LOG_INFO(LABEL, "Waiting for the callback execution complete...");
+    std::future_status status = fut.wait_for(std::chrono::seconds(MAX_TIMEOUT_SEC));
+    if (status == std::future_status::timeout) {
+        ACCESSTOKEN_LOG_WARN(LABEL, "callbackTask callback execution timeout");
+    }
+    ACCESSTOKEN_LOG_INFO(LABEL, "The callback execution is complete");
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/services/privacymanager/src/active/perm_active_status_callback_death_recipient.cpp b/services/privacymanager/src/active/perm_active_status_callback_death_recipient.cpp
index 1acb1bdecfb11e5f76cd9f69f57d89139143080b..e0349ef54d65b4bf4461adca7815c77d666424e3 100644
--- a/services/privacymanager/src/active/perm_active_status_callback_death_recipient.cpp
+++ b/services/privacymanager/src/active/perm_active_status_callback_death_recipient.cpp
@@ -1,47 +1,47 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "perm_active_status_callback_death_recipient.h"
-
-#include "access_token.h"
-#include "active_status_callback_manager.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-namespace {
-static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
-    LOG_CORE, SECURITY_DOMAIN_ACCESSTOKEN, "PermActiveStatusCallbackDeathRecipient"
-};
-}
-void PermActiveStatusCallbackDeathRecipient::OnRemoteDied(const wptr<IRemoteObject> &remote)
-{
-    ACCESSTOKEN_LOG_INFO(LABEL, "enter");
-    if (remote == nullptr) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "remote object is nullptr");
-        return;
-    }
-
-    sptr<IRemoteObject> object = remote.promote();
-    if (object == nullptr) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "object is nullptr");
-        return;
-    }
-    ActiveStatusCallbackManager::GetInstance().RemoveCallback(object);
-    ACCESSTOKEN_LOG_INFO(LABEL, "end");
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "perm_active_status_callback_death_recipient.h"
+
+#include "access_token.h"
+#include "active_status_callback_manager.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+namespace {
+static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
+    LOG_CORE, SECURITY_DOMAIN_ACCESSTOKEN, "PermActiveStatusCallbackDeathRecipient"
+};
+}
+void PermActiveStatusCallbackDeathRecipient::OnRemoteDied(const wptr<IRemoteObject> &remote)
+{
+    ACCESSTOKEN_LOG_INFO(LABEL, "enter");
+    if (remote == nullptr) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "remote object is nullptr");
+        return;
+    }
+
+    sptr<IRemoteObject> object = remote.promote();
+    if (object == nullptr) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "object is nullptr");
+        return;
+    }
+    ActiveStatusCallbackManager::GetInstance().RemoveCallback(object);
+    ACCESSTOKEN_LOG_INFO(LABEL, "end");
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/services/privacymanager/src/active/perm_active_status_change_callback_proxy.cpp b/services/privacymanager/src/active/perm_active_status_change_callback_proxy.cpp
index 5b41136ed949513551238a13d77eac81f9ecdd27..d1dc59a64b505385f2fe8c8274a843a1ebae81f3 100644
--- a/services/privacymanager/src/active/perm_active_status_change_callback_proxy.cpp
+++ b/services/privacymanager/src/active/perm_active_status_change_callback_proxy.cpp
@@ -1,67 +1,67 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "perm_active_status_change_callback_proxy.h"
-
-#include "accesstoken_log.h"
-#include "perm_active_response_parcel.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-namespace {
-static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
-    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "PermActiveStatusChangeCallbackProxy"
-};
-}
-
-PermActiveStatusChangeCallbackProxy::PermActiveStatusChangeCallbackProxy(const sptr<IRemoteObject>& impl)
-    : IRemoteProxy<IPermActiveStatusCallback>(impl) {
-}
-
-PermActiveStatusChangeCallbackProxy::~PermActiveStatusChangeCallbackProxy()
-{}
-
-void PermActiveStatusChangeCallbackProxy::ActiveStatusChangeCallback(ActiveChangeResponse& result)
-{
-    MessageParcel data;
-    data.WriteInterfaceToken(IPermActiveStatusCallback::GetDescriptor());
-
-    ActiveChangeResponseParcel resultParcel;
-    resultParcel.changeResponse = result;
-    if (!data.WriteParcelable(&resultParcel)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteParcelable");
-        return;
-    }
-
-    MessageParcel reply;
-    MessageOption option(MessageOption::TF_SYNC);
-    sptr<IRemoteObject> remote = Remote();
-    if (remote == nullptr) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "remote service null.");
-        return;
-    }
-    int32_t requestResult = remote->SendRequest(
-        static_cast<uint32_t>(IPermActiveStatusCallback::PERM_ACTIVE_STATUS_CHANGE), data, reply, option);
-    if (requestResult != NO_ERROR) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "send request fail, result: %{public}d", requestResult);
-        return;
-    }
-
-    ACCESSTOKEN_LOG_INFO(LABEL, "SendRequest success");
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "perm_active_status_change_callback_proxy.h"
+
+#include "accesstoken_log.h"
+#include "perm_active_response_parcel.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+namespace {
+static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
+    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "PermActiveStatusChangeCallbackProxy"
+};
+}
+
+PermActiveStatusChangeCallbackProxy::PermActiveStatusChangeCallbackProxy(const sptr<IRemoteObject>& impl)
+    : IRemoteProxy<IPermActiveStatusCallback>(impl) {
+}
+
+PermActiveStatusChangeCallbackProxy::~PermActiveStatusChangeCallbackProxy()
+{}
+
+void PermActiveStatusChangeCallbackProxy::ActiveStatusChangeCallback(ActiveChangeResponse& result)
+{
+    MessageParcel data;
+    data.WriteInterfaceToken(IPermActiveStatusCallback::GetDescriptor());
+
+    ActiveChangeResponseParcel resultParcel;
+    resultParcel.changeResponse = result;
+    if (!data.WriteParcelable(&resultParcel)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteParcelable");
+        return;
+    }
+
+    MessageParcel reply;
+    MessageOption option(MessageOption::TF_SYNC);
+    sptr<IRemoteObject> remote = Remote();
+    if (remote == nullptr) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "remote service null.");
+        return;
+    }
+    int32_t requestResult = remote->SendRequest(
+        static_cast<uint32_t>(IPermActiveStatusCallback::PERM_ACTIVE_STATUS_CHANGE), data, reply, option);
+    if (requestResult != NO_ERROR) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "send request fail, result: %{public}d", requestResult);
+        return;
+    }
+
+    ACCESSTOKEN_LOG_INFO(LABEL, "SendRequest success");
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/services/privacymanager/src/common/constant.cpp b/services/privacymanager/src/common/constant.cpp
index 34fda467f258b1d64a42f07a37f98c7203b51854..aef53ed82560de72b96be940c0c7f98297bd03e8 100644
--- a/services/privacymanager/src/common/constant.cpp
+++ b/services/privacymanager/src/common/constant.cpp
@@ -1,74 +1,75 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "constant.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-const std::map<std::string, int32_t> Constant::PERMISSION_OPCODE_MAP = {
-    std::map<std::string, int32_t>::value_type("ohos.permission.ANSWER_CALL", Constant::OP_ANSWER_CALL),
-    std::map<std::string, int32_t>::value_type("ohos.permission.READ_CALENDAR", Constant::OP_READ_CALENDAR),
-    std::map<std::string, int32_t>::value_type("ohos.permission.WRITE_CALENDAR", Constant::OP_WRITE_CALENDAR),
-    std::map<std::string, int32_t>::value_type("ohos.permission.SEND_MESSAGES", Constant::OP_SEND_MESSAGES),
-    std::map<std::string, int32_t>::value_type("ohos.permission.WRITE_CALL_LOG", Constant::OP_WRITE_CALL_LOG),
-    std::map<std::string, int32_t>::value_type("ohos.permission.READ_CALL_LOG", Constant::OP_READ_CALL_LOG),
-    std::map<std::string, int32_t>::value_type("ohos.permission.READ_CELL_MESSAGES", Constant::OP_READ_CELL_MESSAGES),
-    std::map<std::string, int32_t>::value_type("ohos.permission.MICROPHONE", Constant::OP_MICROPHONE),
-    std::map<std::string, int32_t>::value_type(
-        "ohos.permission.RECEIVE_WAP_MESSAGES", Constant::OP_RECEIVE_WAP_MESSAGES),
-    std::map<std::string, int32_t>::value_type("ohos.permission.RECEIVE_SMS", Constant::OP_RECEIVE_SMS),
-    std::map<std::string, int32_t>::value_type("ohos.permission.RECEIVE_MMS", Constant::OP_RECEIVE_MMS),
-    std::map<std::string, int32_t>::value_type("ohos.permission.READ_MESSAGES", Constant::OP_READ_MESSAGES),
-    std::map<std::string, int32_t>::value_type("ohos.permission.READ_CONTACTS", Constant::OP_READ_CONTACTS),
-    std::map<std::string, int32_t>::value_type("ohos.permission.WRITE_CONTACTS", Constant::OP_WRITE_CONTACTS),
-    std::map<std::string, int32_t>::value_type(
-        "ohos.permission.LOCATION_IN_BACKGROUND", Constant::OP_LOCATION_IN_BACKGROUND),
-    std::map<std::string, int32_t>::value_type("ohos.permission.LOCATION", Constant::OP_LOCATION),
-    std::map<std::string, int32_t>::value_type("ohos.permission.MEDIA_LOCATION", Constant::OP_MEDIA_LOCATION),
-    std::map<std::string, int32_t>::value_type("ohos.permission.CAMERA", Constant::OP_CAMERA),
-    std::map<std::string, int32_t>::value_type("ohos.permission.READ_MEDIA", Constant::OP_READ_MEDIA),
-    std::map<std::string, int32_t>::value_type("ohos.permission.WRITE_MEDIA", Constant::OP_WRITE_MEDIA),
-    std::map<std::string, int32_t>::value_type("ohos.permission.ACTIVITY_MOTION", Constant::OP_ACTIVITY_MOTION),
-    std::map<std::string, int32_t>::value_type("ohos.permission.READ_HEALTH_DATA", Constant::OP_READ_HEALTH_DATA),
-    std::map<std::string, int32_t>::value_type("ohos.permission.MANAGE_VOICEMAIL", Constant::OP_MANAGE_VOICEMAIL),
-    std::map<std::string, int32_t>::value_type(
-        "ohos.permission.DISTRIBUTED_DATASYNC", Constant::OP_DISTRIBUTED_DATASYNC),
-};
-
-bool Constant::TransferPermissionToOpcode(const std::string& permissionName, int32_t& opCode)
-{
-    if (PERMISSION_OPCODE_MAP.count(permissionName) == 0) {
-        return false;
-    }
-    opCode = PERMISSION_OPCODE_MAP.at(permissionName);
-    return true;
-}
-
-bool Constant::TransferOpcodeToPermission(int32_t opCode, std::string& permissionName)
-{
-    auto iter = std::find_if(PERMISSION_OPCODE_MAP.begin(), PERMISSION_OPCODE_MAP.end(),
-        [opCode](const std::map<std::string, int32_t>::value_type item) {
-            return item.second == opCode;
-        });
-    if (iter == PERMISSION_OPCODE_MAP.end()) {
-        return false;
-    }
-    permissionName = iter->first;
-    return true;
-}
-} // namespace AccessToken
-} // namespace Security
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "constant.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+const std::string Constant::COUNT_CMD = "COUNT";
+const std::map<std::string, int32_t> Constant::PERMISSION_OPCODE_MAP = {
+    std::map<std::string, int32_t>::value_type("ohos.permission.ANSWER_CALL", Constant::OP_ANSWER_CALL),
+    std::map<std::string, int32_t>::value_type("ohos.permission.READ_CALENDAR", Constant::OP_READ_CALENDAR),
+    std::map<std::string, int32_t>::value_type("ohos.permission.WRITE_CALENDAR", Constant::OP_WRITE_CALENDAR),
+    std::map<std::string, int32_t>::value_type("ohos.permission.SEND_MESSAGES", Constant::OP_SEND_MESSAGES),
+    std::map<std::string, int32_t>::value_type("ohos.permission.WRITE_CALL_LOG", Constant::OP_WRITE_CALL_LOG),
+    std::map<std::string, int32_t>::value_type("ohos.permission.READ_CALL_LOG", Constant::OP_READ_CALL_LOG),
+    std::map<std::string, int32_t>::value_type("ohos.permission.READ_CELL_MESSAGES", Constant::OP_READ_CELL_MESSAGES),
+    std::map<std::string, int32_t>::value_type("ohos.permission.MICROPHONE", Constant::OP_MICROPHONE),
+    std::map<std::string, int32_t>::value_type(
+        "ohos.permission.RECEIVE_WAP_MESSAGES", Constant::OP_RECEIVE_WAP_MESSAGES),
+    std::map<std::string, int32_t>::value_type("ohos.permission.RECEIVE_SMS", Constant::OP_RECEIVE_SMS),
+    std::map<std::string, int32_t>::value_type("ohos.permission.RECEIVE_MMS", Constant::OP_RECEIVE_MMS),
+    std::map<std::string, int32_t>::value_type("ohos.permission.READ_MESSAGES", Constant::OP_READ_MESSAGES),
+    std::map<std::string, int32_t>::value_type("ohos.permission.READ_CONTACTS", Constant::OP_READ_CONTACTS),
+    std::map<std::string, int32_t>::value_type("ohos.permission.WRITE_CONTACTS", Constant::OP_WRITE_CONTACTS),
+    std::map<std::string, int32_t>::value_type(
+        "ohos.permission.LOCATION_IN_BACKGROUND", Constant::OP_LOCATION_IN_BACKGROUND),
+    std::map<std::string, int32_t>::value_type("ohos.permission.LOCATION", Constant::OP_LOCATION),
+    std::map<std::string, int32_t>::value_type("ohos.permission.MEDIA_LOCATION", Constant::OP_MEDIA_LOCATION),
+    std::map<std::string, int32_t>::value_type("ohos.permission.CAMERA", Constant::OP_CAMERA),
+    std::map<std::string, int32_t>::value_type("ohos.permission.READ_MEDIA", Constant::OP_READ_MEDIA),
+    std::map<std::string, int32_t>::value_type("ohos.permission.WRITE_MEDIA", Constant::OP_WRITE_MEDIA),
+    std::map<std::string, int32_t>::value_type("ohos.permission.ACTIVITY_MOTION", Constant::OP_ACTIVITY_MOTION),
+    std::map<std::string, int32_t>::value_type("ohos.permission.READ_HEALTH_DATA", Constant::OP_READ_HEALTH_DATA),
+    std::map<std::string, int32_t>::value_type("ohos.permission.MANAGE_VOICEMAIL", Constant::OP_MANAGE_VOICEMAIL),
+    std::map<std::string, int32_t>::value_type(
+        "ohos.permission.DISTRIBUTED_DATASYNC", Constant::OP_DISTRIBUTED_DATASYNC),
+};
+
+bool Constant::TransferPermissionToOpcode(const std::string& permissionName, int32_t& opCode)
+{
+    if (PERMISSION_OPCODE_MAP.count(permissionName) == 0) {
+        return false;
+    }
+    opCode = PERMISSION_OPCODE_MAP.at(permissionName);
+    return true;
+}
+
+bool Constant::TransferOpcodeToPermission(int32_t opCode, std::string& permissionName)
+{
+    auto iter = std::find_if(PERMISSION_OPCODE_MAP.begin(), PERMISSION_OPCODE_MAP.end(),
+        [opCode](const std::map<std::string, int32_t>::value_type item) {
+            return item.second == opCode;
+        });
+    if (iter == PERMISSION_OPCODE_MAP.end()) {
+        return false;
+    }
+    permissionName = iter->first;
+    return true;
+}
+} // namespace AccessToken
+} // namespace Security
 } // namespace OHOS
\ No newline at end of file
diff --git a/services/privacymanager/src/common/time_util.cpp b/services/privacymanager/src/common/time_util.cpp
index eff098ca94f6de4a0c15b42164334a3f18944c75..c445c54c3b4289b1c89f3a53df83b99857e1e438 100644
--- a/services/privacymanager/src/common/time_util.cpp
+++ b/services/privacymanager/src/common/time_util.cpp
@@ -1,29 +1,29 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "time_util.h"
-#include <ctime>
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-int64_t TimeUtil::GetCurrentTimestamp()
-{
-    const time_t timestamp = time(NULL);
-    return static_cast<int64_t>(timestamp);
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "time_util.h"
+#include <ctime>
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+int64_t TimeUtil::GetCurrentTimestamp()
+{
+    const time_t timestamp = time(NULL);
+    return static_cast<int64_t>(timestamp);
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/services/privacymanager/src/common/to_string.cpp b/services/privacymanager/src/common/to_string.cpp
index 91b893e974c8245d3607f922c35b20177fb935f4..a1840112f719a7e550656ea4469c4a7772a1aede 100644
--- a/services/privacymanager/src/common/to_string.cpp
+++ b/services/privacymanager/src/common/to_string.cpp
@@ -1,98 +1,98 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "to_string.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-void ToString::DetailUsedRecordToString(
-    bool isAccessDetail, const std::vector<UsedRecordDetail>& detailRecord, std::string& infos)
-{
-    if (isAccessDetail) {
-        infos.append(R"(          "accessRecords": [)");
-    } else {
-        infos.append(R"(          "rejectRecords": [)");
-    }
-    infos.append("\n");
-    for (const auto& detail : detailRecord) {
-        infos.append("              {");
-        infos.append("\n");
-        infos.append(R"(                  "status": ")" + std::to_string(detail.status) + R"(")" + ",\n");
-        infos.append(R"(                  "timestamp": ")" + std::to_string(detail.timestamp) + R"(")" + ",\n");
-        infos.append(R"(                  "duration": )" + std::to_string(detail.accessDuration) + ",\n");
-        infos.append("              },");
-        infos.append("\n");
-    }
-    
-    infos.append("          ]");
-    infos.append("\n");
-}
-
-void ToString::PermissionUsedRecordToString(
-    const std::vector<PermissionUsedRecord>& permissionRecords, std::string& infos)
-{
-    infos.append(R"(  "permissionRecords": [)");
-    infos.append("\n");
-
-    for (const auto& perm : permissionRecords) {
-        infos.append("      {");
-        infos.append("\n");
-        infos.append(R"(          "permissionName": ")" + perm.permissionName + R"(")" + ",\n");
-        infos.append(R"(          "accessCount": ")" + std::to_string(perm.accessCount) + R"(")" + ",\n");
-        infos.append(R"(          "rejectCount": )" + std::to_string(perm.rejectCount) + ",\n");
-        infos.append(R"(          "lastAccessTime": )" + std::to_string(perm.lastAccessTime) + ",\n");
-        infos.append(R"(          "lastRejectTime": )" + std::to_string(perm.lastRejectTime) + ",\n");
-        infos.append(R"(          "lastAccessDuration": )" + std::to_string(perm.lastAccessDuration) + ",\n");
-        ToString::DetailUsedRecordToString(true, perm.accessRecords, infos);
-        ToString::DetailUsedRecordToString(false, perm.rejectRecords, infos);
-        infos.append("      },");
-        infos.append("\n");
-    }
-
-    infos.append("  ]");
-    infos.append("\n");
-}
-
-void ToString::BundleUsedRecordToString(const BundleUsedRecord& bundleRecord, std::string& infos)
-{
-    infos.append("{");
-    infos.append("\n");
-    infos.append(R"(  "tokenId": )" + std::to_string(bundleRecord.tokenId) + ",\n");
-    infos.append(R"(  "isRemote": )" + std::to_string(bundleRecord.isRemote) + ",\n");
-    infos.append(R"(  "bundleName": )" + bundleRecord.bundleName + ",\n");
-    infos.append(R"(  "deviceId": )" + bundleRecord.deviceId + ",\n");
-
-    ToString::PermissionUsedRecordToString(bundleRecord.permissionRecords, infos);
-
-    infos.append("}");
-    infos.append("\n");
-}
-
-void ToString::PermissionUsedResultToString(const PermissionUsedResult& result, std::string& infos)
-{
-    if (result.bundleRecords.empty()) {
-        return;
-    }
-    infos.append(R"("beginTime": )" + std::to_string(result.beginTimeMillis) + ",\n");
-    infos.append(R"("endTime": )" + std::to_string(result.endTimeMillis) + ",\n");
-
-    for (const auto& res : result.bundleRecords) {
-        ToString::BundleUsedRecordToString(res, infos);
-    }
-}
-} // namespace AccessToken
-} // namespace Security
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "to_string.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+void ToString::DetailUsedRecordToString(
+    bool isAccessDetail, const std::vector<UsedRecordDetail>& detailRecord, std::string& infos)
+{
+    if (isAccessDetail) {
+        infos.append(R"(          "accessRecords": [)");
+    } else {
+        infos.append(R"(          "rejectRecords": [)");
+    }
+    infos.append("\n");
+    for (const auto& detail : detailRecord) {
+        infos.append("              {");
+        infos.append("\n");
+        infos.append(R"(                  "status": ")" + std::to_string(detail.status) + R"(")" + ",\n");
+        infos.append(R"(                  "timestamp": ")" + std::to_string(detail.timestamp) + R"(")" + ",\n");
+        infos.append(R"(                  "duration": )" + std::to_string(detail.accessDuration) + ",\n");
+        infos.append("              },");
+        infos.append("\n");
+    }
+    
+    infos.append("          ]");
+    infos.append("\n");
+}
+
+void ToString::PermissionUsedRecordToString(
+    const std::vector<PermissionUsedRecord>& permissionRecords, std::string& infos)
+{
+    infos.append(R"(  "permissionRecords": [)");
+    infos.append("\n");
+
+    for (const auto& perm : permissionRecords) {
+        infos.append("      {");
+        infos.append("\n");
+        infos.append(R"(          "permissionName": ")" + perm.permissionName + R"(")" + ",\n");
+        infos.append(R"(          "accessCount": ")" + std::to_string(perm.accessCount) + R"(")" + ",\n");
+        infos.append(R"(          "rejectCount": )" + std::to_string(perm.rejectCount) + ",\n");
+        infos.append(R"(          "lastAccessTime": )" + std::to_string(perm.lastAccessTime) + ",\n");
+        infos.append(R"(          "lastRejectTime": )" + std::to_string(perm.lastRejectTime) + ",\n");
+        infos.append(R"(          "lastAccessDuration": )" + std::to_string(perm.lastAccessDuration) + ",\n");
+        ToString::DetailUsedRecordToString(true, perm.accessRecords, infos);
+        ToString::DetailUsedRecordToString(false, perm.rejectRecords, infos);
+        infos.append("      },");
+        infos.append("\n");
+    }
+
+    infos.append("  ]");
+    infos.append("\n");
+}
+
+void ToString::BundleUsedRecordToString(const BundleUsedRecord& bundleRecord, std::string& infos)
+{
+    infos.append("{");
+    infos.append("\n");
+    infos.append(R"(  "tokenId": )" + std::to_string(bundleRecord.tokenId) + ",\n");
+    infos.append(R"(  "isRemote": )" + std::to_string(bundleRecord.isRemote) + ",\n");
+    infos.append(R"(  "bundleName": )" + bundleRecord.bundleName + ",\n");
+    infos.append(R"(  "deviceId": )" + bundleRecord.deviceId + ",\n");
+
+    ToString::PermissionUsedRecordToString(bundleRecord.permissionRecords, infos);
+
+    infos.append("}");
+    infos.append("\n");
+}
+
+void ToString::PermissionUsedResultToString(const PermissionUsedResult& result, std::string& infos)
+{
+    if (result.bundleRecords.empty()) {
+        return;
+    }
+    infos.append(R"("beginTime": )" + std::to_string(result.beginTimeMillis) + ",\n");
+    infos.append(R"("endTime": )" + std::to_string(result.endTimeMillis) + ",\n");
+
+    for (const auto& res : result.bundleRecords) {
+        ToString::BundleUsedRecordToString(res, infos);
+    }
+}
+} // namespace AccessToken
+} // namespace Security
 } // namespace OHOS
\ No newline at end of file
diff --git a/services/privacymanager/src/database/data_translator.cpp b/services/privacymanager/src/database/data_translator.cpp
index 27753200fbf65e5bedc50cfe939a1f340f8d5d21..90488ca86021863e86b02f49c7bf61c823ed6efd 100644
--- a/services/privacymanager/src/database/data_translator.cpp
+++ b/services/privacymanager/src/database/data_translator.cpp
@@ -1,104 +1,104 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "data_translator.h"
-
-#include "constant.h"
-#include "field_const.h"
-#include "time_util.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-int32_t DataTranslator::TranslationIntoGenericValues(const PermissionUsedRequest& request,
-    GenericValues& andGenericValues, GenericValues& orGenericValues)
-{
-    int64_t begin = request.beginTimeMillis;
-    int64_t end = request.endTimeMillis;
-    if ((begin < 0) || (end < 0) || (begin > end)) {
-        return Constant::FAILURE;
-    }
-
-    if (request.flag != FLAG_PERMISSION_USAGE_SUMMARY && request.flag != FLAG_PERMISSION_USAGE_DETAIL) {
-        return Constant::FAILURE;
-    }
-
-    if (begin == 0 && end == 0) {
-        int64_t beginTime = TimeUtil::GetCurrentTimestamp() - Constant::LATEST_RECORD_TIME;
-        begin = (beginTime < 0) ? 0 : beginTime;
-        end = TimeUtil::GetCurrentTimestamp();
-    }
-
-    if (begin != 0) {
-        andGenericValues.Put(FIELD_TIMESTAMP_BEGIN, begin);
-    }
-    if (end != 0) {
-        andGenericValues.Put(FIELD_TIMESTAMP_END, end);
-    }
-
-    for (const auto& perm : request.permissionList) {
-        int32_t opCode;
-        if (Constant::TransferPermissionToOpcode(perm, opCode)) {
-            orGenericValues.Put(FIELD_OP_CODE, opCode);
-        } else {
-            orGenericValues.Put(FIELD_OP_CODE, Constant::OP_INVALID);
-        }
-    }
-    return Constant::SUCCESS;
-}
-
-int32_t DataTranslator::TranslationGenericValuesIntoPermissionUsedRecord(const GenericValues& inGenericValues,
-    PermissionUsedRecord& permissionRecord)
-{
-    std::string permission;
-    int32_t opCode = inGenericValues.GetInt(FIELD_OP_CODE);
-    if (!Constant::TransferOpcodeToPermission(opCode, permission)) {
-        return Constant::FAILURE;
-    }
-
-    int64_t timestamp = inGenericValues.GetInt64(FIELD_TIMESTAMP);
-    permissionRecord.permissionName = permission;
-
-    if (inGenericValues.GetInt(FIELD_ACCESS_COUNT) != 0) {
-        permissionRecord.accessCount = inGenericValues.GetInt(FIELD_ACCESS_COUNT);
-        permissionRecord.lastAccessTime = timestamp;
-        permissionRecord.lastAccessDuration = inGenericValues.GetInt64(FIELD_ACCESS_DURATION);
-    }
-
-    if (inGenericValues.GetInt(FIELD_REJECT_COUNT) != 0) {
-        permissionRecord.rejectCount = inGenericValues.GetInt(FIELD_REJECT_COUNT);
-        permissionRecord.lastRejectTime = timestamp;
-    }
-
-    if (inGenericValues.GetInt(FIELD_FLAG) == 0) {
-        return Constant::SUCCESS;
-    }
-
-    UsedRecordDetail detail;
-    detail.status = inGenericValues.GetInt(FIELD_STATUS);
-    if (permissionRecord.lastAccessTime > 0) {
-        detail.timestamp = permissionRecord.lastAccessTime;
-        detail.accessDuration = inGenericValues.GetInt64(FIELD_ACCESS_DURATION);
-        permissionRecord.accessRecords.emplace_back(detail);
-    }
-    if (permissionRecord.lastRejectTime > 0) {
-        detail.timestamp = permissionRecord.lastRejectTime;
-        permissionRecord.rejectRecords.emplace_back(detail);
-    }
-    return Constant::SUCCESS;
-}
-} // namespace AccessToken
-} // namespace Security
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "data_translator.h"
+
+#include "constant.h"
+#include "field_const.h"
+#include "time_util.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+int32_t DataTranslator::TranslationIntoGenericValues(const PermissionUsedRequest& request,
+    GenericValues& andGenericValues, GenericValues& orGenericValues)
+{
+    int64_t begin = request.beginTimeMillis;
+    int64_t end = request.endTimeMillis;
+    if ((begin < 0) || (end < 0) || (begin > end)) {
+        return Constant::FAILURE;
+    }
+
+    if (request.flag != FLAG_PERMISSION_USAGE_SUMMARY && request.flag != FLAG_PERMISSION_USAGE_DETAIL) {
+        return Constant::FAILURE;
+    }
+
+    if (begin == 0 && end == 0) {
+        int64_t beginTime = TimeUtil::GetCurrentTimestamp() - Constant::LATEST_RECORD_TIME;
+        begin = (beginTime < 0) ? 0 : beginTime;
+        end = TimeUtil::GetCurrentTimestamp();
+    }
+
+    if (begin != 0) {
+        andGenericValues.Put(FIELD_TIMESTAMP_BEGIN, begin);
+    }
+    if (end != 0) {
+        andGenericValues.Put(FIELD_TIMESTAMP_END, end);
+    }
+
+    for (const auto& perm : request.permissionList) {
+        int32_t opCode;
+        if (Constant::TransferPermissionToOpcode(perm, opCode)) {
+            orGenericValues.Put(FIELD_OP_CODE, opCode);
+        } else {
+            orGenericValues.Put(FIELD_OP_CODE, Constant::OP_INVALID);
+        }
+    }
+    return Constant::SUCCESS;
+}
+
+int32_t DataTranslator::TranslationGenericValuesIntoPermissionUsedRecord(const GenericValues& inGenericValues,
+    PermissionUsedRecord& permissionRecord)
+{
+    std::string permission;
+    int32_t opCode = inGenericValues.GetInt(FIELD_OP_CODE);
+    if (!Constant::TransferOpcodeToPermission(opCode, permission)) {
+        return Constant::FAILURE;
+    }
+
+    int64_t timestamp = inGenericValues.GetInt64(FIELD_TIMESTAMP);
+    permissionRecord.permissionName = permission;
+
+    if (inGenericValues.GetInt(FIELD_ACCESS_COUNT) != 0) {
+        permissionRecord.accessCount = inGenericValues.GetInt(FIELD_ACCESS_COUNT);
+        permissionRecord.lastAccessTime = timestamp;
+        permissionRecord.lastAccessDuration = inGenericValues.GetInt64(FIELD_ACCESS_DURATION);
+    }
+
+    if (inGenericValues.GetInt(FIELD_REJECT_COUNT) != 0) {
+        permissionRecord.rejectCount = inGenericValues.GetInt(FIELD_REJECT_COUNT);
+        permissionRecord.lastRejectTime = timestamp;
+    }
+
+    if (inGenericValues.GetInt(FIELD_FLAG) == 0) {
+        return Constant::SUCCESS;
+    }
+
+    UsedRecordDetail detail;
+    detail.status = inGenericValues.GetInt(FIELD_STATUS);
+    if (permissionRecord.lastAccessTime > 0) {
+        detail.timestamp = permissionRecord.lastAccessTime;
+        detail.accessDuration = inGenericValues.GetInt64(FIELD_ACCESS_DURATION);
+        permissionRecord.accessRecords.emplace_back(detail);
+    }
+    if (permissionRecord.lastRejectTime > 0) {
+        detail.timestamp = permissionRecord.lastRejectTime;
+        permissionRecord.rejectRecords.emplace_back(detail);
+    }
+    return Constant::SUCCESS;
+}
+} // namespace AccessToken
+} // namespace Security
 } // namespace OHOS
\ No newline at end of file
diff --git a/services/privacymanager/src/database/permission_used_record_db.cpp b/services/privacymanager/src/database/permission_used_record_db.cpp
index 1e216b7a5f085f75af83268494ee0ede684bee33..04cda3e7fa7db3c92bdf9d868046901eba729ed7 100644
--- a/services/privacymanager/src/database/permission_used_record_db.cpp
+++ b/services/privacymanager/src/database/permission_used_record_db.cpp
@@ -1,413 +1,414 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "permission_used_record_db.h"
-
-#include "accesstoken_log.h"
-#include "constant.h"
-#include "field_const.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-namespace {
-static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
-    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "PermissionUsedRecordDb"
-};
-static const std::string FIELD_COUNT_NUMBER = "count";
-}
-
-PermissionUsedRecordDb& PermissionUsedRecordDb::GetInstance()
-{
-    static PermissionUsedRecordDb instance;
-    return instance;
-}
-
-PermissionUsedRecordDb::~PermissionUsedRecordDb()
-{
-    Close();
-}
-
-void PermissionUsedRecordDb::OnCreate()
-{
-    ACCESSTOKEN_LOG_INFO(LABEL, "Entry");
-    CreatePermissionRecordTable();
-}
-
-void PermissionUsedRecordDb::OnUpdate()
-{
-    ACCESSTOKEN_LOG_INFO(LABEL, "Entry");
-}
-
-PermissionUsedRecordDb::PermissionUsedRecordDb() : SqliteHelper(DATABASE_NAME, DATABASE_PATH, DATABASE_VERSION)
-{
-    SqliteTable permissionRecordTable;
-    permissionRecordTable.tableName_ = PERMISSION_RECORD_TABLE;
-    permissionRecordTable.tableColumnNames_ = {
-        FIELD_TOKEN_ID,
-        FIELD_OP_CODE,
-        FIELD_STATUS,
-        FIELD_TIMESTAMP,
-        FIELD_ACCESS_DURATION,
-        FIELD_ACCESS_COUNT,
-        FIELD_REJECT_COUNT
-    };
-
-    dataTypeToSqlTable_ = {
-        {PERMISSION_RECORD, permissionRecordTable},
-    };
-    Open();
-}
-
-int32_t PermissionUsedRecordDb::Add(DataType type, const std::vector<GenericValues>& values)
-{
-    OHOS::Utils::UniqueWriteGuard<OHOS::Utils::RWLock> lock(this->rwLock_);
-    std::string prepareSql = CreateInsertPrepareSqlCmd(type);
-    auto statement = Prepare(prepareSql);
-    BeginTransaction();
-    bool isExecuteSuccessfully = true;
-    for (const auto& value : values) {
-        std::vector<std::string> columnNames = value.GetAllKeys();
-        for (const auto& columnName : columnNames) {
-            statement.Bind(columnName, value.Get(columnName));
-        }
-        int32_t ret = statement.Step();
-        if (ret != Statement::State::DONE) {
-            ACCESSTOKEN_LOG_ERROR(LABEL, "failed, errorMsg: %{public}s", SpitError().c_str());
-            isExecuteSuccessfully = false;
-        }
-        statement.Reset();
-    }
-    if (!isExecuteSuccessfully) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "rollback transaction.");
-        RollbackTransaction();
-        return FAILURE;
-    }
-    ACCESSTOKEN_LOG_DEBUG(LABEL, "commit transaction.");
-    CommitTransaction();
-    return SUCCESS;
-}
-
-int32_t PermissionUsedRecordDb::Remove(DataType type, const GenericValues& conditions)
-{
-    OHOS::Utils::UniqueWriteGuard<OHOS::Utils::RWLock> lock(this->rwLock_);
-    std::vector<std::string> columnNames = conditions.GetAllKeys();
-    std::string prepareSql = CreateDeletePrepareSqlCmd(type, columnNames);
-    auto statement = Prepare(prepareSql);
-    for (const auto& columnName : columnNames) {
-        statement.Bind(columnName, conditions.Get(columnName));
-    }
-    int32_t ret = statement.Step();
-    return (ret == Statement::State::DONE) ? SUCCESS : FAILURE;
-}
-
-int32_t PermissionUsedRecordDb::Modify(
-    DataType type, const GenericValues& modifyValues, const GenericValues& conditions)
-{
-    OHOS::Utils::UniqueWriteGuard<OHOS::Utils::RWLock> lock(this->rwLock_);
-    std::vector<std::string> modifyColumns = modifyValues.GetAllKeys();
-    std::vector<std::string> conditionColumns = conditions.GetAllKeys();
-    std::string prepareSql = CreateUpdatePrepareSqlCmd(type, modifyColumns, conditionColumns);
-    auto statement = Prepare(prepareSql);
-    for (const auto& columnName : modifyColumns) {
-        statement.Bind(columnName, modifyValues.Get(columnName));
-    }
-    for (const auto& columnName : conditionColumns) {
-        statement.Bind(columnName, conditions.Get(columnName));
-    }
-    int32_t ret = statement.Step();
-    return (ret == Statement::State::DONE) ? SUCCESS : FAILURE;
-}
-
-int32_t PermissionUsedRecordDb::FindByConditions(DataType type, const GenericValues& andConditions,
-    const GenericValues& orConditions, std::vector<GenericValues>& results)
-{
-    OHOS::Utils::UniqueWriteGuard<OHOS::Utils::RWLock> lock(this->rwLock_);
-    std::vector<std::string> andColumns = andConditions.GetAllKeys();
-    std::vector<std::string> orColumns = orConditions.GetAllKeys();
-    std::string prepareSql = CreateSelectByConditionPrepareSqlCmd(type, andColumns, orColumns);
-    auto statement = Prepare(prepareSql);
-
-    for (const auto& columnName : andColumns) {
-        statement.Bind(columnName, andConditions.Get(columnName));
-    }
-    for (const auto& columnName : orColumns) {
-        statement.Bind(columnName, orConditions.Get(columnName));
-    }
-
-    while (statement.Step() == Statement::State::ROW) {
-        int32_t columnCount = statement.GetColumnCount();
-        GenericValues value;
-        for (int32_t i = 0; i < columnCount; i++) {
-            if (statement.GetColumnName(i) == FIELD_TIMESTAMP || statement.GetColumnName(i) == FIELD_ACCESS_DURATION) {
-                value.Put(statement.GetColumnName(i), statement.GetValue(i, true));
-            } else {
-                value.Put(statement.GetColumnName(i), statement.GetValue(i, false));
-            }
-        }
-        results.emplace_back(value);
-    }
-    return SUCCESS;
-}
-
-int32_t PermissionUsedRecordDb::GetDistinctValue(DataType type,
-    const std::string& condition, std::vector<GenericValues>& results)
-{
-    OHOS::Utils::UniqueWriteGuard<OHOS::Utils::RWLock> lock(this->rwLock_);
-    std::string getDistinctValueSql = CreateGetDistinctValue(type, condition);
-    auto statement = Prepare(getDistinctValueSql);
-    while (statement.Step() == Statement::State::ROW) {
-        int32_t columnCount = statement.GetColumnCount();
-        GenericValues value;
-        for (int32_t i = 0; i < columnCount; i++) {
-            if (statement.GetColumnName(i) == FIELD_TOKEN_ID) {
-                value.Put(statement.GetColumnName(i), statement.GetValue(i, false));
-            } else if (statement.GetColumnName(i) == FIELD_DEVICE_ID) {
-                value.Put(statement.GetColumnName(i), statement.GetColumnString(i));
-            }
-        }
-        results.emplace_back(value);
-    }
-    return SUCCESS;
-}
-
-void PermissionUsedRecordDb::Count(DataType type, GenericValues& result)
-{
-    OHOS::Utils::UniqueWriteGuard<OHOS::Utils::RWLock> lock(this->rwLock_);
-    std::string countSql = CreateCountPrepareSqlCmd(type);
-    auto countStatement = Prepare(countSql);
-    if (countStatement.Step() == Statement::State::ROW) {
-        int32_t column = 0;
-        result.Put(FIELD_COUNT_NUMBER, countStatement.GetValue(column, true));
-    }
-}
-
-int32_t PermissionUsedRecordDb::DeleteExpireRecords(DataType type,
-    const GenericValues& andConditions)
-{
-    OHOS::Utils::UniqueWriteGuard<OHOS::Utils::RWLock> lock(this->rwLock_);
-    std::vector<std::string> andColumns = andConditions.GetAllKeys();
-    if (!andColumns.empty()) {
-        std::string deleteExpireSql = CreateDeleteExpireRecordsPrepareSqlCmd(type, andColumns);
-        auto deleteExpireStatement = Prepare(deleteExpireSql);
-        for (const auto& columnName : andColumns) {
-            deleteExpireStatement.Bind(columnName, andConditions.Get(columnName));
-        }
-        if (deleteExpireStatement.Step() != Statement::State::DONE) {
-            return FAILURE;
-        }
-    }
-    return SUCCESS;
-}
-
-int32_t PermissionUsedRecordDb::DeleteExcessiveRecords(DataType type, uint32_t excessiveSize)
-{
-    OHOS::Utils::UniqueWriteGuard<OHOS::Utils::RWLock> lock(this->rwLock_);
-    std::string deleteExcessiveSql = CreateDeleteExcessiveRecordsPrepareSqlCmd(type, excessiveSize);
-    auto deleteExcessiveStatement = Prepare(deleteExcessiveSql);
-    if (deleteExcessiveStatement.Step() != Statement::State::DONE) {
-        return FAILURE;
-    }
-    return SUCCESS;
-}
-
-std::string PermissionUsedRecordDb::CreateInsertPrepareSqlCmd(DataType type) const
-{
-    auto it = dataTypeToSqlTable_.find(type);
-    if (it == dataTypeToSqlTable_.end()) {
-        return std::string();
-    }
-    std::string sql = "insert into " + it->second.tableName_ + " values(";
-    int32_t i = 1;
-    for (const auto& columnName : it->second.tableColumnNames_) {
-        sql.append(":" + columnName);
-        if (i < (int32_t) it->second.tableColumnNames_.size()) {
-            sql.append(",");
-        }
-        i += 1;
-    }
-    sql.append(")");
-    return sql;
-}
-
-std::string PermissionUsedRecordDb::CreateDeletePrepareSqlCmd(
-    DataType type, const std::vector<std::string>& columnNames) const
-{
-    auto it = dataTypeToSqlTable_.find(type);
-    if (it == dataTypeToSqlTable_.end()) {
-        return std::string();
-    }
-    std::string sql = "delete from " + it->second.tableName_ + " where 1 = 1";
-    for (const auto& columnName : columnNames) {
-        sql.append(" and ");
-        sql.append(columnName + "=:" + columnName);
-    }
-    return sql;
-}
-
-std::string PermissionUsedRecordDb::CreateUpdatePrepareSqlCmd(DataType type,
-    const std::vector<std::string>& modifyColumns, const std::vector<std::string>& conditionColumns) const
-{
-    if (modifyColumns.empty()) {
-        return std::string();
-    }
-
-    auto it = dataTypeToSqlTable_.find(type);
-    if (it == dataTypeToSqlTable_.end()) {
-        return std::string();
-    }
-
-    std::string sql = "update " + it->second.tableName_ + " set ";
-    int32_t i = 1;
-    for (const auto& columnName : modifyColumns) {
-        sql.append(columnName + "=:" + columnName);
-        if (i < (int32_t) modifyColumns.size()) {
-            sql.append(",");
-        }
-        i += 1;
-    }
-
-    if (!conditionColumns.empty()) {
-        sql.append(" where 1 = 1");
-        for (const auto& columnName : conditionColumns) {
-            sql.append(" and ");
-            sql.append(columnName + "=:" + columnName);
-        }
-    }
-    return sql;
-}
-
-std::string PermissionUsedRecordDb::CreateSelectByConditionPrepareSqlCmd(DataType type,
-    const std::vector<std::string>& andColumns, const std::vector<std::string>& orColumns) const
-{
-    auto it = dataTypeToSqlTable_.find(type);
-    if (it == dataTypeToSqlTable_.end()) {
-        return std::string();
-    }
-
-    std::string sql = "select * from " + it->second.tableName_ + " where 1 = 1";
-    for (const auto& andColName : andColumns) {
-        if (andColName == FIELD_TIMESTAMP_BEGIN) {
-            sql.append(" and ");
-            sql.append(FIELD_TIMESTAMP + " >=:" + andColName);
-        } else if (andColName == FIELD_TIMESTAMP_END) {
-            sql.append(" and ");
-            sql.append(FIELD_TIMESTAMP + " <=:" + andColName);
-        } else {
-            sql.append(" and ");
-            sql.append(andColName + "=:" + andColName);
-        }
-    }
-    if (!orColumns.empty()) {
-        sql.append(" and (");
-        for (const auto& orColName : orColumns) {
-            if (orColName.find(FIELD_OP_CODE) != std::string::npos) {
-                sql.append(FIELD_OP_CODE  + " =:" + orColName);
-                sql.append(" or ");
-            }
-        }
-        sql.append("0)");
-    }
-    return sql;
-}
-
-std::string PermissionUsedRecordDb::CreateCountPrepareSqlCmd(DataType type) const
-{
-    auto it = dataTypeToSqlTable_.find(type);
-    if (it == dataTypeToSqlTable_.end()) {
-        return std::string();
-    }
-    std::string sql = "select count(*) from " + it->second.tableName_;
-    return sql;
-}
-
-std::string PermissionUsedRecordDb::CreateDeleteExpireRecordsPrepareSqlCmd(DataType type,
-    const std::vector<std::string>& andColumns) const
-{
-    auto it = dataTypeToSqlTable_.find(type);
-    if (it == dataTypeToSqlTable_.end()) {
-        return std::string();
-    }
-    std::string sql = "delete from " + it->second.tableName_ + " where ";
-    sql.append(FIELD_TIMESTAMP + " in (select ");
-    sql.append(FIELD_TIMESTAMP + " from " + it->second.tableName_ + " where 1 = 1");
-    for (const auto& andColName : andColumns) {
-        if (andColName == FIELD_TIMESTAMP_BEGIN) {
-            sql.append(" and ");
-            sql.append(FIELD_TIMESTAMP + " >=:" + andColName);
-        } else if (andColName == FIELD_TIMESTAMP_END) {
-            sql.append(" and ");
-            sql.append(FIELD_TIMESTAMP + " <=:" + andColName);
-        } else {
-            sql.append(" and ");
-            sql.append(andColName + "=:" + andColName);
-        }
-    }
-    sql.append(" )");
-    return sql;
-}
-
-std::string PermissionUsedRecordDb::CreateDeleteExcessiveRecordsPrepareSqlCmd(DataType type,
-    uint32_t excessiveSize) const
-{
-    auto it = dataTypeToSqlTable_.find(type);
-    if (it == dataTypeToSqlTable_.end()) {
-        return std::string();
-    }
-    std::string sql = "delete from " + it->second.tableName_ + " where ";
-    sql.append(FIELD_TIMESTAMP + " in (select ");
-    sql.append(FIELD_TIMESTAMP + " from " + it->second.tableName_ + " order by ");
-    sql.append(FIELD_TIMESTAMP + " limit ");
-    sql.append(std::to_string(excessiveSize) + " )");
-    return sql;
-}
-
-std::string PermissionUsedRecordDb::CreateGetDistinctValue(DataType type,
-    const std::string conditionColumns) const
-{
-    auto it = dataTypeToSqlTable_.find(type);
-    if (it == dataTypeToSqlTable_.end()) {
-        return std::string();
-    }
-    std::string sql = "select distinct ";
-    sql.append(conditionColumns + " from "+ it->second.tableName_);
-    return sql;
-}
-
-int32_t PermissionUsedRecordDb::CreatePermissionRecordTable() const
-{
-    auto it = dataTypeToSqlTable_.find(DataType::PERMISSION_RECORD);
-    if (it == dataTypeToSqlTable_.end()) {
-        return FAILURE;
-    }
-    std::string sql = "create table if not exists ";
-    sql.append(it->second.tableName_ + " (")
-        .append(FIELD_TOKEN_ID + " integer not null,")
-        .append(FIELD_OP_CODE + " integer not null,")
-        .append(FIELD_STATUS + " integer not null,")
-        .append(FIELD_TIMESTAMP + " integer not null,")
-        .append(FIELD_ACCESS_DURATION + " integer not null,")
-        .append(FIELD_ACCESS_COUNT + " integer not null,")
-        .append(FIELD_REJECT_COUNT + " integer not null,")
-        .append("primary key(" + FIELD_TOKEN_ID)
-        .append("," + FIELD_OP_CODE)
-        .append("," + FIELD_STATUS)
-        .append("," + FIELD_TIMESTAMP)
-        .append("))");
-    return ExecuteSql(sql);
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "permission_used_record_db.h"
+
+#include "accesstoken_log.h"
+#include "constant.h"
+#include "field_const.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+namespace {
+static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
+    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "PermissionUsedRecordDb"
+};
+}
+
+PermissionUsedRecordDb& PermissionUsedRecordDb::GetInstance()
+{
+    static PermissionUsedRecordDb instance;
+    return instance;
+}
+
+PermissionUsedRecordDb::~PermissionUsedRecordDb()
+{
+    Close();
+}
+
+void PermissionUsedRecordDb::OnCreate()
+{
+    ACCESSTOKEN_LOG_INFO(LABEL, "Entry");
+    CreatePermissionRecordTable();
+}
+
+void PermissionUsedRecordDb::OnUpdate()
+{
+    ACCESSTOKEN_LOG_INFO(LABEL, "Entry");
+}
+
+PermissionUsedRecordDb::PermissionUsedRecordDb() : SqliteHelper(DATABASE_NAME, DATABASE_PATH, DATABASE_VERSION)
+{
+    SqliteTable permissionRecordTable;
+    permissionRecordTable.tableName_ = PERMISSION_RECORD_TABLE;
+    permissionRecordTable.tableColumnNames_ = {
+        FIELD_TOKEN_ID,
+        FIELD_OP_CODE,
+        FIELD_STATUS,
+        FIELD_TIMESTAMP,
+        FIELD_ACCESS_DURATION,
+        FIELD_ACCESS_COUNT,
+        FIELD_REJECT_COUNT
+    };
+
+    dataTypeToSqlTable_ = {
+        {PERMISSION_RECORD, permissionRecordTable},
+    };
+    Open();
+}
+
+int32_t PermissionUsedRecordDb::Add(DataType type, const std::vector<GenericValues>& values)
+{
+    OHOS::Utils::UniqueWriteGuard<OHOS::Utils::RWLock> lock(this->rwLock_);
+    std::string prepareSql = CreateInsertPrepareSqlCmd(type);
+    auto statement = Prepare(prepareSql);
+    BeginTransaction();
+    bool isExecuteSuccessfully = true;
+    for (const auto& value : values) {
+        std::vector<std::string> columnNames = value.GetAllKeys();
+        for (const auto& columnName : columnNames) {
+            statement.Bind(columnName, value.Get(columnName));
+        }
+        int32_t ret = statement.Step();
+        if (ret != Statement::State::DONE) {
+            ACCESSTOKEN_LOG_ERROR(LABEL, "failed, errorMsg: %{public}s", SpitError().c_str());
+            isExecuteSuccessfully = false;
+        }
+        statement.Reset();
+    }
+    if (!isExecuteSuccessfully) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "rollback transaction.");
+        RollbackTransaction();
+        return FAILURE;
+    }
+    ACCESSTOKEN_LOG_DEBUG(LABEL, "commit transaction.");
+    CommitTransaction();
+    return SUCCESS;
+}
+
+int32_t PermissionUsedRecordDb::Remove(DataType type, const GenericValues& conditions)
+{
+    OHOS::Utils::UniqueWriteGuard<OHOS::Utils::RWLock> lock(this->rwLock_);
+    std::vector<std::string> columnNames = conditions.GetAllKeys();
+    std::string prepareSql = CreateDeletePrepareSqlCmd(type, columnNames);
+    auto statement = Prepare(prepareSql);
+    for (const auto& columnName : columnNames) {
+        statement.Bind(columnName, conditions.Get(columnName));
+    }
+    int32_t ret = statement.Step();
+    return (ret == Statement::State::DONE) ? SUCCESS : FAILURE;
+}
+
+int32_t PermissionUsedRecordDb::Modify(
+    DataType type, const GenericValues& modifyValues, const GenericValues& conditions)
+{
+    OHOS::Utils::UniqueWriteGuard<OHOS::Utils::RWLock> lock(this->rwLock_);
+    std::vector<std::string> modifyColumns = modifyValues.GetAllKeys();
+    std::vector<std::string> conditionColumns = conditions.GetAllKeys();
+    std::string prepareSql = CreateUpdatePrepareSqlCmd(type, modifyColumns, conditionColumns);
+    auto statement = Prepare(prepareSql);
+    for (const auto& columnName : modifyColumns) {
+        statement.Bind(columnName, modifyValues.Get(columnName));
+    }
+    for (const auto& columnName : conditionColumns) {
+        statement.Bind(columnName, conditions.Get(columnName));
+    }
+    int32_t ret = statement.Step();
+    return (ret == Statement::State::DONE) ? SUCCESS : FAILURE;
+}
+
+int32_t PermissionUsedRecordDb::FindByConditions(DataType type, const GenericValues& andConditions,
+    const GenericValues& orConditions, std::vector<GenericValues>& results)
+{
+    OHOS::Utils::UniqueWriteGuard<OHOS::Utils::RWLock> lock(this->rwLock_);
+    std::vector<std::string> andColumns = andConditions.GetAllKeys();
+    std::vector<std::string> orColumns = orConditions.GetAllKeys();
+    std::string prepareSql = CreateSelectByConditionPrepareSqlCmd(type, andColumns, orColumns);
+    auto statement = Prepare(prepareSql);
+
+    for (const auto& columnName : andColumns) {
+        statement.Bind(columnName, andConditions.Get(columnName));
+    }
+    for (const auto& columnName : orColumns) {
+        statement.Bind(columnName, orConditions.Get(columnName));
+    }
+
+    while (statement.Step() == Statement::State::ROW) {
+        int32_t columnCount = statement.GetColumnCount();
+        GenericValues value;
+        for (int32_t i = 0; i < columnCount; i++) {
+            if (statement.GetColumnName(i) == FIELD_TIMESTAMP || statement.GetColumnName(i) == FIELD_ACCESS_DURATION) {
+                value.Put(statement.GetColumnName(i), statement.GetValue(i, true));
+            } else {
+                value.Put(statement.GetColumnName(i), statement.GetValue(i, false));
+            }
+        }
+        results.emplace_back(value);
+    }
+    return SUCCESS;
+}
+
+int32_t PermissionUsedRecordDb::GetDistinctValue(DataType type,
+    const std::string& condition, std::vector<GenericValues>& results)
+{
+    OHOS::Utils::UniqueWriteGuard<OHOS::Utils::RWLock> lock(this->rwLock_);
+    std::string getDistinctValueSql = CreateGetDistinctValue(type, condition);
+    auto statement = Prepare(getDistinctValueSql);
+    while (statement.Step() == Statement::State::ROW) {
+        int32_t columnCount = statement.GetColumnCount();
+        GenericValues value;
+        for (int32_t i = 0; i < columnCount; i++) {
+            if (statement.GetColumnName(i) == FIELD_TOKEN_ID) {
+                value.Put(statement.GetColumnName(i), statement.GetValue(i, false));
+            } else if (statement.GetColumnName(i) == FIELD_DEVICE_ID) {
+                value.Put(statement.GetColumnName(i), statement.GetColumnString(i));
+            }
+        }
+        results.emplace_back(value);
+    }
+    return SUCCESS;
+}
+
+int32_t PermissionUsedRecordDb::Count(DataType type, GenericValues& result)
+{
+    OHOS::Utils::UniqueWriteGuard<OHOS::Utils::RWLock> lock(this->rwLock_);
+    std::string countSql = CreateCountPrepareSqlCmd(type);
+    auto countStatement = Prepare(countSql);
+    if (countStatement.Step() == Statement::State::ROW) {
+        int32_t column = 0;
+        result.Put(Constant::COUNT_CMD, countStatement.GetValue(column, true));
+    }
+    return SUCCESS;
+}
+
+int32_t PermissionUsedRecordDb::DeleteExpireRecords(DataType type,
+    const GenericValues& andConditions)
+{
+    OHOS::Utils::UniqueWriteGuard<OHOS::Utils::RWLock> lock(this->rwLock_);
+    std::vector<std::string> andColumns = andConditions.GetAllKeys();
+    if (!andColumns.empty()) {
+        std::string deleteExpireSql = CreateDeleteExpireRecordsPrepareSqlCmd(type, andColumns);
+        auto deleteExpireStatement = Prepare(deleteExpireSql);
+        for (const auto& columnName : andColumns) {
+            deleteExpireStatement.Bind(columnName, andConditions.Get(columnName));
+        }
+        int32_t ret = deleteExpireStatement.Step();
+        if (ret != Statement::State::DONE) {
+            return FAILURE;
+        }
+    }
+    return SUCCESS;
+}
+
+int32_t PermissionUsedRecordDb::DeleteExcessiveRecords(DataType type, unsigned excessiveSize)
+{
+    OHOS::Utils::UniqueWriteGuard<OHOS::Utils::RWLock> lock(this->rwLock_);
+    std::string deleteExcessiveSql = CreateDeleteExcessiveRecordsPrepareSqlCmd(type, excessiveSize);
+    auto deleteExcessiveStatement = Prepare(deleteExcessiveSql);
+    if (deleteExcessiveStatement.Step() != Statement::State::DONE) {
+        return FAILURE;
+    }
+    return SUCCESS;
+}
+
+std::string PermissionUsedRecordDb::CreateInsertPrepareSqlCmd(DataType type) const
+{
+    auto it = dataTypeToSqlTable_.find(type);
+    if (it == dataTypeToSqlTable_.end()) {
+        return std::string();
+    }
+    std::string sql = "insert into " + it->second.tableName_ + " values(";
+    int32_t i = 1;
+    for (const auto& columnName : it->second.tableColumnNames_) {
+        sql.append(":" + columnName);
+        if (i < (int32_t) it->second.tableColumnNames_.size()) {
+            sql.append(",");
+        }
+        i += 1;
+    }
+    sql.append(")");
+    return sql;
+}
+
+std::string PermissionUsedRecordDb::CreateDeletePrepareSqlCmd(
+    DataType type, const std::vector<std::string>& columnNames) const
+{
+    auto it = dataTypeToSqlTable_.find(type);
+    if (it == dataTypeToSqlTable_.end()) {
+        return std::string();
+    }
+    std::string sql = "delete from " + it->second.tableName_ + " where 1 = 1";
+    for (const auto& columnName : columnNames) {
+        sql.append(" and ");
+        sql.append(columnName + "=:" + columnName);
+    }
+    return sql;
+}
+
+std::string PermissionUsedRecordDb::CreateUpdatePrepareSqlCmd(DataType type,
+    const std::vector<std::string>& modifyColumns, const std::vector<std::string>& conditionColumns) const
+{
+    if (modifyColumns.empty()) {
+        return std::string();
+    }
+
+    auto it = dataTypeToSqlTable_.find(type);
+    if (it == dataTypeToSqlTable_.end()) {
+        return std::string();
+    }
+
+    std::string sql = "update " + it->second.tableName_ + " set ";
+    int32_t i = 1;
+    for (const auto& columnName : modifyColumns) {
+        sql.append(columnName + "=:" + columnName);
+        if (i < (int32_t) modifyColumns.size()) {
+            sql.append(",");
+        }
+        i += 1;
+    }
+
+    if (!conditionColumns.empty()) {
+        sql.append(" where 1 = 1");
+        for (const auto& columnName : conditionColumns) {
+            sql.append(" and ");
+            sql.append(columnName + "=:" + columnName);
+        }
+    }
+    return sql;
+}
+
+std::string PermissionUsedRecordDb::CreateSelectByConditionPrepareSqlCmd(DataType type,
+    const std::vector<std::string>& andColumns, const std::vector<std::string>& orColumns) const
+{
+    auto it = dataTypeToSqlTable_.find(type);
+    if (it == dataTypeToSqlTable_.end()) {
+        return std::string();
+    }
+
+    std::string sql = "select * from " + it->second.tableName_ + " where 1 = 1";
+    for (const auto& andColName : andColumns) {
+        if (andColName == FIELD_TIMESTAMP_BEGIN) {
+            sql.append(" and ");
+            sql.append(FIELD_TIMESTAMP + " >=:" + andColName);
+        } else if (andColName == FIELD_TIMESTAMP_END) {
+            sql.append(" and ");
+            sql.append(FIELD_TIMESTAMP + " <=:" + andColName);
+        } else {
+            sql.append(" and ");
+            sql.append(andColName + "=:" + andColName);
+        }
+    }
+    if (!orColumns.empty()) {
+        sql.append(" and (");
+        for (const auto& orColName : orColumns) {
+            if (orColName.find(FIELD_OP_CODE) != std::string::npos) {
+                sql.append(FIELD_OP_CODE  + " =:" + orColName);
+                sql.append(" or ");
+            }
+        }
+        sql.append("0)");
+    }
+    return sql;
+}
+
+std::string PermissionUsedRecordDb::CreateCountPrepareSqlCmd(DataType type) const
+{
+    auto it = dataTypeToSqlTable_.find(type);
+    if (it == dataTypeToSqlTable_.end()) {
+        return std::string();
+    }
+    std::string sql = "select count(*) from " + it->second.tableName_;
+    return sql;
+}
+
+std::string PermissionUsedRecordDb::CreateDeleteExpireRecordsPrepareSqlCmd(DataType type,
+    const std::vector<std::string>& andColumns) const
+{
+    auto it = dataTypeToSqlTable_.find(type);
+    if (it == dataTypeToSqlTable_.end()) {
+        return std::string();
+    }
+    std::string sql = "delete from " + it->second.tableName_ + " where ";
+    sql.append(FIELD_TIMESTAMP + " in (select ");
+    sql.append(FIELD_TIMESTAMP + " from " + it->second.tableName_ + " where 1 = 1");
+    for (const auto& andColName : andColumns) {
+        if (andColName == FIELD_TIMESTAMP_BEGIN) {
+            sql.append(" and ");
+            sql.append(FIELD_TIMESTAMP + " >=:" + andColName);
+        } else if (andColName == FIELD_TIMESTAMP_END) {
+            sql.append(" and ");
+            sql.append(FIELD_TIMESTAMP + " <=:" + andColName);
+        } else {
+            sql.append(" and ");
+            sql.append(andColName + "=:" + andColName);
+        }
+    }
+    sql.append(" )");
+    return sql;
+}
+
+std::string PermissionUsedRecordDb::CreateDeleteExcessiveRecordsPrepareSqlCmd(DataType type,
+    uint32_t excessiveSize) const
+{
+    auto it = dataTypeToSqlTable_.find(type);
+    if (it == dataTypeToSqlTable_.end()) {
+        return std::string();
+    }
+    std::string sql = "delete from " + it->second.tableName_ + " where ";
+    sql.append(FIELD_TIMESTAMP + " in (select ");
+    sql.append(FIELD_TIMESTAMP + " from " + it->second.tableName_ + " order by ");
+    sql.append(FIELD_TIMESTAMP + " limit ");
+    sql.append(std::to_string(excessiveSize) + " )");
+    return sql;
+}
+
+std::string PermissionUsedRecordDb::CreateGetDistinctValue(DataType type,
+    const std::string conditionColumns) const
+{
+    auto it = dataTypeToSqlTable_.find(type);
+    if (it == dataTypeToSqlTable_.end()) {
+        return std::string();
+    }
+    std::string sql = "select distinct ";
+    sql.append(conditionColumns + " from "+ it->second.tableName_);
+    return sql;
+}
+
+int32_t PermissionUsedRecordDb::CreatePermissionRecordTable() const
+{
+    auto it = dataTypeToSqlTable_.find(DataType::PERMISSION_RECORD);
+    if (it == dataTypeToSqlTable_.end()) {
+        return FAILURE;
+    }
+    std::string sql = "create table if not exists ";
+    sql.append(it->second.tableName_ + " (")
+        .append(FIELD_TOKEN_ID + " integer not null,")
+        .append(FIELD_OP_CODE + " integer not null,")
+        .append(FIELD_STATUS + " integer not null,")
+        .append(FIELD_TIMESTAMP + " integer not null,")
+        .append(FIELD_ACCESS_DURATION + " integer not null,")
+        .append(FIELD_ACCESS_COUNT + " integer not null,")
+        .append(FIELD_REJECT_COUNT + " integer not null,")
+        .append("primary key(" + FIELD_TOKEN_ID)
+        .append("," + FIELD_OP_CODE)
+        .append("," + FIELD_STATUS)
+        .append("," + FIELD_TIMESTAMP)
+        .append("))");
+    return ExecuteSql(sql);
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/services/privacymanager/src/record/on_permission_used_record_callback_proxy.cpp b/services/privacymanager/src/record/on_permission_used_record_callback_proxy.cpp
index 79ddc389df00b0f33994dea0f8610875bf64b197..f9b9e52fe4ad4e42e16314c5f0270f9ca50d631c 100644
--- a/services/privacymanager/src/record/on_permission_used_record_callback_proxy.cpp
+++ b/services/privacymanager/src/record/on_permission_used_record_callback_proxy.cpp
@@ -1,71 +1,71 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "on_permission_used_record_callback_proxy.h"
-
-#include "accesstoken_log.h"
-#include "permission_used_result_parcel.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-namespace {
-static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
-    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "OnPermissionUsedRecordCallbackProxy"
-};
-}
-
-OnPermissionUsedRecordCallbackProxy::OnPermissionUsedRecordCallbackProxy(const sptr<IRemoteObject>& impl)
-    : IRemoteProxy<OnPermissionUsedRecordCallback>(impl) {
-}
-
-OnPermissionUsedRecordCallbackProxy::~OnPermissionUsedRecordCallbackProxy()
-{}
-
-void OnPermissionUsedRecordCallbackProxy::OnQueried(ErrCode code, PermissionUsedResult& result)
-{
-    MessageParcel data;
-    data.WriteInterfaceToken(OnPermissionUsedRecordCallback::GetDescriptor());
-    if (!data.WriteInt32(code)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteParcelable(code)");
-        return;
-    }
-
-    PermissionUsedResultParcel resultParcel;
-    resultParcel.result = result;
-    if (!data.WriteParcelable(&resultParcel)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteParcelable(result)");
-        return;
-    }
-
-    MessageParcel reply;
-    MessageOption option(MessageOption::TF_SYNC);
-    sptr<IRemoteObject> remote = Remote();
-    if (remote == nullptr) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "remote service null.");
-        return;
-    }
-    int32_t requestResult = remote->SendRequest(
-        static_cast<uint32_t>(OnPermissionUsedRecordCallback::ON_QUERIED), data, reply, option);
-    if (requestResult != NO_ERROR) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "send request fail, result: %{public}d", requestResult);
-        return;
-    }
-
-    ACCESSTOKEN_LOG_INFO(LABEL, "SendRequest success");
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "on_permission_used_record_callback_proxy.h"
+
+#include "accesstoken_log.h"
+#include "permission_used_result_parcel.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+namespace {
+static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
+    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "OnPermissionUsedRecordCallbackProxy"
+};
+}
+
+OnPermissionUsedRecordCallbackProxy::OnPermissionUsedRecordCallbackProxy(const sptr<IRemoteObject>& impl)
+    : IRemoteProxy<OnPermissionUsedRecordCallback>(impl) {
+}
+
+OnPermissionUsedRecordCallbackProxy::~OnPermissionUsedRecordCallbackProxy()
+{}
+
+void OnPermissionUsedRecordCallbackProxy::OnQueried(ErrCode code, PermissionUsedResult& result)
+{
+    MessageParcel data;
+    data.WriteInterfaceToken(OnPermissionUsedRecordCallback::GetDescriptor());
+    if (!data.WriteInt32(code)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteParcelable(code)");
+        return;
+    }
+
+    PermissionUsedResultParcel resultParcel;
+    resultParcel.result = result;
+    if (!data.WriteParcelable(&resultParcel)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to WriteParcelable(result)");
+        return;
+    }
+
+    MessageParcel reply;
+    MessageOption option(MessageOption::TF_SYNC);
+    sptr<IRemoteObject> remote = Remote();
+    if (remote == nullptr) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "remote service null.");
+        return;
+    }
+    int32_t requestResult = remote->SendRequest(
+        static_cast<uint32_t>(OnPermissionUsedRecordCallback::ON_QUERIED), data, reply, option);
+    if (requestResult != NO_ERROR) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "send request fail, result: %{public}d", requestResult);
+        return;
+    }
+
+    ACCESSTOKEN_LOG_INFO(LABEL, "SendRequest success");
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/services/privacymanager/src/record/on_permission_used_record_callback_stub.cpp b/services/privacymanager/src/record/on_permission_used_record_callback_stub.cpp
index d4b8215251c2bf436419ea0a9f26a5fa694eb07f..a5a53ee1fecf9de5d1660c4f105a99d7248a9ccd 100644
--- a/services/privacymanager/src/record/on_permission_used_record_callback_stub.cpp
+++ b/services/privacymanager/src/record/on_permission_used_record_callback_stub.cpp
@@ -1,65 +1,65 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "on_permission_used_record_callback_stub.h"
-
-#include "accesstoken_log.h"
-#include "constant.h"
-#include "permission_used_result_parcel.h"
-#include "constant.h"
-#include "string_ex.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-namespace {
-static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
-    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "OnPermissionUsedRecordCallbackStub"
-};
-}
-
-int32_t OnPermissionUsedRecordCallbackStub::OnRemoteRequest(
-    uint32_t code, MessageParcel& data, MessageParcel& reply, MessageOption& option)
-{
-    ACCESSTOKEN_LOG_DEBUG(LABEL, "Entry, code: 0x%{public}x", code);
-    std::u16string descriptor = data.ReadInterfaceToken();
-    if (descriptor != OnPermissionUsedRecordCallback::GetDescriptor()) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "get unexpect descriptor: %{public}s", Str16ToStr8(descriptor).c_str());
-        return Constant::FAILURE;
-    }
-
-    int32_t msgCode =  static_cast<int32_t>(code);
-    if (msgCode == OnPermissionUsedRecordCallback::ON_QUERIED) {
-        ErrCode errCode = data.ReadInt32();
-        PermissionUsedResult result;
-        if (errCode != NO_ERROR) {
-            OnQueried(errCode, result);
-            return Constant::FAILURE;
-        }
-        sptr<PermissionUsedResultParcel> resultSptr = data.ReadParcelable<PermissionUsedResultParcel>();
-        if (resultSptr == nullptr) {
-            ACCESSTOKEN_LOG_ERROR(LABEL, "ReadParcelable fail");
-            return Constant::FAILURE;
-        }
-        ACCESSTOKEN_LOG_INFO(LABEL, "errCode: %{public}d", errCode);
-        OnQueried(errCode, resultSptr->result);
-    } else {
-        return IPCObjectStub::OnRemoteRequest(code, data, reply, option);
-    }
-    return NO_ERROR;
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "on_permission_used_record_callback_stub.h"
+
+#include "accesstoken_log.h"
+#include "constant.h"
+#include "permission_used_result_parcel.h"
+#include "constant.h"
+#include "string_ex.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+namespace {
+static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
+    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "OnPermissionUsedRecordCallbackStub"
+};
+}
+
+int32_t OnPermissionUsedRecordCallbackStub::OnRemoteRequest(
+    uint32_t code, MessageParcel& data, MessageParcel& reply, MessageOption& option)
+{
+    ACCESSTOKEN_LOG_DEBUG(LABEL, "Entry, code: 0x%{public}x", code);
+    std::u16string descriptor = data.ReadInterfaceToken();
+    if (descriptor != OnPermissionUsedRecordCallback::GetDescriptor()) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "get unexpect descriptor: %{public}s", Str16ToStr8(descriptor).c_str());
+        return Constant::FAILURE;
+    }
+
+    int32_t msgCode =  static_cast<int32_t>(code);
+    if (msgCode == OnPermissionUsedRecordCallback::ON_QUERIED) {
+        ErrCode errCode = data.ReadInt32();
+        PermissionUsedResult result;
+        if (errCode != NO_ERROR) {
+            OnQueried(errCode, result);
+            return Constant::FAILURE;
+        }
+        sptr<PermissionUsedResultParcel> resultSptr = data.ReadParcelable<PermissionUsedResultParcel>();
+        if (resultSptr == nullptr) {
+            ACCESSTOKEN_LOG_ERROR(LABEL, "ReadParcelable fail");
+            return Constant::FAILURE;
+        }
+        ACCESSTOKEN_LOG_INFO(LABEL, "errCode: %{public}d", errCode);
+        OnQueried(errCode, resultSptr->result);
+    } else {
+        return IPCObjectStub::OnRemoteRequest(code, data, reply, option);
+    }
+    return NO_ERROR;
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/services/privacymanager/src/record/permission_record.cpp b/services/privacymanager/src/record/permission_record.cpp
index 643ec0f84f5bd7c8e4a511bf56158d821aa9a760..244879a796343d64a158d25714c353635d909b0e 100644
--- a/services/privacymanager/src/record/permission_record.cpp
+++ b/services/privacymanager/src/record/permission_record.cpp
@@ -1,45 +1,45 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "permission_record.h"
-#include "field_const.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-void PermissionRecord::TranslationIntoGenericValues(const PermissionRecord& record, GenericValues& values)
-{
-    values.Put(FIELD_TOKEN_ID, (int32_t)record.tokenId);
-    values.Put(FIELD_OP_CODE, record.opCode);
-    values.Put(FIELD_STATUS, record.status);
-    values.Put(FIELD_TIMESTAMP, record.timestamp);
-    values.Put(FIELD_ACCESS_DURATION, record.accessDuration);
-    values.Put(FIELD_ACCESS_COUNT, record.accessCount);
-    values.Put(FIELD_REJECT_COUNT, record.rejectCount);
-}
-
-void PermissionRecord::TranslationIntoPermissionRecord(const GenericValues& values, PermissionRecord& record)
-{
-    record.tokenId = values.GetInt(FIELD_TOKEN_ID);
-    record.opCode = values.GetInt(FIELD_OP_CODE);
-    record.status = values.GetInt(FIELD_STATUS);
-    record.timestamp = values.GetInt64(FIELD_TIMESTAMP);
-    record.accessDuration = values.GetInt64(FIELD_ACCESS_DURATION);
-    record.accessCount = values.GetInt(FIELD_ACCESS_COUNT);
-    record.rejectCount = values.GetInt(FIELD_REJECT_COUNT);
-}
-} // namespace AccessToken
-} // namespace Security
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "permission_record.h"
+#include "field_const.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+void PermissionRecord::TranslationIntoGenericValues(const PermissionRecord& record, GenericValues& values)
+{
+    values.Put(FIELD_TOKEN_ID, (int32_t)record.tokenId);
+    values.Put(FIELD_OP_CODE, record.opCode);
+    values.Put(FIELD_STATUS, record.status);
+    values.Put(FIELD_TIMESTAMP, record.timestamp);
+    values.Put(FIELD_ACCESS_DURATION, record.accessDuration);
+    values.Put(FIELD_ACCESS_COUNT, record.accessCount);
+    values.Put(FIELD_REJECT_COUNT, record.rejectCount);
+}
+
+void PermissionRecord::TranslationIntoPermissionRecord(const GenericValues& values, PermissionRecord& record)
+{
+    record.tokenId = values.GetInt(FIELD_TOKEN_ID);
+    record.opCode = values.GetInt(FIELD_OP_CODE);
+    record.status = values.GetInt(FIELD_STATUS);
+    record.timestamp = values.GetInt64(FIELD_TIMESTAMP);
+    record.accessDuration = values.GetInt64(FIELD_ACCESS_DURATION);
+    record.accessCount = values.GetInt(FIELD_ACCESS_COUNT);
+    record.rejectCount = values.GetInt(FIELD_REJECT_COUNT);
+}
+} // namespace AccessToken
+} // namespace Security
 } // namespace OHOS
\ No newline at end of file
diff --git a/services/privacymanager/src/record/permission_record_manager.cpp b/services/privacymanager/src/record/permission_record_manager.cpp
index 37514e9f5700b7eae12d3405ef18d2ddc47c53a2..0fd1b479abf61d5611ec9bd588a6824affbd100f 100644
--- a/services/privacymanager/src/record/permission_record_manager.cpp
+++ b/services/privacymanager/src/record/permission_record_manager.cpp
@@ -1,489 +1,389 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "permission_record_manager.h"
-
-#include "accesstoken_kit.h"
-#include "accesstoken_log.h"
-#include "active_status_callback_manager.h"
-#include "constant.h"
-#include "constant_common.h"
-#include "data_translator.h"
-#include "field_const.h"
-#include "permission_record_repository.h"
-#include "permission_used_record_cache.h"
-#include "time_util.h"
-#include "to_string.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-namespace {
-static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
-    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "PermissionRecordManager"
-};
-static const std::string DEFAULT_DEVICEID = "0";
-static const std::string FIELD_COUNT_NUMBER = "count";
-}
-PermissionRecordManager& PermissionRecordManager::GetInstance()
-{
-    static PermissionRecordManager instance;
-    return instance;
-}
-
-PermissionRecordManager::PermissionRecordManager() : hasInited_(false) {}
-
-PermissionRecordManager::~PermissionRecordManager()
-{
-    if (!hasInited_) {
-        return;
-    }
-    deleteTaskWorker_.Stop();
-    hasInited_ = false;
-}
-
-void PermissionRecordManager::AddRecord(const PermissionRecord& record)
-{
-    Utils::UniqueWriteGuard<Utils::RWLock> lk(this->rwLock_);
-    PermissionUsedRecordCache::GetInstance().AddRecordToBuffer(const_cast<PermissionRecord&>(record));
-}
-
-bool PermissionRecordManager::GetPermissionRecord(AccessTokenID tokenId, const std::string& permissionName,
-    int32_t successCount, int32_t failCount, PermissionRecord& record)
-{
-    HapTokenInfo tokenInfo;
-    if (AccessTokenKit::GetHapTokenInfo(tokenId, tokenInfo) != Constant::SUCCESS) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "invalid tokenId(%{public}d)", tokenId);
-        return false;
-    }
-    int32_t opCode;
-    if (!Constant::TransferPermissionToOpcode(permissionName, opCode)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "invalid permission(%{public}s)", permissionName.c_str());
-        return false;
-    }
-    if (successCount == 0 && failCount == 0) {
-        record.status = PERM_INACTIVE;
-    } else {
-        record.status = PERM_ACTIVE_IN_FOREGROUND;
-    }
-    record.tokenId = tokenId;
-    record.accessCount = successCount;
-    record.rejectCount = failCount;
-    record.opCode = opCode;
-    record.timestamp = TimeUtil::GetCurrentTimestamp();
-    record.accessDuration = 0;
-    ACCESSTOKEN_LOG_DEBUG(LABEL, "record status: %{public}d", record.status);
-    return true;
-}
-
-int32_t PermissionRecordManager::AddPermissionUsedRecord(AccessTokenID tokenId, const std::string& permissionName,
-    int32_t successCount, int32_t failCount)
-{
-    ExecuteDeletePermissionRecordTask();
-
-    PermissionRecord record;
-    if (!GetPermissionRecord(tokenId, permissionName, successCount, failCount, record)) {
-        return Constant::FAILURE;
-    }
-
-    if (record.status == PERM_INACTIVE) {
-        return Constant::FAILURE;
-    }
-
-    AddRecord(record);
-    return Constant::SUCCESS;
-}
-
-void PermissionRecordManager::RemovePermissionUsedRecords(AccessTokenID tokenId, const std::string& deviceID)
-{
-    if (tokenId == 0) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "tokenId is 0");
-        return;
-    }
-
-    // only support remove by tokenId(local)
-    std::string device = GetDeviceId(tokenId);
-    if (device.empty()) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "invalid tokenId = %{public}d", tokenId);
-        return;
-    }
-
-    if (!deviceID.empty() && device != deviceID) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "deviceID mismatch");
-        return;
-    }
-
-    Utils::UniqueWriteGuard<Utils::RWLock> lk(this->rwLock_);
-    PermissionUsedRecordCache::GetInstance().RemoveRecords(tokenId); // remove from cache and database
-}
-
-int32_t PermissionRecordManager::GetPermissionUsedRecords(
-    const PermissionUsedRequest& request, PermissionUsedResult& result)
-{
-    ExecuteDeletePermissionRecordTask();
-
-    if (!request.isRemote && !GetRecordsFromLocalDB(request, result)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to GetRecordsFromLocalDB");
-        return  Constant::FAILURE;
-    }
-    return Constant::SUCCESS;
-}
-
-int32_t PermissionRecordManager::GetPermissionUsedRecordsAsync(
-    const PermissionUsedRequest& request, const sptr<OnPermissionUsedRecordCallback>& callback)
-{
-    auto task = [request, callback]() {
-        ACCESSTOKEN_LOG_INFO(LABEL, "GetPermissionUsedRecordsAsync task called");
-        PermissionUsedResult result;
-        int32_t ret = PermissionRecordManager::GetInstance().GetPermissionUsedRecords(request, result);
-        callback->OnQueried(ret, result);
-    };
-    std::thread recordThread(task);
-    recordThread.detach();
-    return Constant::SUCCESS;
-}
-
-bool PermissionRecordManager::GetLocalRecordTokenIdList(std::set<AccessTokenID>& tokenIdList)
-{
-    std::vector<GenericValues> results;
-    {
-        Utils::UniqueWriteGuard<Utils::RWLock> lk(this->rwLock_);
-        // find tokenId from cache
-        PermissionUsedRecordCache::GetInstance().FindTokenIdList(tokenIdList);
-        // find tokenId from database
-        PermissionRecordRepository::GetInstance().GetAllRecordValuesByKey(FIELD_TOKEN_ID, results);
-    }
-    for (const auto& res : results) {
-        tokenIdList.emplace(res.GetInt(FIELD_TOKEN_ID));
-    }
-    return true;
-}
-
-bool PermissionRecordManager::GetRecordsFromLocalDB(const PermissionUsedRequest& request, PermissionUsedResult& result)
-{
-    GenericValues andConditionValues;
-    GenericValues orConditionValues;
-    if (DataTranslator::TranslationIntoGenericValues(request, andConditionValues, orConditionValues)
-        != Constant::SUCCESS) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "query time or flag is invalid");
-        return false;
-    }
-    
-    std::set<AccessTokenID> tokenIdList;
-    if (request.tokenId == 0) {
-        GetLocalRecordTokenIdList(tokenIdList);
-    } else {
-        tokenIdList.emplace(request.tokenId);
-    }
-    ACCESSTOKEN_LOG_DEBUG(LABEL, "GetLocalRecordTokenIdList.size = %{public}zu", tokenIdList.size());
-    Utils::UniqueWriteGuard<Utils::RWLock> lk(this->rwLock_);
-    for (const auto& tokenId : tokenIdList) {
-        andConditionValues.Put(FIELD_TOKEN_ID, (int32_t)tokenId);
-        std::vector<GenericValues> findRecordsValues;
-        PermissionUsedRecordCache::GetInstance().GetRecords(request.permissionList,
-            andConditionValues, orConditionValues, findRecordsValues); // find records from cache and database
-        andConditionValues.Remove(FIELD_TOKEN_ID);
-        BundleUsedRecord bundleRecord;
-        CreateBundleUsedRecord(tokenId, bundleRecord);
-        if (!findRecordsValues.empty()) {
-            if (!GetRecords(request.flag, findRecordsValues, bundleRecord, result)) {
-                return false;
-            }
-        }
-
-        if (!bundleRecord.permissionRecords.empty()) {
-            result.bundleRecords.emplace_back(bundleRecord);
-        }
-    }
-    return true;
-}
-
-bool PermissionRecordManager::CreateBundleUsedRecord(const AccessTokenID tokenId, BundleUsedRecord& bundleRecord)
-{
-    HapTokenInfo tokenInfo;
-    if (AccessTokenKit::GetHapTokenInfo(tokenId, tokenInfo) != Constant::SUCCESS) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "GetHapTokenInfo failed");
-        return false;
-    }
-    bundleRecord.tokenId = tokenId;
-    bundleRecord.isRemote = false;
-    bundleRecord.deviceId = GetDeviceId(tokenId);
-    bundleRecord.bundleName = tokenInfo.bundleName;
-    return true;
-}
-
-bool PermissionRecordManager::GetRecords(
-    int32_t flag, std::vector<GenericValues> recordValues, BundleUsedRecord& bundleRecord, PermissionUsedResult& result)
-{
-    std::vector<PermissionUsedRecord> permissionRecords;
-    for (auto it = recordValues.rbegin(); it != recordValues.rend(); ++it) {
-        GenericValues record = *it;
-        PermissionUsedRecord tmpPermissionRecord;
-        int64_t timestamp = record.GetInt64(FIELD_TIMESTAMP);
-        result.beginTimeMillis = ((result.beginTimeMillis == 0) || (timestamp < result.beginTimeMillis)) ?
-            timestamp : result.beginTimeMillis;
-        result.endTimeMillis = (timestamp > result.endTimeMillis) ? timestamp : result.endTimeMillis;
-
-        record.Put(FIELD_FLAG, flag);
-        if (DataTranslator::TranslationGenericValuesIntoPermissionUsedRecord(record, tmpPermissionRecord)
-            != Constant::SUCCESS) {
-            ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to transform opcode(%{public}d) into permission",
-                record.GetInt(FIELD_OP_CODE));
-            continue;
-        }
-
-        auto iter = std::find_if(permissionRecords.begin(), permissionRecords.end(),
-            [tmpPermissionRecord](const PermissionUsedRecord& rec) {
-            return tmpPermissionRecord.permissionName == rec.permissionName;
-        });
-        if (iter != permissionRecords.end()) {
-            UpdateRecords(flag, tmpPermissionRecord, *iter);
-        } else {
-            permissionRecords.emplace_back(tmpPermissionRecord);
-        }
-    }
-    bundleRecord.permissionRecords = permissionRecords;
-    return true;
-}
-
-void PermissionRecordManager::UpdateRecords(
-    int32_t flag, const PermissionUsedRecord& inBundleRecord, PermissionUsedRecord& outBundleRecord)
-{
-    outBundleRecord.accessCount += inBundleRecord.accessCount;
-    outBundleRecord.rejectCount += inBundleRecord.rejectCount;
-    if (inBundleRecord.lastAccessTime > outBundleRecord.lastAccessTime) {
-        outBundleRecord.lastAccessTime = inBundleRecord.lastAccessTime;
-        outBundleRecord.lastAccessDuration = inBundleRecord.lastAccessDuration;
-    }
-    outBundleRecord.lastRejectTime = (inBundleRecord.lastRejectTime > outBundleRecord.lastRejectTime) ?
-        inBundleRecord.lastRejectTime : outBundleRecord.lastRejectTime;
-
-    if (flag == 0) {
-        return;
-    }
-    if (inBundleRecord.lastAccessTime > 0 && outBundleRecord.accessRecords.size() < Constant::MAX_DETAIL_RECORD) {
-        outBundleRecord.accessRecords.emplace_back(inBundleRecord.accessRecords[0]);
-    }
-    if (inBundleRecord.lastRejectTime > 0 && outBundleRecord.rejectRecords.size() < Constant::MAX_DETAIL_RECORD) {
-        outBundleRecord.rejectRecords.emplace_back(inBundleRecord.rejectRecords[0]);
-    }
-}
-
-void PermissionRecordManager::ExecuteDeletePermissionRecordTask()
-{
-    if (deleteTaskWorker_.GetCurTaskNum() > 1) {
-        ACCESSTOKEN_LOG_INFO(LABEL, "Already has delete task!");
-        return;
-    }
-
-    auto deleteRecordsTask = [this]() {
-        ACCESSTOKEN_LOG_DEBUG(LABEL, "DeletePermissionRecord task called");
-        DeletePermissionRecord(Constant::RECORD_DELETE_TIME);
-    };
-    deleteTaskWorker_.AddTask(deleteRecordsTask);
-}
-
-int32_t PermissionRecordManager::DeletePermissionRecord(int32_t days)
-{
-    Utils::UniqueWriteGuard<Utils::RWLock> lk(this->rwLock_);
-    GenericValues countValue;
-    PermissionRecordRepository::GetInstance().CountRecordValues(countValue);
-    int64_t total = countValue.GetInt64(FIELD_COUNT_NUMBER);
-    if (total > Constant::MAX_TOTAL_RECORD) {
-        uint32_t excessiveSize = total - Constant::MAX_TOTAL_RECORD;
-        if (!PermissionRecordRepository::GetInstance().DeleteExcessiveSizeRecordValues(excessiveSize)) {
-            return Constant::FAILURE;
-        }
-    }
-    GenericValues andConditionValues;
-    int64_t deleteTimestamp = TimeUtil::GetCurrentTimestamp() - days;
-    andConditionValues.Put(FIELD_TIMESTAMP_END, deleteTimestamp);
-    if (!PermissionRecordRepository::GetInstance().DeleteExpireRecordsValues(andConditionValues)) {
-        return Constant::FAILURE;
-    }
-    return Constant::SUCCESS;
-}
-
-std::string PermissionRecordManager::DumpRecordInfo(AccessTokenID tokenId, const std::string& permissionName)
-{
-    PermissionUsedRequest request;
-    request.tokenId = tokenId;
-    request.flag = FLAG_PERMISSION_USAGE_DETAIL;
-    if (!permissionName.empty()) {
-        request.permissionList.emplace_back(permissionName);
-    }
-
-    PermissionUsedResult result;
-    if (!GetRecordsFromLocalDB(request, result)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "failed to GetRecordsFromLocalDB");
-        return "";
-    }
-
-    if (result.bundleRecords.empty()) {
-        ACCESSTOKEN_LOG_DEBUG(LABEL, "no record");
-        return "";
-    }
-    std::string dumpInfo;
-    ToString::PermissionUsedResultToString(result, dumpInfo);
-    return dumpInfo;
-}
-
-bool PermissionRecordManager::HasStarted(const PermissionRecord& record)
-{
-    Utils::UniqueWriteGuard<Utils::RWLock> lk(this->startRecordListRWLock_);
-    for (const auto& rec : startRecordList_) {
-        if ((rec.opCode == record.opCode) && (rec.tokenId == record.tokenId)) {
-            ACCESSTOKEN_LOG_ERROR(LABEL, "tokenId(%{public}d), opCode(%{public}d) has been started.",
-                record.tokenId, record.opCode);
-            return true;
-        }
-    }
-    return false;
-}
-
-void PermissionRecordManager::AddRecordToStartList(const PermissionRecord& record)
-{
-    Utils::UniqueWriteGuard<Utils::RWLock> lk(this->startRecordListRWLock_);
-    startRecordList_.emplace_back(record);
-}
-
-bool PermissionRecordManager::GetRecordFromStartList(uint32_t tokenId,  int32_t opCode, PermissionRecord& record)
-{
-    Utils::UniqueWriteGuard<Utils::RWLock> lk(this->startRecordListRWLock_);
-    for (auto it = startRecordList_.begin(); it != startRecordList_.end(); ++it) {
-        if ((it->opCode == opCode) && (tokenId == (it->tokenId))) {
-            record = *it;
-            record.accessDuration = TimeUtil::GetCurrentTimestamp() - record.timestamp;
-            startRecordList_.erase(it);
-            return true;
-        }
-    }
-    return false;
-}
-
-void PermissionRecordManager::ResetRecord(PermissionRecord& record, int32_t status)
-{
-    record.status = status;
-    record.accessDuration = 0;
-    record.timestamp = TimeUtil::GetCurrentTimestamp();
-}
-
-std::vector<PermissionRecord> PermissionRecordManager::GetRecordsAndReset(uint32_t tokenId, int32_t status)
-{
-    std::vector<PermissionRecord> recordList;
-    Utils::UniqueWriteGuard<Utils::RWLock> lk(this->startRecordListRWLock_);
-    for (auto it = startRecordList_.begin(); it != startRecordList_.end(); ++it) {
-        if ((it->tokenId == tokenId) && status != (it->status)) {
-            PermissionRecord record = *it;
-            record.accessDuration = TimeUtil::GetCurrentTimestamp() - record.timestamp;
-            recordList.emplace_back(record);
-            ResetRecord(*it, status);
-        }
-    }
-    return recordList;
-}
-
-void PermissionRecordManager::CallbackExecute(
-    AccessTokenID tokenId, const std::string& permissionName, int32_t status)
-{
-    ActiveStatusCallbackManager::GetInstance().ExecuteCallbackAsync(
-        tokenId, permissionName, GetDeviceId(tokenId), (ActiveChangeType)status);
-}
-
-int32_t PermissionRecordManager::StartUsingPermission(AccessTokenID tokenId, const std::string& permissionName)
-{
-    int32_t accessCount = 1;
-    int32_t failCount = 0;
-
-    PermissionRecord record = { 0 };
-    if (!GetPermissionRecord(tokenId, permissionName, accessCount, failCount, record)) {
-        return Constant::FAILURE;
-    }
-
-    if (HasStarted(record)) {
-        return Constant::FAILURE;
-    }
-
-    AddRecordToStartList(record);
-    if (record.status != PERM_INACTIVE) {
-        CallbackExecute(tokenId, permissionName, record.status);
-    }
-    return Constant::SUCCESS;
-}
-
-int32_t PermissionRecordManager::StopUsingPermission(AccessTokenID tokenId, const std::string& permissionName)
-{
-    ExecuteDeletePermissionRecordTask();
-
-    if (AccessTokenKit::GetTokenTypeFlag(tokenId) != TOKEN_HAP) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "invalid tokenId(%{public}d)", tokenId);
-        return Constant::FAILURE;
-    }
-
-    int32_t opCode;
-    if (!Constant::TransferPermissionToOpcode(permissionName, opCode)) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "invalid permission(%{public}s)", permissionName.c_str());
-        return Constant::FAILURE;
-    }
-
-    PermissionRecord record;
-    if (!GetRecordFromStartList(tokenId, opCode, record)) {
-        return Constant::FAILURE;
-    }
-
-    if (record.status != PERM_INACTIVE) {
-        ACCESSTOKEN_LOG_INFO(LABEL, "AddRecord(tokenId: %{public}d, opCode: %{public}d, status: %{public}d)",
-            record.tokenId, record.opCode, record.status);
-        AddRecord(record);
-        CallbackExecute(tokenId, permissionName, PERM_INACTIVE);
-    }
-    return Constant::SUCCESS;
-}
-
-int32_t PermissionRecordManager::RegisterPermActiveStatusCallback(
-    std::vector<std::string>& permList, const sptr<IRemoteObject>& callback)
-{
-    return ActiveStatusCallbackManager::GetInstance().AddCallback(permList, callback);
-}
-
-int32_t PermissionRecordManager::UnRegisterPermActiveStatusCallback(const sptr<IRemoteObject>& callback)
-{
-    return ActiveStatusCallbackManager::GetInstance().RemoveCallback(callback);
-}
-
-std::string PermissionRecordManager::GetDeviceId(AccessTokenID tokenId)
-{
-    HapTokenInfo tokenInfo;
-    if (AccessTokenKit::GetHapTokenInfo(tokenId, tokenInfo) != Constant::SUCCESS) {
-        return "";
-    }
-    if (tokenInfo.deviceID == DEFAULT_DEVICEID) { // local
-        return ConstantCommon::GetLocalDeviceId();
-    }
-    return tokenInfo.deviceID;
-}
-
-void PermissionRecordManager::Init()
-{
-    if (hasInited_) {
-        return;
-    }
-    ACCESSTOKEN_LOG_INFO(LABEL, "init");
-    deleteTaskWorker_.Start(1);
-    hasInited_ = true;
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "permission_record_manager.h"
+
+#include "accesstoken_kit.h"
+#include "accesstoken_log.h"
+#include "constant.h"
+#include "constant_common.h"
+#include "data_translator.h"
+#include "field_const.h"
+#include "permission_record_repository.h"
+#include "permission_used_record_cache.h"
+#include "active_status_callback_manager.h"
+#include "time_util.h"
+#include "to_string.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+namespace {
+static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
+    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "PermissionRecordManager"
+};
+static const std::string DEFAULT_DEVICEID = "0";
+}
+PermissionRecordManager& PermissionRecordManager::GetInstance()
+{
+    static PermissionRecordManager instance;
+    return instance;
+}
+
+PermissionRecordManager::PermissionRecordManager() : hasInited_(false) {}
+
+PermissionRecordManager::~PermissionRecordManager()
+{
+    if (!hasInited_) {
+        return;
+    }
+    deleteTaskWorker_.Stop();
+    hasInited_ = false;
+}
+
+int32_t PermissionRecordManager::AddRecord(const PermissionRecord& record)
+{
+    Utils::UniqueWriteGuard<Utils::RWLock> lk(this->rwLock_);
+    return PermissionUsedRecordCache::GetInstance().AddRecordToBuffer(const_cast<PermissionRecord&>(record));
+}
+
+bool PermissionRecordManager::GetPermissionsRecord(AccessTokenID tokenId, const std::string& permissionName,
+    int32_t successCount, int32_t failCount, PermissionRecord& record)
+{
+    HapTokenInfo tokenInfo;
+    if (AccessTokenKit::GetHapTokenInfo(tokenId, tokenInfo) != Constant::SUCCESS) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "invalid tokenId(%{public}d)", tokenId);
+        return false;
+    }
+    int32_t opCode;
+    if (!Constant::TransferPermissionToOpcode(permissionName, opCode)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "invalid permission(%{public}s)", permissionName.c_str());
+        return false;
+    }
+    if (successCount == 0 && failCount == 0) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "successCount and failCount are both zero");
+        return false;
+    }
+    record.tokenId = tokenId;
+    record.accessCount = successCount;
+    record.rejectCount = failCount;
+    record.opCode = opCode;
+    record.status = 0;
+    record.timestamp = TimeUtil::GetCurrentTimestamp();
+    record.accessDuration = 0;
+    return true;
+}
+
+int32_t PermissionRecordManager::AddPermissionUsedRecord(AccessTokenID tokenId, const std::string& permissionName,
+    int32_t successCount, int32_t failCount)
+{
+    ExecuteDeletePermissionRecordTask();
+
+    PermissionRecord record;
+    if (!GetPermissionsRecord(tokenId, permissionName, successCount, failCount, record)) {
+        return Constant::FAILURE;
+    }
+
+    return AddRecord(record);
+}
+
+void PermissionRecordManager::RemovePermissionUsedRecords(AccessTokenID tokenId, const std::string& deviceID)
+{
+    if (tokenId == 0) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "tokenId is 0");
+        return;
+    }
+
+    // only support remove by tokenId(local)
+    std::string device = GetDeviceId(tokenId);
+    if (device.empty()) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "invalid tokenId = %{public}d", tokenId);
+        return;
+    }
+
+    if (!deviceID.empty() && device != deviceID) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "deviceID mismatch");
+        return;
+    }
+
+    Utils::UniqueWriteGuard<Utils::RWLock> lk(this->rwLock_);
+    GenericValues record;
+    record.Put(FIELD_TOKEN_ID, (int32_t)tokenId);
+    PermissionUsedRecordCache::GetInstance().RemoveRecords(record); // remove from cache and database
+}
+
+int32_t PermissionRecordManager::GetPermissionUsedRecords(
+    const PermissionUsedRequest& request, PermissionUsedResult& result)
+{
+    ExecuteDeletePermissionRecordTask();
+
+    if (!request.isRemote && !GetRecordsFromLocalDB(request, result)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to GetRecordsFromLocalDB");
+        return  Constant::FAILURE;
+    }
+    return Constant::SUCCESS;
+}
+
+int32_t PermissionRecordManager::GetPermissionUsedRecordsAsync(
+    const PermissionUsedRequest& request, const sptr<OnPermissionUsedRecordCallback>& callback)
+{
+    auto task = [request, callback]() {
+        ACCESSTOKEN_LOG_INFO(LABEL, "GetPermissionUsedRecordsAsync task called");
+        PermissionUsedResult result;
+        int32_t ret = PermissionRecordManager::GetInstance().GetPermissionUsedRecords(request, result);
+        callback->OnQueried(ret, result);
+    };
+    std::thread recordThread(task);
+    recordThread.detach();
+    return Constant::SUCCESS;
+}
+
+bool PermissionRecordManager::GetLocalRecordTokenIdList(std::set<AccessTokenID>& tokenIdList)
+{
+    std::vector<GenericValues> results;
+    {
+        Utils::UniqueWriteGuard<Utils::RWLock> lk(this->rwLock_);
+        // find tokenId from cache
+        PermissionUsedRecordCache::GetInstance().FindTokenIdList(tokenIdList);
+        // find tokenId from database
+        PermissionRecordRepository::GetInstance().GetAllRecordValuesByKey(FIELD_TOKEN_ID, results);
+    }
+    for (const auto& res : results) {
+        tokenIdList.emplace(res.GetInt(FIELD_TOKEN_ID));
+    }
+    return true;
+}
+
+bool PermissionRecordManager::GetRecordsFromLocalDB(const PermissionUsedRequest& request, PermissionUsedResult& result)
+{
+    GenericValues andConditionValues;
+    GenericValues orConditionValues;
+    if (DataTranslator::TranslationIntoGenericValues(request, andConditionValues, orConditionValues)
+        != Constant::SUCCESS) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "query time or flag is invalid");
+        return false;
+    }
+    
+    std::set<AccessTokenID> tokenIdList;
+    if (request.tokenId == 0) {
+        GetLocalRecordTokenIdList(tokenIdList);
+    } else {
+        tokenIdList.emplace(request.tokenId);
+    }
+    ACCESSTOKEN_LOG_DEBUG(LABEL, "GetLocalRecordTokenIdList.size = %{public}zu", tokenIdList.size());
+    Utils::UniqueWriteGuard<Utils::RWLock> lk(this->rwLock_);
+    for (const auto& tokenId : tokenIdList) {
+        andConditionValues.Put(FIELD_TOKEN_ID, (int32_t)tokenId);
+        std::vector<GenericValues> findRecordsValues;
+        PermissionUsedRecordCache::GetInstance().GetRecords(request.permissionList,
+            andConditionValues, orConditionValues, findRecordsValues); // find records from cache and database
+        andConditionValues.Remove(FIELD_TOKEN_ID);
+        BundleUsedRecord bundleRecord;
+        CreateBundleUsedRecord(tokenId, bundleRecord);
+        if (!findRecordsValues.empty()) {
+            if (!GetRecords(request.flag, findRecordsValues, bundleRecord, result)) {
+                return false;
+            }
+        }
+
+        if (!bundleRecord.permissionRecords.empty()) {
+            result.bundleRecords.emplace_back(bundleRecord);
+        }
+    }
+    return true;
+}
+
+bool PermissionRecordManager::CreateBundleUsedRecord(const AccessTokenID tokenId, BundleUsedRecord& bundleRecord)
+{
+    HapTokenInfo tokenInfo;
+    if (AccessTokenKit::GetHapTokenInfo(tokenId, tokenInfo) != Constant::SUCCESS) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "GetHapTokenInfo failed");
+        return false;
+    }
+    bundleRecord.tokenId = tokenId;
+    bundleRecord.isRemote = false;
+    bundleRecord.deviceId = ConstantCommon::GetLocalDeviceId();
+    bundleRecord.bundleName = tokenInfo.bundleName;
+    return true;
+}
+
+bool PermissionRecordManager::GetRecords(
+    int32_t flag, std::vector<GenericValues> recordValues, BundleUsedRecord& bundleRecord, PermissionUsedResult& result)
+{
+    std::vector<PermissionUsedRecord> permissionRecords;
+    for (auto it = recordValues.rbegin(); it != recordValues.rend(); ++it) {
+        GenericValues record = *it;
+        PermissionUsedRecord tmpPermissionRecord;
+        int64_t timestamp = record.GetInt64(FIELD_TIMESTAMP);
+        result.beginTimeMillis = ((result.beginTimeMillis == 0) || (timestamp < result.beginTimeMillis)) ?
+            timestamp : result.beginTimeMillis;
+        result.endTimeMillis = (timestamp > result.endTimeMillis) ? timestamp : result.endTimeMillis;
+
+        record.Put(FIELD_FLAG, flag);
+        if (DataTranslator::TranslationGenericValuesIntoPermissionUsedRecord(record, tmpPermissionRecord)
+            != Constant::SUCCESS) {
+            ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to transform opcode(%{public}d) into permission",
+                record.GetInt(FIELD_OP_CODE));
+            continue;
+        }
+
+        auto iter = std::find_if(permissionRecords.begin(), permissionRecords.end(),
+            [tmpPermissionRecord](const PermissionUsedRecord& rec) {
+            return tmpPermissionRecord.permissionName == rec.permissionName;
+        });
+        if (iter != permissionRecords.end()) {
+            UpdateRecords(flag, tmpPermissionRecord, *iter);
+        } else {
+            permissionRecords.emplace_back(tmpPermissionRecord);
+        }
+    }
+    bundleRecord.permissionRecords = permissionRecords;
+    return true;
+}
+
+void PermissionRecordManager::UpdateRecords(
+    int32_t flag, const PermissionUsedRecord& inBundleRecord, PermissionUsedRecord& outBundleRecord)
+{
+    outBundleRecord.accessCount += inBundleRecord.accessCount;
+    outBundleRecord.rejectCount += inBundleRecord.rejectCount;
+    if (inBundleRecord.lastAccessTime > outBundleRecord.lastAccessTime) {
+        outBundleRecord.lastAccessTime = inBundleRecord.lastAccessTime;
+        outBundleRecord.lastAccessDuration = inBundleRecord.lastAccessDuration;
+    }
+    outBundleRecord.lastRejectTime = (inBundleRecord.lastRejectTime > outBundleRecord.lastRejectTime) ?
+        inBundleRecord.lastRejectTime : outBundleRecord.lastRejectTime;
+
+    if (flag == 0) {
+        return;
+    }
+    if (inBundleRecord.lastAccessTime > 0 && outBundleRecord.accessRecords.size() < Constant::MAX_DETAIL_RECORD) {
+        outBundleRecord.accessRecords.emplace_back(inBundleRecord.accessRecords[0]);
+    }
+    if (inBundleRecord.lastRejectTime > 0 && outBundleRecord.rejectRecords.size() < Constant::MAX_DETAIL_RECORD) {
+        outBundleRecord.rejectRecords.emplace_back(inBundleRecord.rejectRecords[0]);
+    }
+}
+
+void PermissionRecordManager::ExecuteDeletePermissionRecordTask()
+{
+    if (deleteTaskWorker_.GetCurTaskNum() > 1) {
+        ACCESSTOKEN_LOG_INFO(LABEL, "Already has delete task!");
+        return;
+    }
+
+    auto deleteRecordsTask = [this]() {
+        ACCESSTOKEN_LOG_DEBUG(LABEL, "DeletePermissionRecord task called");
+        DeletePermissionRecord(Constant::RECORD_DELETE_TIME);
+    };
+    deleteTaskWorker_.AddTask(deleteRecordsTask);
+}
+
+int32_t PermissionRecordManager::DeletePermissionRecord(int32_t days)
+{
+    Utils::UniqueWriteGuard<Utils::RWLock> lk(this->rwLock_);
+    GenericValues countValue;
+    if (!PermissionRecordRepository::GetInstance().CountRecordValues(countValue)) {
+        return Constant::FAILURE;
+    }
+    int64_t total = countValue.GetInt64(Constant::COUNT_CMD);
+    if (total > Constant::MAX_TOTAL_RECORD) {
+        uint32_t excessiveSize = total - Constant::MAX_TOTAL_RECORD;
+        if (!PermissionRecordRepository::GetInstance().DeleteExcessiveSizeRecordValues(excessiveSize)) {
+            return Constant::FAILURE;
+        }
+    }
+    GenericValues andConditionValues;
+    int64_t deleteTimestamp = TimeUtil::GetCurrentTimestamp() - days;
+    andConditionValues.Put(FIELD_TIMESTAMP_END, deleteTimestamp);
+    if (!PermissionRecordRepository::GetInstance().DeleteExpireRecordsValues(andConditionValues)) {
+        return Constant::FAILURE;
+    }
+    return Constant::SUCCESS;
+}
+
+std::string PermissionRecordManager::DumpRecordInfo(AccessTokenID tokenId, const std::string& permissionName)
+{
+    PermissionUsedRequest request;
+    request.tokenId = tokenId;
+    request.flag = FLAG_PERMISSION_USAGE_DETAIL;
+    if (!permissionName.empty()) {
+        request.permissionList.emplace_back(permissionName);
+    }
+
+    PermissionUsedResult result;
+    if (!GetRecordsFromLocalDB(request, result)) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "failed to GetRecordsFromLocalDB");
+        return "";
+    }
+
+    if (result.bundleRecords.empty()) {
+        ACCESSTOKEN_LOG_DEBUG(LABEL, "no record");
+        return "";
+    }
+    std::string dumpInfo;
+    ToString::PermissionUsedResultToString(result, dumpInfo);
+    return dumpInfo;
+}
+
+int32_t PermissionRecordManager::StartUsingPermission(AccessTokenID tokenId, const std::string& permissionName)
+{
+    ActiveStatusCallbackManager::GetInstance().ExecuteCallbackAsync(
+        tokenId, permissionName, ConstantCommon::GetLocalDeviceId(), PERM_ACTIVE_IN_FOREGROUND);
+    return Constant::SUCCESS;
+}
+
+int32_t PermissionRecordManager::StopUsingPermission(AccessTokenID tokenId, const std::string& permissionName)
+{
+    ActiveStatusCallbackManager::GetInstance().ExecuteCallbackAsync(
+        tokenId, permissionName, ConstantCommon::GetLocalDeviceId(), PERM_INACTIVE);
+    return Constant::SUCCESS;
+}
+
+int32_t PermissionRecordManager::RegisterPermActiveStatusCallback(
+    std::vector<std::string>& permList, const sptr<IRemoteObject>& callback)
+{
+    return ActiveStatusCallbackManager::GetInstance().AddCallback(permList, callback);
+}
+
+int32_t PermissionRecordManager::UnRegisterPermActiveStatusCallback(const sptr<IRemoteObject>& callback)
+{
+    return ActiveStatusCallbackManager::GetInstance().RemoveCallback(callback);
+}
+
+std::string PermissionRecordManager::GetDeviceId(AccessTokenID tokenId)
+{
+    HapTokenInfo tokenInfo;
+    if (AccessTokenKit::GetHapTokenInfo(tokenId, tokenInfo) != Constant::SUCCESS) {
+        return "";
+    }
+    if (tokenInfo.deviceID == DEFAULT_DEVICEID) { // local
+        return ConstantCommon::GetLocalDeviceId();
+    }
+    return tokenInfo.deviceID;
+}
+
+
+void PermissionRecordManager::Init()
+{
+    if (hasInited_) {
+        return;
+    }
+    ACCESSTOKEN_LOG_INFO(LABEL, "init");
+    deleteTaskWorker_.Start(1);
+    hasInited_ = true;
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/services/privacymanager/src/record/permission_record_repository.cpp b/services/privacymanager/src/record/permission_record_repository.cpp
index 4d2e7d08aeed75836da24c65c09b50dd838453e6..5e1eca1f7c5ea75ac012a7b9d5f698119c304145 100644
--- a/services/privacymanager/src/record/permission_record_repository.cpp
+++ b/services/privacymanager/src/record/permission_record_repository.cpp
@@ -1,112 +1,117 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "permission_record_repository.h"
-
-#include "accesstoken_log.h"
-#include "permission_used_record_db.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-namespace {
-static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
-    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "PermissionRecordRepository"
-};
-}
-
-PermissionRecordRepository& PermissionRecordRepository::GetInstance()
-{
-    static PermissionRecordRepository instance;
-    return instance;
-}
-
-PermissionRecordRepository::PermissionRecordRepository()
-{
-}
-
-PermissionRecordRepository::~PermissionRecordRepository()
-{
-}
-
-bool PermissionRecordRepository::AddRecordValues(const std::vector<GenericValues>& recordValues)
-{
-    if (PermissionUsedRecordDb::GetInstance().Add(PermissionUsedRecordDb::PERMISSION_RECORD, recordValues)
-        != PermissionUsedRecordDb::SUCCESS) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "PERMISSION_RECORD table add fail");
-        return false;
-    }
-    return true;
-}
-
-bool PermissionRecordRepository::FindRecordValues(const GenericValues& andConditionValues,
-    const GenericValues& orConditionValues, std::vector<GenericValues>& recordValues)
-{
-    if (PermissionUsedRecordDb::GetInstance().FindByConditions(PermissionUsedRecordDb::PERMISSION_RECORD,
-        andConditionValues, orConditionValues, recordValues) != PermissionUsedRecordDb::SUCCESS) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "PERMISSION_RECORD table find fail");
-        return false;
-    }
-    return true;
-}
-
-bool PermissionRecordRepository::RemoveRecordValues(const GenericValues& conditionValues)
-{
-    if (PermissionUsedRecordDb::GetInstance().Remove(PermissionUsedRecordDb::PERMISSION_RECORD, conditionValues)
-        != PermissionUsedRecordDb::SUCCESS) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "PERMISSION_RECORD table add fail");
-        return false;
-    }
-    return true;
-}
-
-bool PermissionRecordRepository::GetAllRecordValuesByKey(
-    const std::string& condition, std::vector<GenericValues>& resultValues)
-{
-    if (PermissionUsedRecordDb::GetInstance().GetDistinctValue(PermissionUsedRecordDb::PERMISSION_RECORD,
-        condition, resultValues) != PermissionUsedRecordDb::SUCCESS) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "PERMISSION_RECORD table add fail");
-        return false;
-    }
-    return true;
-}
-
-void PermissionRecordRepository::CountRecordValues(GenericValues& resultValues)
-{
-    PermissionUsedRecordDb::GetInstance().Count(PermissionUsedRecordDb::PERMISSION_RECORD, resultValues);
-}
-
-bool PermissionRecordRepository::DeleteExpireRecordsValues(const GenericValues& andConditions)
-{
-    if (PermissionUsedRecordDb::GetInstance().DeleteExpireRecords(PermissionUsedRecordDb::PERMISSION_RECORD,
-        andConditions) != PermissionUsedRecordDb::SUCCESS) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "PERMISSION_RECORD delete fail");
-        return false;
-    }
-    return true;
-}
-
-bool PermissionRecordRepository::DeleteExcessiveSizeRecordValues(uint32_t excessiveSize)
-{
-    if (PermissionUsedRecordDb::GetInstance().DeleteExcessiveRecords(PermissionUsedRecordDb::PERMISSION_RECORD,
-        excessiveSize) != PermissionUsedRecordDb::SUCCESS) {
-            ACCESSTOKEN_LOG_ERROR(LABEL, "PERMISSION_RECORD delete fail");
-            return false;
-    }
-    return true;
-}
-} // namespace AccessToken
-} // namespace Security
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "permission_record_repository.h"
+
+#include "accesstoken_log.h"
+#include "permission_used_record_db.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+namespace {
+static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
+    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "PermissionRecordRepository"
+};
+}
+
+PermissionRecordRepository& PermissionRecordRepository::GetInstance()
+{
+    static PermissionRecordRepository instance;
+    return instance;
+}
+
+PermissionRecordRepository::PermissionRecordRepository()
+{
+}
+
+PermissionRecordRepository::~PermissionRecordRepository()
+{
+}
+
+bool PermissionRecordRepository::AddRecordValues(const std::vector<GenericValues>& recordValues)
+{
+    if (PermissionUsedRecordDb::GetInstance().Add(PermissionUsedRecordDb::PERMISSION_RECORD, recordValues)
+        != PermissionUsedRecordDb::SUCCESS) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "PERMISSION_RECORD table add fail");
+        return false;
+    }
+    return true;
+}
+
+bool PermissionRecordRepository::FindRecordValues(const GenericValues& andConditionValues,
+    const GenericValues& orConditionValues, std::vector<GenericValues>& recordValues)
+{
+    if (PermissionUsedRecordDb::GetInstance().FindByConditions(PermissionUsedRecordDb::PERMISSION_RECORD,
+        andConditionValues, orConditionValues, recordValues) != PermissionUsedRecordDb::SUCCESS) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "PERMISSION_RECORD table find fail");
+        return false;
+    }
+    return true;
+}
+
+bool PermissionRecordRepository::RemoveRecordValues(const GenericValues& conditionValues)
+{
+    if (PermissionUsedRecordDb::GetInstance().Remove(PermissionUsedRecordDb::PERMISSION_RECORD, conditionValues)
+        != PermissionUsedRecordDb::SUCCESS) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "PERMISSION_RECORD table add fail");
+        return false;
+    }
+    return true;
+}
+
+bool PermissionRecordRepository::GetAllRecordValuesByKey(
+    const std::string& condition, std::vector<GenericValues>& resultValues)
+{
+    if (PermissionUsedRecordDb::GetInstance().GetDistinctValue(PermissionUsedRecordDb::PERMISSION_RECORD,
+        condition, resultValues) != PermissionUsedRecordDb::SUCCESS) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "PERMISSION_RECORD table add fail");
+        return false;
+    }
+    return true;
+}
+
+int32_t PermissionRecordRepository::CountRecordValues(GenericValues& resultValues)
+{
+    if (PermissionUsedRecordDb::GetInstance().Count(PermissionUsedRecordDb::PERMISSION_RECORD, resultValues)
+        != PermissionUsedRecordDb::SUCCESS) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Cannot count PERMISSION_RECORD");
+        return false;
+    }
+    return true;
+}
+
+bool PermissionRecordRepository::DeleteExpireRecordsValues(const GenericValues& andConditions)
+{
+    if (PermissionUsedRecordDb::GetInstance().DeleteExpireRecords(PermissionUsedRecordDb::PERMISSION_RECORD,
+        andConditions) != PermissionUsedRecordDb::SUCCESS) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "PERMISSION_RECORD delete fail");
+        return false;
+    }
+    return true;
+}
+
+bool PermissionRecordRepository::DeleteExcessiveSizeRecordValues(uint32_t excessiveSize)
+{
+    if (PermissionUsedRecordDb::GetInstance().DeleteExcessiveRecords(PermissionUsedRecordDb::PERMISSION_RECORD,
+        excessiveSize) != PermissionUsedRecordDb::SUCCESS) {
+            ACCESSTOKEN_LOG_ERROR(LABEL, "PERMISSION_RECORD delete fail");
+            return false;
+    }
+    return true;
+}
+} // namespace AccessToken
+} // namespace Security
 } // namespace OHOS
\ No newline at end of file
diff --git a/services/privacymanager/src/record/permission_used_record_cache.cpp b/services/privacymanager/src/record/permission_used_record_cache.cpp
index 038595fc592171fa11737f450703516e4776ad1e..0dba804cd6925dd94780a11ea5ca2f67c74fdb24 100644
--- a/services/privacymanager/src/record/permission_used_record_cache.cpp
+++ b/services/privacymanager/src/record/permission_used_record_cache.cpp
@@ -1,415 +1,425 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "permission_used_record_cache.h"
-#include "accesstoken_log.h"
-#include "constant.h"
-#include "field_const.h"
-#include "generic_values.h"
-#include "permission_record.h"
-#include "permission_record_manager.h"
-#include "permission_record_node.h"
-#include "permission_record_repository.h"
-#include "permission_used_record_db.h"
-#include "time_util.h"
-#include "to_string.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-namespace {
-static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
-    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "PermissionUsedRecordCache"
-};
-}
-
-PermissionUsedRecordCache& PermissionUsedRecordCache::GetInstance()
-{
-    static PermissionUsedRecordCache instance;
-    return instance;
-}
-
-void PermissionUsedRecordCache::AddRecordToBuffer(PermissionRecord& record)
-{
-    if (nextPersistTimestamp_ == 0) {
-        nextPersistTimestamp_ = record.timestamp + INTERVAL;
-    }
-    std::shared_ptr<PermissionUsedRecordNode> curFindMergePos;
-    std::shared_ptr<PermissionUsedRecordNode> persistPendingBufferHead;
-    std::shared_ptr<PermissionUsedRecordNode> persistPendingBufferEnd = nullptr;
-    {
-        Utils::UniqueWriteGuard<Utils::RWLock> lock1(this->cacheLock_);
-        curFindMergePos = curRecordBufferPos_;
-        persistPendingBufferHead = recordBufferHead_;
-        int32_t remainCount = 0;
-        while (curFindMergePos != recordBufferHead_) {
-            auto pre = curFindMergePos->pre.lock();
-            if ((record.timestamp - curFindMergePos->record.timestamp) >= INTERVAL) {
-                persistPendingBufferEnd = curFindMergePos;
-                break;
-            } else if (curFindMergePos->record.tokenId == record.tokenId &&
-                record.opCode == curFindMergePos->record.opCode &&
-                record.status == curFindMergePos->record.status &&
-                (record.timestamp - curFindMergePos->record.timestamp) <= Constant::PRECISE) {
-                MergeRecord(record, curFindMergePos);
-            } else {
-                remainCount++;
-            }
-            curFindMergePos = pre;
-        }
-        AddRecordNode(record); // refresh curRecordBUfferPos and readableSize
-        remainCount++;
-        if (persistPendingBufferEnd != nullptr) {
-            ResetRecordBuffer(remainCount, persistPendingBufferEnd);
-        }
-    }
-    if (persistPendingBufferEnd != nullptr) {
-        AddToPersistQueue(persistPendingBufferHead);
-    }
-}
-
-void PermissionUsedRecordCache::MergeRecord(PermissionRecord& record,
-    std::shared_ptr<PermissionUsedRecordNode> curFindMergePos)
-{
-    record.accessDuration += curFindMergePos->record.accessDuration;
-    record.accessCount += curFindMergePos->record.accessCount;
-    record.rejectCount += curFindMergePos->record.rejectCount;
-    if (curRecordBufferPos_ == curFindMergePos) {
-        curRecordBufferPos_ = curRecordBufferPos_->pre.lock();
-    }
-    DeleteRecordNode(curFindMergePos); // delete old same node
-    readableSize_--;
-}
-
-void PermissionUsedRecordCache::AddToPersistQueue(
-    const std::shared_ptr<PermissionUsedRecordNode> persistPendingBufferHead)
-{
-    bool startPersist = false;
-    {
-        Utils::UniqueWriteGuard<Utils::RWLock> lock2(this->cacheLock_);
-        persistPendingBufferQueue_.emplace_back(persistPendingBufferHead);
-        if ((TimeUtil::GetCurrentTimestamp() >= nextPersistTimestamp_ ||
-            readableSize_ >= MAX_PERSIST_SIZE) && persistIsRunning_ == 0) {
-            startPersist = true;
-        }
-    }
-    if (startPersist) {
-        ExecuteReadRecordBufferTask();
-    }
-}
-
-void PermissionUsedRecordCache::ExecuteReadRecordBufferTask()
-{
-    if (readRecordBufferTaskWorker_.GetCurTaskNum() > 1) {
-        ACCESSTOKEN_LOG_INFO(LABEL, "Already has read record buffer task!");
-        return;
-    }
-    auto readRecordBufferTask = [this]() {
-        ACCESSTOKEN_LOG_INFO(LABEL, "ReadRecordBuffer task called");
-        PersistPendingRecords();
-    };
-    readRecordBufferTaskWorker_.AddTask(readRecordBufferTask);
-}
-
-int32_t PermissionUsedRecordCache::PersistPendingRecords()
-{
-    std::shared_ptr<PermissionUsedRecordNode> persistPendingBufferHead;
-    bool isEmpty;
-    std::vector<GenericValues> insertValues;
-    {
-        Utils::UniqueReadGuard<Utils::RWLock> lock2(this->cacheLock_);
-        isEmpty = persistPendingBufferQueue_.empty();
-        persistIsRunning_ = 1;
-        nextPersistTimestamp_ = 0;
-    }
-    while (!isEmpty) {
-        {
-            Utils::UniqueWriteGuard<Utils::RWLock> lock2(this->cacheLock_);
-            persistPendingBufferHead = persistPendingBufferQueue_[0];
-            persistPendingBufferQueue_.erase(persistPendingBufferQueue_.begin());
-        }
-        std::shared_ptr<PermissionUsedRecordNode> curPendingRecordNode =
-            persistPendingBufferHead->next;
-        while (curPendingRecordNode != nullptr) {
-            auto next = curPendingRecordNode->next;
-            GenericValues tmpRecordValues;
-            PermissionRecord tmpRecord = curPendingRecordNode->record;
-            PermissionRecord::TranslationIntoGenericValues(tmpRecord, tmpRecordValues);
-            insertValues.emplace_back(tmpRecordValues);
-            DeleteRecordNode(curPendingRecordNode);
-            curPendingRecordNode = next;
-        }
-        if (!insertValues.empty() && !PermissionRecordRepository::GetInstance().AddRecordValues(insertValues)) {
-            ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to persist pending records");
-        }
-        ACCESSTOKEN_LOG_DEBUG(LABEL, "Persist pending records successful");
-        {
-            Utils::UniqueReadGuard<Utils::RWLock> lock2(this->cacheLock_);
-            isEmpty = persistPendingBufferQueue_.empty();
-        }
-    }
-    {
-        Utils::UniqueReadGuard<Utils::RWLock> lock2(this->cacheLock_);
-        if (isEmpty) { // free persistPendingBufferQueue
-            std::vector<std::shared_ptr<PermissionUsedRecordNode>> tmpPersistPendingBufferQueue;
-            std::swap(tmpPersistPendingBufferQueue, persistPendingBufferQueue_);
-        }
-        persistIsRunning_ = 0;
-    }
-    return true;
-}
-
-int32_t PermissionUsedRecordCache::RemoveRecords(const AccessTokenID tokenId)
-{
-    std::shared_ptr<PermissionUsedRecordNode> curFindDeletePos;
-    std::shared_ptr<PermissionUsedRecordNode> persistPendingBufferHead;
-    std::shared_ptr<PermissionUsedRecordNode> persistPendingBufferEnd = nullptr;
-    int32_t countPersistPendingNode = 0;
-    {
-        Utils::UniqueWriteGuard<Utils::RWLock> lock1(this->cacheLock_);
-        curFindDeletePos = recordBufferHead_->next;
-        persistPendingBufferHead = recordBufferHead_;
-        while (curFindDeletePos != nullptr) {
-            auto next = curFindDeletePos->next;
-            if (curFindDeletePos->record.tokenId == tokenId) {
-                if (curRecordBufferPos_ == curFindDeletePos) {
-                    curRecordBufferPos_ = curFindDeletePos->pre.lock();
-                }
-                DeleteRecordNode(curFindDeletePos);
-                readableSize_--;
-            } else if (TimeUtil::GetCurrentTimestamp() -
-                curFindDeletePos->record.timestamp >= INTERVAL) {
-                persistPendingBufferEnd = curFindDeletePos;
-                countPersistPendingNode++;
-            }
-            curFindDeletePos = next;
-        }
-        if (countPersistPendingNode != 0) { // refresh recordBufferHead
-            int32_t remainCount = readableSize_ - countPersistPendingNode;
-            ResetRecordBuffer(remainCount, persistPendingBufferEnd);
-        }
-    }
-    RemoveRecordsFromPersistPendingBufferQueue(tokenId, persistPendingBufferHead, persistPendingBufferEnd);
-    return Constant::SUCCESS;
-}
-
-void PermissionUsedRecordCache::RemoveRecordsFromPersistPendingBufferQueue(const AccessTokenID tokenId,
-    std::shared_ptr<PermissionUsedRecordNode> persistPendingBufferHead,
-    std::shared_ptr<PermissionUsedRecordNode> persistPendingBufferEnd)
-{
-    {
-        std::shared_ptr<PermissionUsedRecordNode> curFindDeletePos;
-        Utils::UniqueWriteGuard<Utils::RWLock> lock2(this->cacheLock_);
-        if (!persistPendingBufferQueue_.empty()) {
-            for (auto& persistHead : persistPendingBufferQueue_) {
-                curFindDeletePos = persistHead->next;
-                while (curFindDeletePos != nullptr) {
-                    auto next = curFindDeletePos->next;
-                    if (curFindDeletePos->record.tokenId == tokenId) {
-                        DeleteRecordNode(curFindDeletePos);
-                    }
-                    curFindDeletePos = next;
-                }
-            }
-        }
-    }
-    GenericValues record;
-    record.Put(FIELD_TOKEN_ID, (int32_t)tokenId);
-    PermissionRecordRepository::GetInstance().RemoveRecordValues(record); // remove from database
-    if (persistPendingBufferEnd != nullptr) { // add to queue
-        AddToPersistQueue(persistPendingBufferHead);
-    }
-}
-
-void PermissionUsedRecordCache::GetRecords(const std::vector<std::string>& permissionList,
-    const GenericValues& andConditionValues, const GenericValues& orConditionValues,
-    std::vector<GenericValues>& findRecordsValues)
-{
-    std::set<int32_t> opCodeList;
-    std::shared_ptr<PermissionUsedRecordNode> curFindPos;
-    std::shared_ptr<PermissionUsedRecordNode> persistPendingBufferHead;
-    std::shared_ptr<PermissionUsedRecordNode> persistPendingBufferEnd = nullptr;
-    int32_t countPersistPendingNode = 0;
-    AccessTokenID tokenId = andConditionValues.GetInt(FIELD_TOKEN_ID);
-    TransferToOpcode(opCodeList, permissionList);
-    {
-        Utils::UniqueWriteGuard<Utils::RWLock> lock1(this->cacheLock_);
-        curFindPos = recordBufferHead_->next;
-        persistPendingBufferHead = recordBufferHead_;
-        while (curFindPos != nullptr) {
-            auto next = curFindPos->next;
-            if (RecordCompare(tokenId, opCodeList, andConditionValues, curFindPos->record)) {
-                GenericValues recordValues;
-                PermissionRecord::TranslationIntoGenericValues(curFindPos->record, recordValues);
-                findRecordsValues.emplace_back(recordValues);
-            }
-            if (TimeUtil::GetCurrentTimestamp() - curFindPos->record.timestamp >= INTERVAL) {
-                persistPendingBufferEnd = curFindPos;
-                countPersistPendingNode++;
-            }
-            curFindPos = next;
-        }
-        if (countPersistPendingNode != 0) { // refresh recordBufferHead
-            int32_t remainCount = readableSize_ - countPersistPendingNode;
-            ResetRecordBuffer(remainCount, persistPendingBufferEnd);
-        }
-    }
-    GetRecordsFromPersistPendingBufferQueue(opCodeList, andConditionValues,
-        orConditionValues, findRecordsValues);
-    if (countPersistPendingNode != 0) {
-        AddToPersistQueue(persistPendingBufferHead);
-    }
-}
-
-void PermissionUsedRecordCache::GetRecordsFromPersistPendingBufferQueue(const std::set<int32_t>& opCodeList,
-    const GenericValues& andConditionValues, const GenericValues& orConditionValues,
-    std::vector<GenericValues>& findRecordsValues)
-{
-    AccessTokenID tokenId = andConditionValues.GetInt(FIELD_TOKEN_ID);
-    std::shared_ptr<PermissionUsedRecordNode> curFindPos;
-    Utils::UniqueWriteGuard<Utils::RWLock> lock2(this->cacheLock_);
-    if (!persistPendingBufferQueue_.empty()) {
-        for (auto& persistHead : persistPendingBufferQueue_) {
-            curFindPos = persistHead->next;
-            while (curFindPos != nullptr) {
-                auto next = curFindPos->next;
-                if (RecordCompare(tokenId, opCodeList, andConditionValues, curFindPos->record)) {
-                    GenericValues recordValues;
-                    PermissionRecord::TranslationIntoGenericValues(curFindPos->record, recordValues);
-                    findRecordsValues.emplace_back(recordValues);
-                }
-                curFindPos = next;
-            }
-        }
-    }
-    if (!PermissionRecordRepository::GetInstance().FindRecordValues(
-        andConditionValues, orConditionValues, findRecordsValues)) { // find records from database
-        ACCESSTOKEN_LOG_ERROR(LABEL, "find records from database failed");
-    }
-}
-
-void PermissionUsedRecordCache::ResetRecordBuffer(const int32_t remainCount,
-    std::shared_ptr<PermissionUsedRecordNode>& persistPendingBufferEnd)
-{
-    readableSize_ = remainCount;
-    // refresh recordBufferHead
-    std::shared_ptr<PermissionUsedRecordNode> tmpRecordBufferHead =
-        std::make_shared<PermissionUsedRecordNode>();
-    tmpRecordBufferHead->next = persistPendingBufferEnd->next;
-    persistPendingBufferEnd->next.reset();
-    recordBufferHead_ = tmpRecordBufferHead;
-    
-    if (persistPendingBufferEnd == curRecordBufferPos_) {
-        // persistPendingBufferEnd == curRecordBufferPos, reset curRecordBufferPos
-        curRecordBufferPos_ = recordBufferHead_;
-    } else {
-        // recordBufferHead_->next->pre = persistPendingBufferEnd, reset recordBufferHead_->next->pre
-        recordBufferHead_->next->pre = recordBufferHead_;
-    }
-}
-
-void PermissionUsedRecordCache::TransferToOpcode(std::set<int32_t>& opCodeList,
-    const std::vector<std::string>& permissionList)
-{
-    for (const auto& permission : permissionList) {
-        int32_t opCode = Constant::OP_INVALID;
-        Constant::TransferPermissionToOpcode(permission, opCode);
-        opCodeList.insert(opCode);
-    }
-}
-
-bool PermissionUsedRecordCache::RecordCompare(const AccessTokenID tokenId, const std::set<int32_t>& opCodeList,
-    const GenericValues& andConditionValues, const PermissionRecord& record)
-{
-    // compare tokenId
-    if (record.tokenId != tokenId) {
-        return false;
-    }
-    // compare opCode
-    if (!opCodeList.empty() && opCodeList.find(record.opCode) == opCodeList.end()) {
-        return false;
-    }
-    // compare timestamp
-    std::vector<std::string> andColumns = andConditionValues.GetAllKeys();
-    if (!andColumns.empty()) {
-        for (auto andColumn : andColumns) {
-            if (andColumn == FIELD_TIMESTAMP_BEGIN &&
-                record.timestamp < andConditionValues.GetInt64(andColumn)) {
-                return false;
-            } else if (andColumn == FIELD_TIMESTAMP_END &&
-                record.timestamp > andConditionValues.GetInt64(andColumn)) {
-                return false;
-            } else if (andColumn == FIELD_TIMESTAMP &&
-                record.timestamp != andConditionValues.GetInt64(andColumn)) {
-                return false;
-            }
-        }
-    }
-    return true;
-}
-
-void PermissionUsedRecordCache::FindTokenIdList(std::set<AccessTokenID>& tokenIdList)
-{
-    std::shared_ptr<PermissionUsedRecordNode> curFindPos;
-    {
-        // find tokenIdList from recordBuffer
-        Utils::UniqueWriteGuard<Utils::RWLock> lock1(this->cacheLock_);
-        curFindPos = recordBufferHead_->next;
-        while (curFindPos != nullptr) {
-            auto next = curFindPos->next;
-            tokenIdList.emplace((AccessTokenID)curFindPos->record.tokenId);
-            curFindPos = next;
-        }
-    }
-    {
-        // find tokenIdList from BufferQueue
-        Utils::UniqueWriteGuard<Utils::RWLock> lock2(this->cacheLock_);
-        if (!persistPendingBufferQueue_.empty()) {
-            for (auto persistHead : persistPendingBufferQueue_) {
-                curFindPos = persistHead->next;
-                while (curFindPos != nullptr) {
-                    auto next = curFindPos->next;
-                    tokenIdList.emplace((AccessTokenID)curFindPos->record.tokenId);
-                    curFindPos = next;
-                }
-            }
-        }
-    }
-}
-
-void PermissionUsedRecordCache::AddRecordNode(const PermissionRecord& record)
-{
-    std::shared_ptr<PermissionUsedRecordNode> tmpRecordNode = std::make_shared<PermissionUsedRecordNode>();
-    tmpRecordNode->record = record;
-    tmpRecordNode->pre = curRecordBufferPos_;
-    curRecordBufferPos_->next = tmpRecordNode;
-    curRecordBufferPos_ = curRecordBufferPos_->next;
-    readableSize_++;
-}
-
-void PermissionUsedRecordCache::DeleteRecordNode(std::shared_ptr<PermissionUsedRecordNode> deleteRecordNode)
-{
-    std::shared_ptr<PermissionUsedRecordNode> pre = deleteRecordNode->pre.lock();
-    if (deleteRecordNode->next == nullptr) { // End of the linked list
-        pre->next = nullptr;
-    } else {
-        std::shared_ptr<PermissionUsedRecordNode> next = deleteRecordNode->next;
-        pre->next = next;
-        next->pre = pre;
-    }
-}
-} // namespace AccessToken
-} // namespace Security
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "permission_used_record_cache.h"
+#include "accesstoken_log.h"
+#include "constant.h"
+#include "field_const.h"
+#include "generic_values.h"
+#include "permission_record.h"
+#include "permission_record_manager.h"
+#include "permission_record_node.h"
+#include "permission_record_repository.h"
+#include "permission_used_record_db.h"
+#include "time_util.h"
+#include "to_string.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+namespace {
+static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
+    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "PermissionUsedRecordCache"
+};
+}
+
+PermissionUsedRecordCache& PermissionUsedRecordCache::GetInstance()
+{
+    static PermissionUsedRecordCache instance;
+    return instance;
+}
+
+int32_t PermissionUsedRecordCache::AddRecordToBuffer(PermissionRecord& record)
+{
+    if (nextPersistTimestamp_ == 0) {
+        nextPersistTimestamp_ = record.timestamp + INTERVAL;
+    }
+    std::shared_ptr<PermissionUsedRecordNode> curFindMergePos;
+    std::shared_ptr<PermissionUsedRecordNode> persistPendingBufferHead;
+    std::shared_ptr<PermissionUsedRecordNode> persistPendingBufferEnd = nullptr;
+    {
+        Utils::UniqueWriteGuard<Utils::RWLock> lock1(this->cacheLock_);
+        curFindMergePos = curRecordBufferPos_;
+        persistPendingBufferHead = recordBufferHead_;
+        int32_t remainCount = 0;
+        while (curFindMergePos != recordBufferHead_) {
+            auto pre = curFindMergePos->pre.lock();
+            if ((record.timestamp - curFindMergePos->record.timestamp) >= INTERVAL) {
+                persistPendingBufferEnd = curFindMergePos;
+                break;
+            } else if (curFindMergePos->record.tokenId == record.tokenId &&
+                record.opCode == curFindMergePos->record.opCode &&
+                (record.timestamp - curFindMergePos->record.timestamp) <= Constant::PRECISE) {
+                MergeRecord(record, curFindMergePos);
+            } else {
+                remainCount++;
+            }
+            curFindMergePos = pre;
+        }
+        AddRecordNode(record); // refresh curRecordBUfferPos and readableSize
+        remainCount++;
+        if (persistPendingBufferEnd != nullptr) {
+            readableSize_ = remainCount;
+            std::shared_ptr<PermissionUsedRecordNode> tmpRecordBufferHead =
+                std::make_shared<PermissionUsedRecordNode>();
+            tmpRecordBufferHead->next = persistPendingBufferEnd->next;
+            persistPendingBufferEnd->next.reset();
+            recordBufferHead_ = tmpRecordBufferHead;
+            if (persistPendingBufferEnd == curRecordBufferPos_) { // persistPendingBufferEnd == curRecordBufferPos
+                curRecordBufferPos_ = recordBufferHead_;
+            } else { // remainCount !=0 ==> recordBufferHead->next != nullptr
+                recordBufferHead_->next->pre = recordBufferHead_;
+            }
+        }
+    }
+    if (persistPendingBufferEnd != nullptr) {
+        AddToPersistQueue(persistPendingBufferHead);
+    }
+    return Constant::SUCCESS;
+}
+
+void PermissionUsedRecordCache::MergeRecord(PermissionRecord& record,
+    std::shared_ptr<PermissionUsedRecordNode> curFindMergePos)
+{
+    record.accessDuration += curFindMergePos->record.accessDuration;
+    record.accessCount += curFindMergePos->record.accessCount;
+    record.rejectCount += curFindMergePos->record.rejectCount;
+    if (curRecordBufferPos_ == curFindMergePos) {
+        curRecordBufferPos_ = curRecordBufferPos_->pre.lock();
+    }
+    DeleteRecordNode(curFindMergePos); // delete old same node
+    readableSize_--;
+}
+
+void PermissionUsedRecordCache::AddToPersistQueue(
+    const std::shared_ptr<PermissionUsedRecordNode> persistPendingBufferHead)
+{
+    bool startPersist = false;
+    {
+        Utils::UniqueWriteGuard<Utils::RWLock> lock2(this->cacheLock_);
+        persistPendingBufferQueue_.emplace_back(persistPendingBufferHead);
+        if ((TimeUtil::GetCurrentTimestamp() >= nextPersistTimestamp_ ||
+            readableSize_ >= MAX_PERSIST_SIZE) && persistIsRunning_ == 0) {
+            startPersist = true;
+        }
+    }
+    if (startPersist) {
+        ExecuteReadRecordBufferTask();
+    }
+}
+
+void PermissionUsedRecordCache::ExecuteReadRecordBufferTask()
+{
+    if (readRecordBufferTaskWorker_.GetCurTaskNum() > 1) {
+        ACCESSTOKEN_LOG_INFO(LABEL, "Already has read record buffer task!");
+        return;
+    }
+    auto readRecordBufferTask = [this]() {
+        ACCESSTOKEN_LOG_INFO(LABEL, "ReadRecordBuffer task called");
+        PersistPendingRecords();
+    };
+    readRecordBufferTaskWorker_.AddTask(readRecordBufferTask);
+}
+
+int32_t PermissionUsedRecordCache::PersistPendingRecords()
+{
+    std::shared_ptr<PermissionUsedRecordNode> persistPendingBufferHead;
+    bool isEmpty;
+    std::vector<GenericValues> insertValues;
+    {
+        Utils::UniqueReadGuard<Utils::RWLock> lock2(this->cacheLock_);
+        isEmpty = persistPendingBufferQueue_.empty();
+        persistIsRunning_ = 1;
+        nextPersistTimestamp_ = 0;
+    }
+    while (!isEmpty) {
+        {
+            Utils::UniqueWriteGuard<Utils::RWLock> lock2(this->cacheLock_);
+            persistPendingBufferHead = persistPendingBufferQueue_[0];
+            persistPendingBufferQueue_.erase(persistPendingBufferQueue_.begin());
+        }
+        std::shared_ptr<PermissionUsedRecordNode> curPendingRecordNode =
+            persistPendingBufferHead->next;
+        while (curPendingRecordNode != nullptr) {
+            auto next = curPendingRecordNode->next;
+            GenericValues tmpRecordValues;
+            PermissionRecord tmpRecord = curPendingRecordNode->record;
+            PermissionRecord::TranslationIntoGenericValues(tmpRecord, tmpRecordValues);
+            insertValues.emplace_back(tmpRecordValues);
+            DeleteRecordNode(curPendingRecordNode);
+            curPendingRecordNode = next;
+        }
+        if (!insertValues.empty() && !PermissionRecordRepository::GetInstance().AddRecordValues(insertValues)) {
+            ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to persist pending records");
+        }
+        ACCESSTOKEN_LOG_DEBUG(LABEL, "Persist pending records successful");
+        {
+            Utils::UniqueReadGuard<Utils::RWLock> lock2(this->cacheLock_);
+            isEmpty = persistPendingBufferQueue_.empty();
+        }
+    }
+    {
+        Utils::UniqueReadGuard<Utils::RWLock> lock2(this->cacheLock_);
+        if (isEmpty) { // free persistPendingBufferQueue
+            std::vector<std::shared_ptr<PermissionUsedRecordNode>> tmpPersistPendingBufferQueue;
+            std::swap(tmpPersistPendingBufferQueue, persistPendingBufferQueue_);
+        }
+        persistIsRunning_ = 0;
+    }
+    return true;
+}
+
+int32_t PermissionUsedRecordCache::RemoveRecords(const GenericValues& record)
+{
+    AccessTokenID tokenId = record.GetInt(FIELD_TOKEN_ID);
+    std::shared_ptr<PermissionUsedRecordNode> curFindDeletePos;
+    std::shared_ptr<PermissionUsedRecordNode> persistPendingBufferHead;
+    std::shared_ptr<PermissionUsedRecordNode> persistPendingBufferEnd = nullptr;
+    int32_t countPersistPendingNode = 0;
+    {
+        Utils::UniqueWriteGuard<Utils::RWLock> lock1(this->cacheLock_);
+        curFindDeletePos = recordBufferHead_->next;
+        persistPendingBufferHead = recordBufferHead_;
+        while (curFindDeletePos != nullptr) {
+            auto next = curFindDeletePos->next;
+            if (curFindDeletePos->record.tokenId == tokenId) {
+                if (curRecordBufferPos_ == curFindDeletePos) {
+                    curRecordBufferPos_ = curFindDeletePos->pre.lock();
+                }
+                DeleteRecordNode(curFindDeletePos);
+                readableSize_--;
+            } else if (TimeUtil::GetCurrentTimestamp() -
+                curFindDeletePos->record.timestamp >= INTERVAL) {
+                persistPendingBufferEnd = curFindDeletePos;
+                countPersistPendingNode++;
+            }
+            curFindDeletePos = next;
+        }
+        if (countPersistPendingNode != 0) { // refresh recordBufferHead
+            readableSize_ -= countPersistPendingNode;
+            std::shared_ptr<PermissionUsedRecordNode> tmpRecordBufferHead =
+                std::make_shared<PermissionUsedRecordNode>();
+            tmpRecordBufferHead->next = persistPendingBufferEnd->next;
+            persistPendingBufferEnd->next.reset();
+            recordBufferHead_ = tmpRecordBufferHead;
+            recordBufferHead_->pre.reset();
+            if (persistPendingBufferEnd == curRecordBufferPos_) {
+                curRecordBufferPos_ = recordBufferHead_;
+            } else { // remainCount !=0 ==> recordBufferHead->next != nullptr
+                recordBufferHead_->next->pre = recordBufferHead_;
+            }
+        }
+    }
+    RemoveRecordsFromPersistPendingBufferQueue(record, persistPendingBufferHead, persistPendingBufferEnd);
+    return Constant::SUCCESS;
+}
+
+void PermissionUsedRecordCache::RemoveRecordsFromPersistPendingBufferQueue(const GenericValues& record,
+    std::shared_ptr<PermissionUsedRecordNode> persistPendingBufferHead,
+    std::shared_ptr<PermissionUsedRecordNode> persistPendingBufferEnd)
+{
+    AccessTokenID tokenId = record.GetInt(FIELD_TOKEN_ID);
+    {
+        std::shared_ptr<PermissionUsedRecordNode> curFindDeletePos;
+        Utils::UniqueWriteGuard<Utils::RWLock> lock2(this->cacheLock_);
+        if (!persistPendingBufferQueue_.empty()) {
+            for (auto persistHead : persistPendingBufferQueue_) {
+                curFindDeletePos = persistHead->next;
+                while (curFindDeletePos != nullptr) {
+                    auto next = curFindDeletePos->next;
+                    if (curFindDeletePos->record.tokenId == tokenId) {
+                        DeleteRecordNode(curFindDeletePos);
+                    }
+                    curFindDeletePos = next;
+                }
+            }
+        }
+        PermissionRecordRepository::GetInstance().RemoveRecordValues(record); // remove from database
+    }
+    if (persistPendingBufferEnd != nullptr) { // add to queue
+        AddToPersistQueue(persistPendingBufferHead);
+    }
+}
+
+void PermissionUsedRecordCache::GetRecords(const std::vector<std::string>& permissionList,
+    const GenericValues& andConditionValues, const GenericValues& orConditionValues,
+    std::vector<GenericValues>& findRecordsValues)
+{
+    std::set<int32_t> opCodeList;
+    std::shared_ptr<PermissionUsedRecordNode> curFindPos;
+    std::shared_ptr<PermissionUsedRecordNode> persistPendingBufferHead;
+    std::shared_ptr<PermissionUsedRecordNode> persistPendingBufferEnd = nullptr;
+    int32_t countPersistPendingNode = 0;
+    AccessTokenID tokenId = andConditionValues.GetInt(FIELD_TOKEN_ID);
+    TransferToOpcode(opCodeList, permissionList);
+    {
+        Utils::UniqueWriteGuard<Utils::RWLock> lock1(this->cacheLock_);
+        curFindPos = recordBufferHead_->next;
+        persistPendingBufferHead = recordBufferHead_;
+        while (curFindPos != nullptr) {
+            auto next = curFindPos->next;
+            if (RecordCompare(tokenId, opCodeList, andConditionValues, curFindPos->record)) {
+                GenericValues recordValues;
+                PermissionRecord::TranslationIntoGenericValues(curFindPos->record, recordValues);
+                findRecordsValues.emplace_back(recordValues);
+            }
+            if (TimeUtil::GetCurrentTimestamp() - curFindPos->record.timestamp >= INTERVAL) {
+                persistPendingBufferEnd = curFindPos;
+                countPersistPendingNode++;
+            }
+            curFindPos = next;
+        }
+        if (countPersistPendingNode != 0) { // refresh recordBufferHead
+            readableSize_ -= countPersistPendingNode;
+            std::shared_ptr<PermissionUsedRecordNode> tmpRecordBufferHead =
+                std::make_shared<PermissionUsedRecordNode>();
+            tmpRecordBufferHead->next = persistPendingBufferEnd->next;
+            persistPendingBufferEnd->next.reset();
+            recordBufferHead_ = tmpRecordBufferHead;
+            if (persistPendingBufferEnd == curRecordBufferPos_) {
+                curRecordBufferPos_ = recordBufferHead_;
+            } else { // remainCount !=0 ==> recordBufferHead->next != nullptr
+                recordBufferHead_->next->pre = recordBufferHead_;
+            }
+        }
+    }
+    GetRecordsFromPersistPendingBufferQueue(permissionList, andConditionValues,
+        orConditionValues, findRecordsValues, opCodeList);
+    if (countPersistPendingNode != 0) {
+        AddToPersistQueue(persistPendingBufferHead);
+    }
+}
+
+void PermissionUsedRecordCache::GetRecordsFromPersistPendingBufferQueue(
+    const std::vector<std::string>& permissionList, const GenericValues& andConditionValues,
+    const GenericValues& orConditionValues, std::vector<GenericValues>& findRecordsValues,
+    const std::set<int32_t>& opCodeList)
+{
+    AccessTokenID tokenId = andConditionValues.GetInt(FIELD_TOKEN_ID);
+    std::shared_ptr<PermissionUsedRecordNode> curFindPos;
+    Utils::UniqueWriteGuard<Utils::RWLock> lock2(this->cacheLock_);
+    if (!persistPendingBufferQueue_.empty()) {
+        for (auto persistHead : persistPendingBufferQueue_) {
+            curFindPos = persistHead->next;
+            while (curFindPos != nullptr) {
+                auto next = curFindPos->next;
+                if (RecordCompare(tokenId, opCodeList, andConditionValues, curFindPos->record)) {
+                    GenericValues recordValues;
+                    PermissionRecord::TranslationIntoGenericValues(curFindPos->record, recordValues);
+                    findRecordsValues.emplace_back(recordValues);
+                }
+                curFindPos = next;
+            }
+        }
+    }
+    if (tokenId != INVALID_TOKENID && !PermissionRecordRepository::GetInstance().FindRecordValues(
+        andConditionValues, orConditionValues, findRecordsValues)) { // find records from database
+        ACCESSTOKEN_LOG_ERROR(LABEL, "find records from database failed");
+    }
+}
+
+void PermissionUsedRecordCache::TransferToOpcode(std::set<int32_t>& opCodeList,
+    const std::vector<std::string>& permissionList)
+{
+    for (const auto& permission : permissionList) {
+        int32_t opCode = Constant::OP_INVALID;
+        Constant::TransferPermissionToOpcode(permission, opCode);
+        opCodeList.insert(opCode);
+    }
+}
+
+bool PermissionUsedRecordCache::RecordCompare(const AccessTokenID tokenId, const std::set<int32_t>& opCodeList,
+    const GenericValues& andConditionValues, const PermissionRecord& record)
+{
+    // compare tokenId
+    if (record.tokenId != (int32_t)tokenId) {
+        return false;
+    }
+    // compare opCode
+    if (!opCodeList.empty() && opCodeList.find(record.opCode) == opCodeList.end()) {
+        return false;
+    }
+    // compare timestamp
+    std::vector<std::string> andColumns = andConditionValues.GetAllKeys();
+    if (!andColumns.empty()) {
+        for (auto andColumn : andColumns) {
+            if (andColumn == FIELD_TIMESTAMP_BEGIN &&
+                record.timestamp < andConditionValues.GetInt64(andColumn)) {
+                return false;
+            } else if (andColumn == FIELD_TIMESTAMP_END &&
+                record.timestamp > andConditionValues.GetInt64(andColumn)) {
+                return false;
+            } else if (andColumn == FIELD_TIMESTAMP &&
+                record.timestamp != andConditionValues.GetInt64(andColumn)) {
+                return false;
+            }
+        }
+    }
+    return true;
+}
+
+void PermissionUsedRecordCache::FindTokenIdList(std::set<AccessTokenID>& tokenIdList)
+{
+    std::shared_ptr<PermissionUsedRecordNode> curFindPos;
+    {
+        // find tokenIdList from recordBuffer
+        Utils::UniqueWriteGuard<Utils::RWLock> lock1(this->cacheLock_);
+        curFindPos = recordBufferHead_->next;
+        while (curFindPos != nullptr) {
+            auto next = curFindPos->next;
+            tokenIdList.emplace((AccessTokenID)curFindPos->record.tokenId);
+            curFindPos = next;
+        }
+    }
+    {
+        // find tokenIdList from BufferQueue
+        Utils::UniqueWriteGuard<Utils::RWLock> lock2(this->cacheLock_);
+        if (!persistPendingBufferQueue_.empty()) {
+            for (auto persistHead : persistPendingBufferQueue_) {
+                curFindPos = persistHead->next;
+                while (curFindPos != nullptr) {
+                    auto next = curFindPos->next;
+                    tokenIdList.emplace((AccessTokenID)curFindPos->record.tokenId);
+                    curFindPos = next;
+                }
+            }
+        }
+    }
+}
+
+void PermissionUsedRecordCache::AddRecordNode(const PermissionRecord& record)
+{
+    std::shared_ptr<PermissionUsedRecordNode> tmpRecordNode = std::make_shared<PermissionUsedRecordNode>();
+    tmpRecordNode->record = record;
+    tmpRecordNode->pre = curRecordBufferPos_;
+    curRecordBufferPos_->next = tmpRecordNode;
+    curRecordBufferPos_ = curRecordBufferPos_->next;
+    readableSize_++;
+}
+
+void PermissionUsedRecordCache::DeleteRecordNode(std::shared_ptr<PermissionUsedRecordNode> deleteRecordNode)
+{
+    std::shared_ptr<PermissionUsedRecordNode> pre = deleteRecordNode->pre.lock();
+    if (deleteRecordNode->next == nullptr) { // End of the linked list
+        pre->next = nullptr;
+    } else {
+        std::shared_ptr<PermissionUsedRecordNode> next = deleteRecordNode->next;
+        pre->next = next;
+        next->pre = pre;
+    }
+}
+} // namespace AccessToken
+} // namespace Security
 } // namespace OHOS
\ No newline at end of file
diff --git a/services/privacymanager/src/service/privacy_manager_service.cpp b/services/privacymanager/src/service/privacy_manager_service.cpp
index 41e1087e1458ec3d3c26dbbd9bd694b996245052..9651bf413493694e893c889f2349de7aa44a92a1 100644
--- a/services/privacymanager/src/service/privacy_manager_service.cpp
+++ b/services/privacymanager/src/service/privacy_manager_service.cpp
@@ -1,133 +1,138 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "privacy_manager_service.h"
-
-#include "accesstoken_log.h"
-#include "constant_common.h"
-#include "constant.h"
-#include "ipc_skeleton.h"
-#include "permission_record_manager.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-namespace {
-static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
-    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "PrivacyManagerService"
-};
-}
-
-const bool REGISTER_RESULT =
-    SystemAbility::MakeAndRegisterAbility(DelayedSingleton<PrivacyManagerService>::GetInstance().get());
-
-PrivacyManagerService::PrivacyManagerService()
-    : SystemAbility(SA_ID_PRIVACY_MANAGER_SERVICE, true), state_(ServiceRunningState::STATE_NOT_START)
-{
-    ACCESSTOKEN_LOG_INFO(LABEL, "PrivacyManagerService()");
-}
-
-PrivacyManagerService::~PrivacyManagerService()
-{
-    ACCESSTOKEN_LOG_INFO(LABEL, "~PrivacyManagerService()");
-}
-
-void PrivacyManagerService::OnStart()
-{
-    if (state_ == ServiceRunningState::STATE_RUNNING) {
-        ACCESSTOKEN_LOG_INFO(LABEL, "PrivacyManagerService has already started!");
-        return;
-    }
-    if (!Initialize()) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to initialize");
-        return;
-    }
-    state_ = ServiceRunningState::STATE_RUNNING;
-    bool ret = Publish(DelayedSingleton<PrivacyManagerService>::GetInstance().get());
-    if (!ret) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to publish service!");
-        return;
-    }
-    ACCESSTOKEN_LOG_INFO(LABEL, "Congratulations, PrivacyManagerService start successfully!");
-}
-
-void PrivacyManagerService::OnStop()
-{
-    ACCESSTOKEN_LOG_INFO(LABEL, "stop service");
-    state_ = ServiceRunningState::STATE_NOT_START;
-}
-
-int32_t PrivacyManagerService::AddPermissionUsedRecord(
-    AccessTokenID tokenId, const std::string& permissionName, int32_t successCount, int32_t failCount)
-{
-    return PermissionRecordManager::GetInstance().AddPermissionUsedRecord(
-        tokenId, permissionName, successCount, failCount);
-}
-
-int32_t PrivacyManagerService::StartUsingPermission(AccessTokenID tokenId, const std::string& permissionName)
-{
-    return PermissionRecordManager::GetInstance().StartUsingPermission(tokenId, permissionName);
-}
-
-int32_t PrivacyManagerService::StopUsingPermission(AccessTokenID tokenId, const std::string& permissionName)
-{
-    return PermissionRecordManager::GetInstance().StopUsingPermission(tokenId, permissionName);
-}
-
-int32_t PrivacyManagerService::RemovePermissionUsedRecords(AccessTokenID tokenId, const std::string& deviceID)
-{
-    PermissionRecordManager::GetInstance().RemovePermissionUsedRecords(tokenId, deviceID);
-    return Constant::SUCCESS;
-}
-
-int32_t PrivacyManagerService::GetPermissionUsedRecords(
-    const PermissionUsedRequestParcel& request, PermissionUsedResultParcel& result)
-{
-    PermissionUsedResult permissionRecord;
-    int32_t ret =  PermissionRecordManager::GetInstance().GetPermissionUsedRecords(request.request, permissionRecord);
-    result.result = permissionRecord;
-    return ret;
-}
-
-int32_t PrivacyManagerService::GetPermissionUsedRecords(
-    const PermissionUsedRequestParcel& request, const sptr<OnPermissionUsedRecordCallback>& callback)
-{
-    return PermissionRecordManager::GetInstance().GetPermissionUsedRecordsAsync(request.request, callback);
-}
-
-std::string PrivacyManagerService::DumpRecordInfo(AccessTokenID tokenId, const std::string& permissionName)
-{
-    return PermissionRecordManager::GetInstance().DumpRecordInfo(tokenId, permissionName);
-}
-
-int32_t PrivacyManagerService::RegisterPermActiveStatusCallback(
-    std::vector<std::string>& permList, const sptr<IRemoteObject>& callback)
-{
-    return PermissionRecordManager::GetInstance().RegisterPermActiveStatusCallback(permList, callback);
-}
-
-int32_t PrivacyManagerService::UnRegisterPermActiveStatusCallback(const sptr<IRemoteObject>& callback)
-{
-    return PermissionRecordManager::GetInstance().UnRegisterPermActiveStatusCallback(callback);
-}
-
-bool PrivacyManagerService::Initialize() const
-{
-    PermissionRecordManager::GetInstance().Init();
-    return true;
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "privacy_manager_service.h"
+
+#include "accesstoken_log.h"
+#include "constant_common.h"
+#include "constant.h"
+#include "ipc_skeleton.h"
+#include "permission_record_manager.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+namespace {
+static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
+    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "PrivacyManagerService"
+};
+}
+
+const bool REGISTER_RESULT =
+    SystemAbility::MakeAndRegisterAbility(DelayedSingleton<PrivacyManagerService>::GetInstance().get());
+
+PrivacyManagerService::PrivacyManagerService()
+    : SystemAbility(SA_ID_PRIVACY_MANAGER_SERVICE, true), state_(ServiceRunningState::STATE_NOT_START)
+{
+    ACCESSTOKEN_LOG_INFO(LABEL, "PrivacyManagerService()");
+}
+
+PrivacyManagerService::~PrivacyManagerService()
+{
+    ACCESSTOKEN_LOG_INFO(LABEL, "~PrivacyManagerService()");
+}
+
+void PrivacyManagerService::OnStart()
+{
+    if (state_ == ServiceRunningState::STATE_RUNNING) {
+        ACCESSTOKEN_LOG_INFO(LABEL, "PrivacyManagerService has already started!");
+        return;
+    }
+    if (!Initialize()) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to initialize");
+        return;
+    }
+    state_ = ServiceRunningState::STATE_RUNNING;
+    bool ret = Publish(DelayedSingleton<PrivacyManagerService>::GetInstance().get());
+    if (!ret) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "Failed to publish service!");
+        return;
+    }
+    ACCESSTOKEN_LOG_INFO(LABEL, "Congratulations, PrivacyManagerService start successfully!");
+}
+
+void PrivacyManagerService::OnStop()
+{
+    ACCESSTOKEN_LOG_INFO(LABEL, "stop service");
+    state_ = ServiceRunningState::STATE_NOT_START;
+}
+
+int32_t PrivacyManagerService::AddPermissionUsedRecord(
+    AccessTokenID tokenId, const std::string& permissionName, int32_t successCount, int32_t failCount)
+{
+    return PermissionRecordManager::GetInstance().AddPermissionUsedRecord(
+        tokenId, permissionName, successCount, failCount);
+}
+
+int32_t PrivacyManagerService::StartUsingPermission(AccessTokenID tokenId, const std::string& permissionName)
+{
+    return PermissionRecordManager::GetInstance().StartUsingPermission(tokenId, permissionName);
+}
+
+int32_t PrivacyManagerService::StopUsingPermission(AccessTokenID tokenId, const std::string& permissionName)
+{
+    return PermissionRecordManager::GetInstance().StopUsingPermission(tokenId, permissionName);
+}
+
+int32_t PrivacyManagerService::RemovePermissionUsedRecords(AccessTokenID tokenId, const std::string& deviceID)
+{
+    PermissionRecordManager::GetInstance().RemovePermissionUsedRecords(tokenId, deviceID);
+    return Constant::SUCCESS;
+}
+
+int32_t PrivacyManagerService::GetPermissionUsedRecords(
+    const PermissionUsedRequestParcel& request, PermissionUsedResultParcel& result)
+{
+    PermissionUsedResult permissionRecord;
+    int32_t ret =  PermissionRecordManager::GetInstance().GetPermissionUsedRecords(request.request, permissionRecord);
+    result.result = permissionRecord;
+    return ret;
+}
+
+int32_t PrivacyManagerService::GetPermissionUsedRecords(
+    const PermissionUsedRequestParcel& request, const sptr<OnPermissionUsedRecordCallback>& callback)
+{
+    return PermissionRecordManager::GetInstance().GetPermissionUsedRecordsAsync(request.request, callback);
+}
+
+std::string PrivacyManagerService::DumpRecordInfo(AccessTokenID tokenId, const std::string& permissionName)
+{
+    return PermissionRecordManager::GetInstance().DumpRecordInfo(tokenId, permissionName);
+}
+
+int32_t PrivacyManagerService::RegisterPermActiveStatusCallback(
+    std::vector<std::string>& permList, const sptr<IRemoteObject>& callback)
+{
+    return PermissionRecordManager::GetInstance().RegisterPermActiveStatusCallback(permList, callback);
+}
+
+int32_t PrivacyManagerService::UnRegisterPermActiveStatusCallback(const sptr<IRemoteObject>& callback)
+{
+    return PermissionRecordManager::GetInstance().UnRegisterPermActiveStatusCallback(callback);
+}
+
+bool PrivacyManagerService::IsAllowUsingPermission(AccessTokenID tokenId, const std::string& permissionName)
+{
+    return false;
+}
+
+bool PrivacyManagerService::Initialize() const
+{
+    PermissionRecordManager::GetInstance().Init();
+    return true;
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/services/privacymanager/src/service/privacy_manager_stub.cpp b/services/privacymanager/src/service/privacy_manager_stub.cpp
index 743cd11b595da3882498a7de7ab982255fa3e278..618d291fa6da18487c40a642f114eb328b7cd459 100644
--- a/services/privacymanager/src/service/privacy_manager_stub.cpp
+++ b/services/privacymanager/src/service/privacy_manager_stub.cpp
@@ -1,211 +1,223 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "privacy_manager_stub.h"
-
-#include "accesstoken_kit.h"
-#include "accesstoken_log.h"
-
-#include "ipc_skeleton.h"
-#include "string_ex.h"
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-namespace {
-static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
-    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "PrivacyManagerStub"
-};
-static const uint32_t PERM_LIST_SIZE_MAX = 1024;
-}
-
-int32_t PrivacyManagerStub::OnRemoteRequest(
-    uint32_t code, MessageParcel& data, MessageParcel& reply, MessageOption& option)
-{
-    std::u16string descriptor = data.ReadInterfaceToken();
-    if (descriptor != IPrivacyManager::GetDescriptor()) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "get unexpect descriptor: %{public}s", Str16ToStr8(descriptor).c_str());
-        return -1;
-    }
-    switch (code) {
-        case static_cast<uint32_t>(IPrivacyManager::InterfaceCode::ADD_PERMISSION_USED_RECORD):
-            AddPermissionUsedRecordInner(data, reply);
-            break;
-        case static_cast<uint32_t>(IPrivacyManager::InterfaceCode::START_USING_PERMISSION):
-            StartUsingPermissionInner(data, reply);
-            break;
-        case static_cast<uint32_t>(IPrivacyManager::InterfaceCode::STOP_USING_PERMISSION):
-            StopUsingPermissionInner(data, reply);
-            break;
-        case static_cast<uint32_t>(IPrivacyManager::InterfaceCode::DELETE_PERMISSION_USED_RECORDS):
-            RemovePermissionUsedRecordsInner(data, reply);
-            break;
-        case static_cast<uint32_t>(IPrivacyManager::InterfaceCode::GET_PERMISSION_USED_RECORDS):
-            GetPermissionUsedRecordsInner(data, reply);
-            break;
-        case static_cast<uint32_t>(IPrivacyManager::InterfaceCode::GET_PERMISSION_USED_RECORDS_ASYNC):
-            GetPermissionUsedRecordsAsyncInner(data, reply);
-            break;
-        case static_cast<uint32_t>(IPrivacyManager::InterfaceCode::DUMP_RECORD_INFO):
-            DumpRecordInfoInner(data, reply);
-            break;
-        case static_cast<uint32_t>(IPrivacyManager::InterfaceCode::REGISTER_PERM_ACTIVE_STATUS_CHANGE_CALLBACK):
-            RegisterPermActiveStatusCallbackInner(data, reply);
-            break;
-        case static_cast<uint32_t>(IPrivacyManager::InterfaceCode::UNREGISTER_PERM_ACTIVE_STATUS_CHANGE_CALLBACK):
-            UnRegisterPermActiveStatusCallbackInner(data, reply);
-            break;
-        default:
-            return IPCObjectStub::OnRemoteRequest(code, data, reply, option);
-    }
-    return NO_ERROR;
-}
-
-void PrivacyManagerStub::AddPermissionUsedRecordInner(MessageParcel& data, MessageParcel& reply)
-{
-    uint32_t callingTokenID = IPCSkeleton::GetCallingTokenID();
-    if (AccessTokenKit::VerifyAccessToken(
-        callingTokenID, "ohos.permission.PERMISSION_USED_STATS") == PERMISSION_DENIED) {
-        ACCESSTOKEN_LOG_INFO(LABEL, "permission denied");
-        reply.WriteInt32(RET_FAILED);
-        return;
-    }
-    AccessTokenID tokenId = data.ReadUint32();
-    std::string permissionName = data.ReadString();
-    int32_t successCount = data.ReadInt32();
-    int32_t failCount = data.ReadInt32();
-    int32_t result = this->AddPermissionUsedRecord(tokenId, permissionName, successCount, failCount);
-    reply.WriteInt32(result);
-}
-
-void PrivacyManagerStub::StartUsingPermissionInner(MessageParcel& data, MessageParcel& reply)
-{
-    AccessTokenID tokenId = data.ReadUint32();
-    std::string permissionName = data.ReadString();
-    int32_t result = this->StartUsingPermission(tokenId, permissionName);
-    reply.WriteInt32(result);
-}
-
-void PrivacyManagerStub::StopUsingPermissionInner(MessageParcel& data, MessageParcel& reply)
-{
-    AccessTokenID tokenId = data.ReadUint32();
-    std::string permissionName = data.ReadString();
-    int32_t result = this->StopUsingPermission(tokenId, permissionName);
-    reply.WriteInt32(result);
-}
-
-void PrivacyManagerStub::RemovePermissionUsedRecordsInner(MessageParcel& data, MessageParcel& reply)
-{
-    uint32_t callingTokenID = IPCSkeleton::GetCallingTokenID();
-    if (!IsAccessTokenCalling() && AccessTokenKit::VerifyAccessToken(
-        callingTokenID, "ohos.permission.PERMISSION_USED_STATS") == PERMISSION_DENIED) {
-        ACCESSTOKEN_LOG_INFO(LABEL, "permission denied");
-        reply.WriteInt32(RET_FAILED);
-        return;
-    }
-    AccessTokenID tokenId = data.ReadUint32();
-    std::string deviceID = data.ReadString();
-    int32_t result = this->RemovePermissionUsedRecords(tokenId, deviceID);
-    reply.WriteInt32(result);
-}
-
-void PrivacyManagerStub::GetPermissionUsedRecordsInner(MessageParcel& data, MessageParcel& reply)
-{
-    PermissionUsedResultParcel responseParcel;
-    uint32_t callingTokenID = IPCSkeleton::GetCallingTokenID();
-    if (AccessTokenKit::VerifyAccessToken(
-        callingTokenID, "ohos.permission.PERMISSION_USED_STATS") == PERMISSION_DENIED) {
-        ACCESSTOKEN_LOG_INFO(LABEL, "permission denied");
-        reply.WriteParcelable(&responseParcel);
-        reply.WriteInt32(RET_FAILED);
-        return;
-    }
-    sptr<PermissionUsedRequestParcel> requestParcel = data.ReadParcelable<PermissionUsedRequestParcel>();
-    if (requestParcel == nullptr) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "ReadParcelable faild");
-        reply.WriteParcelable(&responseParcel);
-        reply.WriteInt32(RET_FAILED);
-        return;
-    }
-    int32_t result = this->GetPermissionUsedRecords(*requestParcel, responseParcel);
-    reply.WriteParcelable(&responseParcel);
-    reply.WriteInt32(result);
-}
-
-void PrivacyManagerStub::GetPermissionUsedRecordsAsyncInner(MessageParcel& data, MessageParcel& reply)
-{
-    sptr<PermissionUsedRequestParcel> requestParcel = data.ReadParcelable<PermissionUsedRequestParcel>();
-    if (requestParcel == nullptr) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "ReadParcelable faild");
-        reply.WriteInt32(RET_FAILED);
-        return;
-    }
-    sptr<OnPermissionUsedRecordCallback> callback = iface_cast<OnPermissionUsedRecordCallback>(data.ReadRemoteObject());
-    int32_t result = this->GetPermissionUsedRecords(*requestParcel, callback);
-    reply.WriteInt32(result);
-}
-
-void PrivacyManagerStub::DumpRecordInfoInner(MessageParcel& data, MessageParcel& reply)
-{
-    AccessTokenID tokenId = data.ReadUint32();
-    std::string permissionName = data.ReadString();
-    std::string dumpInfo = this->DumpRecordInfo(tokenId, permissionName);
-    reply.WriteString(dumpInfo);
-}
-
-void PrivacyManagerStub::RegisterPermActiveStatusCallbackInner(MessageParcel& data, MessageParcel& reply)
-{
-    uint32_t permListSize = data.ReadUint32();
-    if (permListSize > PERM_LIST_SIZE_MAX) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "read permListSize fail");
-        reply.WriteInt32(RET_FAILED);
-        return;
-    }
-    std::vector<std::string> permList;
-    for (uint32_t i = 0; i < permListSize; i++) {
-        std::string perm = data.ReadString();
-        permList.emplace_back(perm);
-    }
-    sptr<IRemoteObject> callback = data.ReadRemoteObject();
-    if (callback == nullptr) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "read ReadRemoteObject fail");
-        reply.WriteInt32(RET_FAILED);
-        return;
-    }
-    int32_t result = this->RegisterPermActiveStatusCallback(permList, callback);
-    reply.WriteInt32(result);
-}
-
-void PrivacyManagerStub::UnRegisterPermActiveStatusCallbackInner(MessageParcel& data, MessageParcel& reply)
-{
-    sptr<IRemoteObject> callback = data.ReadRemoteObject();
-    if (callback == nullptr) {
-        ACCESSTOKEN_LOG_ERROR(LABEL, "read scopeParcel fail");
-        reply.WriteInt32(RET_FAILED);
-        return;
-    }
-
-    int32_t result = this->UnRegisterPermActiveStatusCallback(callback);
-    reply.WriteInt32(result);
-}
-
-bool PrivacyManagerStub::IsAccessTokenCalling() const
-{
-    int32_t callingUid = IPCSkeleton::GetCallingUid();
-    return callingUid == ACCESSTOKEN_UID;
-}
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "privacy_manager_stub.h"
+
+#include "accesstoken_kit.h"
+#include "accesstoken_log.h"
+
+#include "ipc_skeleton.h"
+#include "string_ex.h"
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+namespace {
+static constexpr OHOS::HiviewDFX::HiLogLabel LABEL = {
+    LOG_CORE, SECURITY_DOMAIN_PRIVACY, "PrivacyManagerStub"
+};
+static const uint32_t PERM_LIST_SIZE_MAX = 1024;
+}
+
+int32_t PrivacyManagerStub::OnRemoteRequest(
+    uint32_t code, MessageParcel& data, MessageParcel& reply, MessageOption& option)
+{
+    std::u16string descriptor = data.ReadInterfaceToken();
+    if (descriptor != IPrivacyManager::GetDescriptor()) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "get unexpect descriptor: %{public}s", Str16ToStr8(descriptor).c_str());
+        return -1;
+    }
+    switch (code) {
+        case static_cast<uint32_t>(IPrivacyManager::InterfaceCode::ADD_PERMISSION_USED_RECORD):
+            AddPermissionUsedRecordInner(data, reply);
+            break;
+        case static_cast<uint32_t>(IPrivacyManager::InterfaceCode::START_USING_PERMISSION):
+            StartUsingPermissionInner(data, reply);
+            break;
+        case static_cast<uint32_t>(IPrivacyManager::InterfaceCode::STOP_USING_PERMISSION):
+            StopUsingPermissionInner(data, reply);
+            break;
+        case static_cast<uint32_t>(IPrivacyManager::InterfaceCode::DELETE_PERMISSION_USED_RECORDS):
+            RemovePermissionUsedRecordsInner(data, reply);
+            break;
+        case static_cast<uint32_t>(IPrivacyManager::InterfaceCode::GET_PERMISSION_USED_RECORDS):
+            GetPermissionUsedRecordsInner(data, reply);
+            break;
+        case static_cast<uint32_t>(IPrivacyManager::InterfaceCode::GET_PERMISSION_USED_RECORDS_ASYNC):
+            GetPermissionUsedRecordsAsyncInner(data, reply);
+            break;
+        case static_cast<uint32_t>(IPrivacyManager::InterfaceCode::DUMP_RECORD_INFO):
+            DumpRecordInfoInner(data, reply);
+            break;
+        case static_cast<uint32_t>(IPrivacyManager::InterfaceCode::REGISTER_PERM_ACTIVE_STATUS_CHANGE_CALLBACK):
+            RegisterPermActiveStatusCallbackInner(data, reply);
+            break;
+        case static_cast<uint32_t>(IPrivacyManager::InterfaceCode::UNREGISTER_PERM_ACTIVE_STATUS_CHANGE_CALLBACK):
+            UnRegisterPermActiveStatusCallbackInner(data, reply);
+            break;
+        case static_cast<uint32_t>(IPrivacyManager::InterfaceCode::IS_ALLOW_USING_PERMISSION):
+            IsAllowUsingPermissionInner(data, reply);
+            break;
+        default:
+            return IPCObjectStub::OnRemoteRequest(code, data, reply, option);
+    }
+    return NO_ERROR;
+}
+
+void PrivacyManagerStub::AddPermissionUsedRecordInner(MessageParcel& data, MessageParcel& reply)
+{
+    uint32_t callingTokenID = IPCSkeleton::GetCallingTokenID();
+    if (AccessTokenKit::VerifyAccessToken(
+        callingTokenID, "ohos.permission.PERMISSION_USED_STATS") == PERMISSION_DENIED) {
+        ACCESSTOKEN_LOG_INFO(LABEL, "permission denied");
+        reply.WriteInt32(RET_FAILED);
+        return;
+    }
+    AccessTokenID tokenId = data.ReadUint32();
+    std::string permissionName = data.ReadString();
+    int32_t successCount = data.ReadInt32();
+    int32_t failCount = data.ReadInt32();
+    int32_t result = this->AddPermissionUsedRecord(tokenId, permissionName, successCount, failCount);
+    reply.WriteInt32(result);
+}
+
+void PrivacyManagerStub::StartUsingPermissionInner(MessageParcel& data, MessageParcel& reply)
+{
+    AccessTokenID tokenId = data.ReadUint32();
+    std::string permissionName = data.ReadString();
+    int32_t result = this->StartUsingPermission(tokenId, permissionName);
+    reply.WriteInt32(result);
+}
+
+void PrivacyManagerStub::StopUsingPermissionInner(MessageParcel& data, MessageParcel& reply)
+{
+    AccessTokenID tokenId = data.ReadUint32();
+    std::string permissionName = data.ReadString();
+    int32_t result = this->StopUsingPermission(tokenId, permissionName);
+    reply.WriteInt32(result);
+}
+
+void PrivacyManagerStub::RemovePermissionUsedRecordsInner(MessageParcel& data, MessageParcel& reply)
+{
+    uint32_t callingTokenID = IPCSkeleton::GetCallingTokenID();
+    if (!IsAccessTokenCalling() && AccessTokenKit::VerifyAccessToken(
+        callingTokenID, "ohos.permission.PERMISSION_USED_STATS") == PERMISSION_DENIED) {
+        ACCESSTOKEN_LOG_INFO(LABEL, "permission denied");
+        reply.WriteInt32(RET_FAILED);
+        return;
+    }
+    AccessTokenID tokenId = data.ReadUint32();
+    std::string deviceID = data.ReadString();
+    int32_t result = this->RemovePermissionUsedRecords(tokenId, deviceID);
+    reply.WriteInt32(result);
+}
+
+void PrivacyManagerStub::GetPermissionUsedRecordsInner(MessageParcel& data, MessageParcel& reply)
+{
+    PermissionUsedResultParcel responseParcel;
+    uint32_t callingTokenID = IPCSkeleton::GetCallingTokenID();
+    if (AccessTokenKit::VerifyAccessToken(
+        callingTokenID, "ohos.permission.PERMISSION_USED_STATS") == PERMISSION_DENIED) {
+        ACCESSTOKEN_LOG_INFO(LABEL, "permission denied");
+        reply.WriteParcelable(&responseParcel);
+        reply.WriteInt32(RET_FAILED);
+        return;
+    }
+    sptr<PermissionUsedRequestParcel> requestParcel = data.ReadParcelable<PermissionUsedRequestParcel>();
+    if (requestParcel == nullptr) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "ReadParcelable faild");
+        reply.WriteParcelable(&responseParcel);
+        reply.WriteInt32(RET_FAILED);
+        return;
+    }
+    int32_t result = this->GetPermissionUsedRecords(*requestParcel, responseParcel);
+    reply.WriteParcelable(&responseParcel);
+    reply.WriteInt32(result);
+}
+
+void PrivacyManagerStub::GetPermissionUsedRecordsAsyncInner(MessageParcel& data, MessageParcel& reply)
+{
+    sptr<PermissionUsedRequestParcel> requestParcel = data.ReadParcelable<PermissionUsedRequestParcel>();
+    if (requestParcel == nullptr) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "ReadParcelable faild");
+        reply.WriteInt32(RET_FAILED);
+        return;
+    }
+    sptr<OnPermissionUsedRecordCallback> callback = iface_cast<OnPermissionUsedRecordCallback>(data.ReadRemoteObject());
+    int32_t result = this->GetPermissionUsedRecords(*requestParcel, callback);
+    reply.WriteInt32(result);
+}
+
+void PrivacyManagerStub::DumpRecordInfoInner(MessageParcel& data, MessageParcel& reply)
+{
+    AccessTokenID tokenId = data.ReadUint32();
+    std::string permissionName = data.ReadString();
+    std::string dumpInfo = this->DumpRecordInfo(tokenId, permissionName);
+    reply.WriteString(dumpInfo);
+}
+
+void PrivacyManagerStub::RegisterPermActiveStatusCallbackInner(MessageParcel& data, MessageParcel& reply)
+{
+    uint32_t permListSize = data.ReadUint32();
+    if (permListSize > PERM_LIST_SIZE_MAX) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "read permListSize fail");
+        reply.WriteInt32(RET_FAILED);
+        return;
+    }
+    std::vector<std::string> permList;
+    for (uint32_t i = 0; i < permListSize; i++) {
+        std::string perm = data.ReadString();
+        permList.emplace_back(perm);
+    }
+    sptr<IRemoteObject> callback = data.ReadRemoteObject();
+    if (callback == nullptr) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "read ReadRemoteObject fail");
+        reply.WriteInt32(RET_FAILED);
+        return;
+    }
+    int32_t result = this->RegisterPermActiveStatusCallback(permList, callback);
+    reply.WriteInt32(result);
+}
+
+void PrivacyManagerStub::UnRegisterPermActiveStatusCallbackInner(MessageParcel& data, MessageParcel& reply)
+{
+    sptr<IRemoteObject> callback = data.ReadRemoteObject();
+    if (callback == nullptr) {
+        ACCESSTOKEN_LOG_ERROR(LABEL, "read scopeParcel fail");
+        reply.WriteInt32(RET_FAILED);
+        return;
+    }
+
+    int32_t result = this->UnRegisterPermActiveStatusCallback(callback);
+    reply.WriteInt32(result);
+}
+
+void PrivacyManagerStub::IsAllowUsingPermissionInner(MessageParcel& data, MessageParcel& reply)
+{
+    AccessTokenID tokenId = data.ReadUint32();
+    std::string permissionName = data.ReadString();
+    bool allowperInfo = this->IsAllowUsingPermission(tokenId, permissionName);
+    reply.WriteBool(allowperInfo);
+}
+
+
+bool PrivacyManagerStub::IsAccessTokenCalling() const
+{
+    int32_t callingUid = IPCSkeleton::GetCallingUid();
+    return callingUid == ACCESSTOKEN_UID;
+}
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
diff --git a/services/privacymanager/test/add_permission_used_record_test/add_permission_used_record_test.cpp b/services/privacymanager/test/add_permission_used_record_test/add_permission_used_record_test.cpp
index c139fe2ab0b812c572b4d82ed44d9f84a68c0956..41c953308e77afe1f0c90e0b76b63e677dda4af3 100644
--- a/services/privacymanager/test/add_permission_used_record_test/add_permission_used_record_test.cpp
+++ b/services/privacymanager/test/add_permission_used_record_test/add_permission_used_record_test.cpp
@@ -1,55 +1,55 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#include "add_permission_used_record_test.h"
-
-using namespace testing::ext;
-using namespace OHOS::Security::AccessToken;
-
-void AddPermissionUsedRecordTest::SetUpTestCase()
-{}
-
-void AddPermissionUsedRecordTest::TearDownTestCase()
-{
-}
-
-void AddPermissionUsedRecordTest::SetUp()
-{
-}
-
-void AddPermissionUsedRecordTest::TearDown()
-{
-}
-
-/**
- * @tc.name: AddPermissionUsedRecord_001
- * @tc.desc: cannot AddPermissionUsedRecord with invalid tokenID and permission.
- * @tc.type: FUNC
- * @tc.require:AR000GK6TD=====
- */
-HWTEST_F(AddPermissionUsedRecordTest, AddPermissionUsedRecord_001, TestSize.Level1)
-{
-    int32_t successCount = 1;
-    int32_t fasilCount = 0;
-    std::string permission = "ohon.permission.READ_CONTACTS";
-    AccessTokenID tokenID = AccessTokenKit::GetHapTokenID(g_InfoParmsA.userID,
-                                                          g_InfoParmsA.bundleName,
-                                                          g_InfoParmsA.instIndex);
-    int32_t ret = PrivacyKit::AddPermissionUsedRecord(0, permission, successCount, fasilCount);
-    ASSERT_EQ(RET_FAILED, ret);
-
-    ret = PrivacyKit::AddPermissionUsedRecord(tokenID, "", successCount, fasilCount);
-    ASSERT_EQ(RET_FAILED, ret);
-}
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#include "add_permission_used_record_test.h"
+
+using namespace testing::ext;
+using namespace OHOS::Security::AccessToken;
+
+void AddPermissionUsedRecordTest::SetUpTestCase()
+{}
+
+void AddPermissionUsedRecordTest::TearDownTestCase()
+{
+}
+
+void AddPermissionUsedRecordTest::SetUp()
+{
+}
+
+void AddPermissionUsedRecordTest::TearDown()
+{
+}
+
+/**
+ * @tc.name: AddPermissionUsedRecord_001
+ * @tc.desc: cannot AddPermissionUsedRecord with invalid tokenID and permission.
+ * @tc.type: FUNC
+ * @tc.require:AR000GK6TD=====
+ */
+HWTEST_F(AddPermissionUsedRecordTest, AddPermissionUsedRecord_001, TestSize.Level1)
+{
+    int32_t successCount = 1;
+    int32_t fasilCount = 0;
+    std::string permission = "ohon.permission.READ_CONTACTS";
+    AccessTokenID tokenID = AccessTokenKit::GetHapTokenID(g_InfoParmsA.userID,
+                                                          g_InfoParmsA.bundleName,
+                                                          g_InfoParmsA.instIndex);
+    int32_t ret = PrivacyKit::AddPermissionUsedRecord(0, permission, successCount, fasilCount);
+    ASSERT_EQ(RET_FAILED, ret);
+
+    ret = PrivacyKit::AddPermissionUsedRecord(tokenID, "", successCount, fasilCount);
+    ASSERT_EQ(RET_FAILED, ret);
+}
diff --git a/services/privacymanager/test/add_permission_used_record_test/add_permission_used_record_test.h b/services/privacymanager/test/add_permission_used_record_test/add_permission_used_record_test.h
index 8f6f83d318ffc07700083e1b442c73945c12461d..ad18b7d11d10c3cd2b5186faab6eb32e3a098438 100644
--- a/services/privacymanager/test/add_permission_used_record_test/add_permission_used_record_test.h
+++ b/services/privacymanager/test/add_permission_used_record_test/add_permission_used_record_test.h
@@ -1,37 +1,37 @@
-/*
- * Copyright (c) 2022 Huawei Device Co., Ltd.
- * Licensed under the Apache License, Version 2.0 (the "License");
- * you may not use this file except in compliance with the License.
- * You may obtain a copy of the License at
- *
- *     http://www.apache.org/licenses/LICENSE-2.0
- *
- * Unless required by applicable law or agreed to in writing, software
- * distributed under the License is distributed on an "AS IS" BASIS,
- * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
- * See the License for the specific language governing permissions and
- * limitations under the License.
- */
-
-#ifndef ADD_PERMISSION_USED_RECORD_TEST_H
-#define ADD_PERMISSION_USED_RECORD_TEST_H
-
-#include <gtest/gtest.h>
-
-namespace OHOS {
-namespace Security {
-namespace AccessToken {
-class AddPermissionUsedRecordTest : public testing::Test {
-public:
-    static void SetUpTestCase();
-
-    static void TearDownTestCase();
-
-    void SetUp();
-
-    void TearDown();
-};
-} // namespace AccessToken
-} // namespace Security
-} // namespace OHOS
-#endif // ADD_PERMISSION_USED_RECORD_TEST_H
+/*
+ * Copyright (c) 2022 Huawei Device Co., Ltd.
+ * Licensed under the Apache License, Version 2.0 (the "License");
+ * you may not use this file except in compliance with the License.
+ * You may obtain a copy of the License at
+ *
+ *     http://www.apache.org/licenses/LICENSE-2.0
+ *
+ * Unless required by applicable law or agreed to in writing, software
+ * distributed under the License is distributed on an "AS IS" BASIS,
+ * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied.
+ * See the License for the specific language governing permissions and
+ * limitations under the License.
+ */
+
+#ifndef ADD_PERMISSION_USED_RECORD_TEST_H
+#define ADD_PERMISSION_USED_RECORD_TEST_H
+
+#include <gtest/gtest.h>
+
+namespace OHOS {
+namespace Security {
+namespace AccessToken {
+class AddPermissionUsedRecordTest : public testing::Test {
+public:
+    static void SetUpTestCase();
+
+    static void TearDownTestCase();
+
+    void SetUp();
+
+    void TearDown();
+};
+} // namespace AccessToken
+} // namespace Security
+} // namespace OHOS
+#endif // ADD_PERMISSION_USED_RECORD_TEST_H